SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Multiheme cytochromes alignments

These alignments are sequences aligned to the 0045679 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d19hca_                              a..............................................................
gi|269926701|ref|YP_003323324.1|   snyatrid.......................................................
TLn_gi|427724729|ref|YP_007072006.1| n..............................................................
TLn_gi|427724728|ref|YP_007072005.1| iatclaligwfaaafalnakqvfipgetsvghy..............................
Cy2_gi|428218884|ref|YP_007103349.1| iteqwqgsahaianincsschldqetealiskp..............................
Cy2_gi|428218885|ref|YP_007103350.1| iivmvllvvlttwlaaafaldqrsvflpgetshghmvi.........................
gi|257060488|ref|YP_003138376.1|   s..............................................................
gi|166366918|ref|YP_001659191.1|   ncatchiaippsilpsqtwkkilenpnshygirlkpivgitqrliwdylsyssrpltqttfvp
gi|75910524|ref|YP_324820.1|       ynptrmkniekathnllqkiss.........................................
gi|17229585|ref|NP_486133.1|       kissc..........................................................
UBy_gi|414077420|ref|YP_006996738.1| ipqevrtyvfqr...................................................
gi|256827741|ref|YP_003151700.1|   ahswadqypnqystflsndentwpegkaskdelypemvtlgkgygyakffmepgghtyamytv
gi|256826940|ref|YP_003150899.1|   ivivvavagigfwnwhnqptfcnafchesmnayvetyeqd.......................
gi|256827740|ref|YP_003151699.1|   iavvialagvgfwewhetpgfc.........................................
gi|256827321|ref|YP_003151280.1|   vwwawsivalvplvgviaylllrpsllemdrseqeleialkqrelmkyge.............
IBJ_gi|339443845|ref|YP_004709849.1| kaaswatiypeecetymmnasnspdsgkhnylelypalntmykgyafalgydeasshlytlqs
IBJ_gi|339446157|ref|YP_004712161.1| kgdliqvtwsa....................................................
IBJ_gi|339444403|ref|YP_004710407.1| gvgvlavilavagagfwvwheqpsfcdalc.................................
IBJ_gi|339444455|ref|YP_004710459.1| gfgiwheqpsfcna.................................................
IBJ_gi|339445173|ref|YP_004711177.1| spdq...........................................................
IBJ_gi|339445234|ref|YP_004711238.1| v..............................................................
IBJ_gi|339443846|ref|YP_004709850.1| vviaagagfwvwheqpsfcnaichtpmdpylptyeaepgqpavdkwgnev.............
IBJ_gi|339445886|ref|YP_004711890.1| fka............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ysnk...........................................................
IBJ_gi|339444003|ref|YP_004710007.1| vatttngeppvips.................................................
gi|257792322|ref|YP_003182928.1|   aeswkdaypdqyasymenksnaplqdggdkhnylelypalntmykgyafalgydeaashlytl
gi|257790295|ref|YP_003180901.1|   tme............................................................
gi|257790301|ref|YP_003180907.1|   pvnwtmds.......................................................
gi|257790348|ref|YP_003180954.1|   sa.............................................................
gi|257790760|ref|YP_003181366.1|   agagfwvwheqpsfcna..............................................
gi|257792421|ref|YP_003183027.1|   sada...........................................................
gi|257792321|ref|YP_003182927.1|   vvliaagagfwvwheqpsfcaaichtpmdeyletyeqepgttgvdkw................
gi|257792266|ref|YP_003182872.1|   vvliaagagfwvwheqpsfcaaichtpmdeyletyeqeagtagvdkwg...............
gi|257790166|ref|YP_003180772.1|   dn.............................................................
gi|257790742|ref|YP_003181348.1|   deyp...........................................................
gi|257791145|ref|YP_003181751.1|   vt.............................................................
gi|257790421|ref|YP_003181027.1|   eggtsynnyyldad.................................................
gi|257792620|ref|YP_003183226.1|   gay............................................................
gi|257790072|ref|YP_003180678.1|   lvqpvpadelgwnntyldadk..........................................
gi|257790395|ref|YP_003181001.1|   gayv...........................................................
gi|257790768|ref|YP_003181374.1|   nn.............................................................
gi|257790846|ref|YP_003181452.1|   snsyntywldadn..................................................
gi|257791488|ref|YP_003182094.1|   grfenlg........................................................
gi|257792038|ref|YP_003182644.1|   npfdrealarralelhgmkyncaqavactl.................................
gi|257063543|ref|YP_003143215.1|   taeqwkdiypnqyatyvknkenqpvdyaeengptedtttiadegydaaeaeanaaekvsyldt
gi|257062798|ref|YP_003142470.1|   estmrgyaeqfpleynssqmtrvnakgftighdvgtlrdicerpvmrdvngdiewnedgtmsv
gi|257063165|ref|YP_003142837.1|   gy.............................................................
gi|257063496|ref|YP_003143168.1|   aaagagfwvwhgtpgfcsaichtpmdayvetyvdgthdkygneltdesaqnammarmhgqm..
gi|257063059|ref|YP_003142731.1|   hesigqdisgvtev.................................................
gi|257064375|ref|YP_003144047.1|   ylhad..........................................................
gi|257063053|ref|YP_003142725.1|   cdschtdgladlvendlslthykidfglgt.................................
gi|257064996|ref|YP_003144668.1|   tgmypdtawnknflnag..............................................
gi|257063493|ref|YP_003143165.1|   aqhqkyidrp.....................................................
D6J_gi|470176640|ref|YP_007562684.1| v..............................................................
gi|291301089|ref|YP_003512367.1|   pattldcvdefnk..................................................
Inz_gi|386835930|ref|YP_006250098.1| prq............................................................
fvt_gi|397670638|ref|YP_006512173.1| lddstydpavwgknfpiqyeqykktaedtdgdfvkvdptaddpreyhtlsriemepraqlmwr
fvt_gi|397670639|ref|YP_006512174.1| gvgvftvfysgste.................................................
JDb_gi|494685058|ref|YP_007950632.1| whaeawlcarcdrqvraapcaqcgkvre...................................
GJn_gi|397654823|ref|YP_006495506.1| nidenvvdpaewgknfplqyesylktsemgatthggsvkesrqpddkdprtevaksrieedpr
GJn_gi|397654824|ref|YP_006495507.1| vvqilaifvigsfvgvglytfiyakgys...................................
FP7_gi|379716143|ref|YP_005304480.1| nidenvvdpaewgknfplqyesylktsemgatthggsakesrqpddkdprtevaksrieedpr
FP7_gi|379716144|ref|YP_005304481.1| sfvgmglytfiyakgysy.............................................
gi|317124994|ref|YP_004099106.1|   eltnktydpavwgqnfpaeyegwqateemepkdvekraatpedprtivaqqklvkdprlvtmw
gi|317124995|ref|YP_004099107.1|   vrrwflpivgvlvgvlvglsfftfgyangsa................................
gi|317125004|ref|YP_004099116.1|   dngphvstatnnttfvdgqptngvkisdag.................................
gi|317124997|ref|YP_004099109.1|   hysegasfcttchtmepqkkayeagvhqdvacgechvepgvlgfvkaklagtrelyalvtnty
gi|317125003|ref|YP_004099115.1|   pgasttsgqcgvchqthsaksqnlvkkss..................................
gi|283455668|ref|YP_003360232.1|   tea............................................................
gi|297572021|ref|YP_003697795.1|   tkiddttfdsetwgqnfprqyegfkatsklneerkipntepnvpedkrefktrskleieprlv
gi|297572022|ref|YP_003697796.1|   alglvigiggvtlhyagft............................................
sZN_gi|383763452|ref|YP_005442434.1| eipdneidpavwglnfpiqydsfkrteenygpttyggsepysklerypamvrlwagmpfsvdh
sZN_gi|383763451|ref|YP_005442433.1| tfvyaegfsyf....................................................
sZN_gi|383761442|ref|YP_005440424.1| vdpt...........................................................
gi|57233597|ref|YP_180800.1|       saqslheqgfncaqsilgafapslgietgtafklasafgggmagrgdscgv............
gi|147668693|ref|YP_001213511.1|   saqilhekgfncaqsllaafapslgietgtalklasafgggma....................

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   llie...........................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   mnngrvsd.......................................................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| vketprttqk.....................................................
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   qsvketprttqke..................................................
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   ...............................................................
gi|257063543|ref|YP_003143215.1|   npeikilglgygyakyytepaghvyslwtvthngris..........................
gi|257062798|ref|YP_003142470.1|   ftseydeesgqyivpdltdeqleelnlks..................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   ...............................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   ...............................................................
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| gyafsvdyteprghewaledqkhtqrtqpkfk...............................
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| lkemwsgyafavdyrearghqymlddqrktkrvtefk..........................
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| lkemwagyafavdyrearghqymlddqrktkrvtefkq.........................
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   qgyafaidyreprghaymlldqrhtrrtlerpqpg............................
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   ...............................................................
gi|317124997|ref|YP_004099109.1|   ptpipaiehdalptteqtcekchplsqiakdgqptklitrasfsrdekntrndlavlirpaqa
gi|317125003|ref|YP_004099115.1|   ...............................................................
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   siwkgyafsveyneprgheymledqkfvkrmtdfkqp..........................
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| neerghyy.......................................................
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| ...............................................................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   ...............................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   ...............................................................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| ...............................................................
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   ...............................................................
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   ...............................................................
gi|257063543|ref|YP_003143215.1|   ...............................................................
gi|257062798|ref|YP_003142470.1|   ...............................................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   ...............................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   ...............................................................
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| ...............................................................
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| ...............................................................
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| ...............................................................
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   ...............................................................
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   ...............................................................
gi|317124997|ref|YP_004099109.1|   gtadevsmhwhvlqevtytsteehqqtidsvefrdsktgelvqyiaegavrqsanadadiarl
gi|317125003|ref|YP_004099115.1|   ...............................................................
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   ...............................................................
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| ...............................................................
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| ...............................................................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   ...............................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   ...............................................................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| ...............................................................
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   ...............................................................
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   ...............................................................
gi|257063543|ref|YP_003143215.1|   ...............................................................
gi|257062798|ref|YP_003142470.1|   ...............................................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   ...............................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   ...............................................................
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| ...............................................................
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| ...............................................................
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| ...............................................................
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   ...............................................................
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   ...............................................................
gi|317124997|ref|YP_004099109.1|   katgstrtmdclachnrvghdipsvdkavdqamasgaisptlpyikrnaitllnrtyatdedg
gi|317125003|ref|YP_004099115.1|   ...............................................................
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   ...............................................................
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| ...............................................................
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| ...............................................................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ..........................................................-ALEP
gi|269926701|ref|YP_003323324.1|   ..........................................................-----
TLn_gi|427724729|ref|YP_007072006.1| ..........................................................-----
TLn_gi|427724728|ref|YP_007072005.1| ..........................................................-----
Cy2_gi|428218884|ref|YP_007103349.1| ..........................................................-----
Cy2_gi|428218885|ref|YP_007103350.1| ..........................................................-----
gi|257060488|ref|YP_003138376.1|   ..........................................................-----
gi|166366918|ref|YP_001659191.1|   ..........................................................-----
gi|75910524|ref|YP_324820.1|       ..........................................................-----
gi|17229585|ref|NP_486133.1|       ..........................................................-----
UBy_gi|414077420|ref|YP_006996738.1| ..........................................................-----
gi|256827741|ref|YP_003151700.1|   ..........................................................-----
gi|256826940|ref|YP_003150899.1|   ..........................................................-----
gi|256827740|ref|YP_003151699.1|   ..........................................................-----
gi|256827321|ref|YP_003151280.1|   ..........................................................-----
IBJ_gi|339443845|ref|YP_004709849.1| ..........................................................-----
IBJ_gi|339446157|ref|YP_004712161.1| ..........................................................-----
IBJ_gi|339444403|ref|YP_004710407.1| ..........................................................-----
IBJ_gi|339444455|ref|YP_004710459.1| ..........................................................-----
IBJ_gi|339445173|ref|YP_004711177.1| ..........................................................-----
IBJ_gi|339445234|ref|YP_004711238.1| ..........................................................-----
IBJ_gi|339443846|ref|YP_004709850.1| ..........................................................-----
IBJ_gi|339445886|ref|YP_004711890.1| ..........................................................-----
IBJ_gi|339445619|ref|YP_004711623.1| ..........................................................-----
IBJ_gi|339444003|ref|YP_004710007.1| ..........................................................-----
gi|257792322|ref|YP_003182928.1|   ..........................................................-----
gi|257790295|ref|YP_003180901.1|   ..........................................................-----
gi|257790301|ref|YP_003180907.1|   ..........................................................-----
gi|257790348|ref|YP_003180954.1|   ..........................................................-----
gi|257790760|ref|YP_003181366.1|   ..........................................................-----
gi|257792421|ref|YP_003183027.1|   ..........................................................-----
gi|257792321|ref|YP_003182927.1|   ..........................................................-----
gi|257792266|ref|YP_003182872.1|   ..........................................................-----
gi|257790166|ref|YP_003180772.1|   ..........................................................-----
gi|257790742|ref|YP_003181348.1|   ..........................................................-----
gi|257791145|ref|YP_003181751.1|   ..........................................................-----
gi|257790421|ref|YP_003181027.1|   ..........................................................-----
gi|257792620|ref|YP_003183226.1|   ..........................................................-----
gi|257790072|ref|YP_003180678.1|   ..........................................................-----
gi|257790395|ref|YP_003181001.1|   ..........................................................-----
gi|257790768|ref|YP_003181374.1|   ..........................................................-----
gi|257790846|ref|YP_003181452.1|   ..........................................................-----
gi|257791488|ref|YP_003182094.1|   ..........................................................-----
gi|257792038|ref|YP_003182644.1|   ..........................................................-----
gi|257063543|ref|YP_003143215.1|   ..........................................................-----
gi|257062798|ref|YP_003142470.1|   ..........................................................-----
gi|257063165|ref|YP_003142837.1|   ..........................................................-----
gi|257063496|ref|YP_003143168.1|   ..........................................................-----
gi|257063059|ref|YP_003142731.1|   ..........................................................-----
gi|257064375|ref|YP_003144047.1|   ..........................................................-----
gi|257063053|ref|YP_003142725.1|   ..........................................................-----
gi|257064996|ref|YP_003144668.1|   ..........................................................-----
gi|257063493|ref|YP_003143165.1|   ..........................................................-----
D6J_gi|470176640|ref|YP_007562684.1| ..........................................................-----
gi|291301089|ref|YP_003512367.1|   ..........................................................-----
Inz_gi|386835930|ref|YP_006250098.1| ..........................................................-----
fvt_gi|397670638|ref|YP_006512173.1| ..........................................................-----
fvt_gi|397670639|ref|YP_006512174.1| ..........................................................-----
JDb_gi|494685058|ref|YP_007950632.1| ..........................................................-----
GJn_gi|397654823|ref|YP_006495506.1| ..........................................................-----
GJn_gi|397654824|ref|YP_006495507.1| ..........................................................-----
FP7_gi|379716143|ref|YP_005304480.1| ..........................................................-----
FP7_gi|379716144|ref|YP_005304481.1| ..........................................................-----
gi|317124994|ref|YP_004099106.1|   ..........................................................-----
gi|317124995|ref|YP_004099107.1|   ..........................................................-----
gi|317125004|ref|YP_004099116.1|   ..........................................................-----
gi|317124997|ref|YP_004099109.1|   eaaignlaelysadypavakdkakeiaaaskaiagiyelvvtsemntrggtyadnlgh-----
gi|317125003|ref|YP_004099115.1|   ..........................................................-----
gi|283455668|ref|YP_003360232.1|   ..........................................................-----
gi|297572021|ref|YP_003697795.1|   ..........................................................-----
gi|297572022|ref|YP_003697796.1|   ..........................................................-----
sZN_gi|383763452|ref|YP_005442434.1| ..........................................................-----
sZN_gi|383763451|ref|YP_005442433.1| ..........................................................-----
sZN_gi|383761442|ref|YP_005440424.1| ..........................................................-----
gi|57233597|ref|YP_180800.1|       ..........................................................-----
gi|147668693|ref|YP_001213511.1|   ..........................................................-----

                                        10        20        30        40         50               60
                                         |         |         |         |          |                |
gi|269926701|ref|YP_003323324.1|   ---------------------FTPAQPVPFSHAHHVGGDGiDCRYCHT...S.VET-...---
TLn_gi|427724729|ref|YP_007072006.1| ----------------------------------------.-------...-.----...---
TLn_gi|427724728|ref|YP_007072005.1| ------------------------------------LFEA.SCASCHE...G.FKPVtneTCT
Cy2_gi|428218884|ref|YP_007103349.1| -------------------------------------DHE.SCRTCHE...Q.A--V...ATF
Cy2_gi|428218885|ref|YP_007103350.1| --------------------------------------EA.SCSSCHEgfkP.ITNE...TCL
gi|257060488|ref|YP_003138376.1|   ----------------------------------------.-------...-.----...---
gi|166366918|ref|YP_001659191.1|   ----------------------------------------.-------...-.----...---
gi|75910524|ref|YP_324820.1|       ----------------------------------------.-------...-.----...---
gi|17229585|ref|NP_486133.1|       ----------------------------------------.-------...-.----...---
UBy_gi|414077420|ref|YP_006996738.1| -------------------------------------DKN.QCQSCGK...I.SQET...QLS
gi|256827741|ref|YP_003151700.1|   ------------------------------------KTKA.QCLACKT...P.N--L...HFE
gi|256826940|ref|YP_003150899.1|   ----------------------------------------.-------...-.----...---
gi|256827740|ref|YP_003151699.1|   ----------------------------------------.-AAICHN...M.DQYLd..TYS
gi|256827321|ref|YP_003151280.1|   ----------------------------------------.-------...-.----...---
IBJ_gi|339443845|ref|YP_004709849.1| ------------------------------------EQLA.NCITCKT...P.Q---...---
IBJ_gi|339446157|ref|YP_004712161.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339444403|ref|YP_004710407.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339444455|ref|YP_004710459.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339445173|ref|YP_004711177.1| ----------------------------------------.ECAPCHS...I.E---...---
IBJ_gi|339445234|ref|YP_004711238.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339443846|ref|YP_004709850.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339445886|ref|YP_004711890.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339445619|ref|YP_004711623.1| ----------------------------------------.-------...-.----...---
IBJ_gi|339444003|ref|YP_004710007.1| ----------------------------------------.-------...-.----...---
gi|257792322|ref|YP_003182928.1|   -------------------------------------QLA.GCITCKT...P.Q--F...TAM
gi|257790295|ref|YP_003180901.1|   ----------------------------------------.-------...-.----...---
gi|257790301|ref|YP_003180907.1|   ----------------------------------------.-------...-.----...DCS
gi|257790348|ref|YP_003180954.1|   ----------------------------------------.-------...-.----...---
gi|257790760|ref|YP_003181366.1|   ----------------------------------------.---ICHT...P.MDPY...VE-
gi|257792421|ref|YP_003183027.1|   ----------------------------------------.-------...-.----...DCG
gi|257792321|ref|YP_003182927.1|   ----------------------------------------.-------...-.----...---
gi|257792266|ref|YP_003182872.1|   ----------------------------------------.-------...-.----...---
gi|257790166|ref|YP_003180772.1|   ---------------------------------------R.GCNSCHA...D.MN--...---
gi|257790742|ref|YP_003181348.1|   ----------------------------------------.-------...-.----...---
gi|257791145|ref|YP_003181751.1|   ----------------------------------------.-------...-.----...---
gi|257790421|ref|YP_003181027.1|   --------------------------------------NR.G------...-.----...-CG
gi|257792620|ref|YP_003183226.1|   ----------------------------------------.-------...-.----...---
gi|257790072|ref|YP_003180678.1|   ----------------------------------------.-------...-.---R...GCT
gi|257790395|ref|YP_003181001.1|   ----------------------------------------.-------...-.----...---
gi|257790768|ref|YP_003181374.1|   ----------------------------------------.-------...-.----...---
gi|257790846|ref|YP_003181452.1|   ---------------------------------------R.GCESCHA...D.MNSL...LKH
gi|257791488|ref|YP_003182094.1|   ----------------------------------------.-------...-.----...---
gi|257792038|ref|YP_003182644.1|   ----------------------------------------.-------...-.----...---
gi|257063543|ref|YP_003143215.1|   -----------------------------------EKSGA.GCWACKT...P.Q--F...SNY
gi|257062798|ref|YP_003142470.1|   ----------------------------------------.GCVACKS...S.KF--...--N
gi|257063165|ref|YP_003142837.1|   ----------------------------------------.-------...-.----...---
gi|257063496|ref|YP_003143168.1|   ----------------------------------------.-------...-.----...---
gi|257063059|ref|YP_003142731.1|   ----------------------------------------.-------...-.----...---
gi|257064375|ref|YP_003144047.1|   --------------------------------------QR.GCKSCHS...DlADLV...WNS
gi|257063053|ref|YP_003142725.1|   ----------------------------------------.-------...-.----...---
gi|257064996|ref|YP_003144668.1|   --------------------------------------NR.GCNSCHE...S.----...---
gi|257063493|ref|YP_003143165.1|   ---------------------------------------AyKCYKCHG...A.-SEK...GNP
D6J_gi|470176640|ref|YP_007562684.1| ----------------------------------------.-------...-.----...---
gi|291301089|ref|YP_003512367.1|   ----------------------------------------.-------...-.----...---
Inz_gi|386835930|ref|YP_006250098.1| ----------------------------------------.-------...-.----...---
fvt_gi|397670638|ref|YP_006512173.1| -------------------------------------QPG.TCLNCHAsm.P.EVYD...KLG
fvt_gi|397670639|ref|YP_006512174.1| ----------------------------------------.-------...-.----...---
JDb_gi|494685058|ref|YP_007950632.1| ----------------------------------------.-------...-.----...---
GJn_gi|397654823|ref|YP_006495506.1| -------------------------------------QPG.TCLNCHA...S.----...---
GJn_gi|397654824|ref|YP_006495507.1| ----------------------------------------.-------...-.----...---
FP7_gi|379716143|ref|YP_005304480.1| --------------------------------------PG.TCLNCHA...S.----...---
FP7_gi|379716144|ref|YP_005304481.1| ----------------------------------------.-------...-.----...---
gi|317124994|ref|YP_004099106.1|   ----------------------------------------.ACLNCHA...S.L--P...EI-
gi|317124995|ref|YP_004099107.1|   ----------------------------------------.-------...-.----...---
gi|317125004|ref|YP_004099116.1|   ----------------------------------------.-------...-.----...---
gi|317124997|ref|YP_004099109.1|   ----------------------------------------.-------...-.----...---
gi|317125003|ref|YP_004099115.1|   ----------------------------------------.-------...-.-ETD...QCY
gi|283455668|ref|YP_003360232.1|   ----------------------------------------.-------...-.----...---
gi|297572021|ref|YP_003697795.1|   ---------------------------------------G.ACLNCHAsi.P.QVVN...SIN
gi|297572022|ref|YP_003697796.1|   ----------------------------------------.-------...-.----...---
sZN_gi|383763452|ref|YP_005442434.1| ----------------------------------------.-------...-.----...---
sZN_gi|383763451|ref|YP_005442433.1| ----------------------------------------.-------...-.----...---
sZN_gi|383761442|ref|YP_005440424.1| ----------------------------------------.SCQSCHT...T.P--I...YGA
gi|57233597|ref|YP_180800.1|       ----------------------------------------.-------...-.----...---
gi|147668693|ref|YP_001213511.1|   ----------------------------------------.-------...-.----...---

                                             70         80         90        100                110 
                                              |          |          |          |                  | 
d19hca_                              TCHTVEGKAE.GDYITLDRAMHAT.DIAARAK.GNTPTSCVSCHQSE.....TKE....RRE.
gi|269926701|ref|YP_003323324.1|   ----------.------------S.SFAGIP-.--PTKTCMNCHSQI.....WTN....SP-.
TLn_gi|427724729|ref|YP_007072006.1| ----------.-------------.-------.---DVNCASCHQDE.....ETK....EF-.
TLn_gi|427724728|ref|YP_007072005.1| RCHEAELEQ-.--DIHGTKKFRDP.RWAGDLE.KIEALTCTTCHAEH.....VHM....---.
Cy2_gi|428218884|ref|YP_007103349.1| LLGKHGIRLN.EGMTPLTPAMAQI.PMKEAAM.D-KQMTCNTCHDV-.....---....---.
Cy2_gi|428218885|ref|YP_007103350.1| RCHEAEMAED.EHGT---KKFRDP.RWAELME.EI------------.....---....---.
gi|257060488|ref|YP_003138376.1|   ----------.-------------.-------.--------------.....---....---.
gi|166366918|ref|YP_001659191.1|   ----------.-------------.-------.--------------.....---....---.
gi|75910524|ref|YP_324820.1|       ----------.-------------.-------.--------------.....---....---.
gi|17229585|ref|NP_486133.1|       ----------.-------------.-------.--------------.....---....---.
UBy_gi|414077420|ref|YP_006996738.1| IDHIIPLSRG.GKN----------.DIS----.-NLQTLCLICNQQK.....---....---.
gi|256826940|ref|YP_003150899.1|   -ANTQGTDKW.GNAVSNTNAMLA-.----VTH.KEAGVNCLGCHVPT.....ITQ....QLT.
gi|256827321|ref|YP_003151280.1|   ----------.-------------.-------.--------------.....---....---.
IBJ_gi|339443845|ref|YP_004709849.1| --FTRLVETE.GDGVY---AQKFN.DTIGQF-.-DENISCYNCHEND.....PET....-LN.
IBJ_gi|339446157|ref|YP_004712161.1| ----------.-------------.-------.---ESDCESCHTTE.....AGA....RTD.
IBJ_gi|339444403|ref|YP_004710407.1| ----------.-------------.-------.--------------.....---....---.
IBJ_gi|339444455|ref|YP_004710459.1| ----------.-------------.-------.--------------.....---....---.
IBJ_gi|339445173|ref|YP_004711177.1| -AHTAAASAC.TDFSD--------.-------.--ASSSCLTCHNVE.....QEL....TVA.
IBJ_gi|339445234|ref|YP_004711238.1| ----------.-------------.-------.-----SCLQCHEAK.....IDE....QVTe
IBJ_gi|339443846|ref|YP_004709850.1| ----------.---ENASSMMAAL.HRVSKDQ.GGADATCLSCHVPD.....IGE....QMTe
IBJ_gi|339445886|ref|YP_004711890.1| ----------.-------------.-------.---DLNCAGCHENE.....A--....VSA.
IBJ_gi|339445619|ref|YP_004711623.1| ----------.-------------.-------.--------------.....---....---.
IBJ_gi|339444003|ref|YP_004710007.1| ----------.-------------.DHVGRYD.GNGSTDCYQCHGSD.....GKN....NPSl
gi|257792322|ref|YP_003182928.1|   VNDEGEGVYK.EKFNDLIGE----.-------.FTEPVSCYNCHEND.....PQS....-LK.
gi|257790295|ref|YP_003180901.1|   ----------.-------------.-------.----SDCSMCHTSE.....AES....AT-.
gi|257790301|ref|YP_003180907.1|   MCHTVEAASA.TDASCPQASAHEA.E------.---GVTCVQCHTDE.....AVL....STE.
gi|257790348|ref|YP_003180954.1|   ----------.-------------.-------.---DSECGTCHATE.....-QA....SYD.
gi|257790760|ref|YP_003181366.1|   -------DYY.ADDATLLAASHRV.-------.--ADVSCLDCHVPT.....LSE....QLAe
gi|257792421|ref|YP_003183027.1|   LCHATQSSSL.TDSSCQVSANH--.-------.--ANLQCVQCHTDEng...LAA....AHDg
gi|257792321|ref|YP_003182927.1|   ----------.GNE----------.-------.--------------.....---....-VS.
gi|257792266|ref|YP_003182872.1|   ----------.-------------.-------.--------------.....--N....EVA.
gi|257790166|ref|YP_003180772.1|   --AMIENMEY.KHATIDNKALETY.S------.--DVNQCISCHRDN.....GDD....FGR.
gi|257790742|ref|YP_003181348.1|   ----------.-------------.-------.--------------.....---....---.
gi|257791145|ref|YP_003181751.1|   ----------.-------------.-------.------CLKCHEAK.....LSD....QVAe
gi|257790421|ref|YP_003181027.1|   ACHEDLGDAL.ANMEYSHPTVW--.-NDALGS.KITVDQCMLCHSADdg...YEM....GTV.
gi|257792620|ref|YP_003183226.1|   ----------.-------------.-------.--------------.....---....---.
gi|257790072|ref|YP_003180678.1|   SCHTLENA--.---LMSLPTYHRL.IFFGYPT.EQGYQNCIACHSDS.....YSG....-HK.
gi|257790395|ref|YP_003181001.1|   ----------.-------------.-------.--------------.....---....---.
gi|257790768|ref|YP_003181374.1|   ----------.-------------.-------.--------------.....---....---.
gi|257790846|ref|YP_003181452.1|   L-------PY.EHPVAWNDELDNK.T------.--TLQQCLFCHSYA.....---....---.
gi|257791488|ref|YP_003182094.1|   ----------.-------------.-------.---AAGCYGCHGAN.....DQA....NPMl
gi|257792038|ref|YP_003182644.1|   ----------.-------------.-------.--------------.....---....---.
gi|257063543|ref|YP_003143215.1|   V------DEN.GNEVFKEKFLSMD.GWF----.-TEGISCASCHAND.....PTGfeidRAQw
gi|257062798|ref|YP_003142470.1|   DIYAAQGPAA.YGNVY-------N.GEARAIV.NDEYWDCAMCHDGT.....PSA....DNVg
gi|257063165|ref|YP_003142837.1|   ----------.-------------.-------.-----DCTSCHGSD.....LPD....QLSg
gi|257063496|ref|YP_003143168.1|   ----------.-------------.-------.--GTADCLACHVPT.....LSE....Q--.
gi|257063059|ref|YP_003142731.1|   ----------.-------------.-------.--------------.....---....---.
gi|257064375|ref|YP_003144047.1|   E---------.--------YYH-P.GRYGLNV.EWTVQTCRGCHSTSgygidITE....-DN.
gi|257063053|ref|YP_003142725.1|   ----------.-------------.-------.VKNVSDCLRCHELA.....PET....APAh
gi|257064996|ref|YP_003144668.1|   ----LTSVIE.GAGLPADHPVPKV.GYANDRN.VTILDGCLSCHDVHs....ADY....GNY.
gi|257063493|ref|YP_003143165.1|   TVSTSRAMPA.GHYVDNDPSSFQL.DP-----.--SREECRTCHSV-.....---....---.
D6J_gi|470176640|ref|YP_007562684.1| ----------.-------------.-------.--------------.....---....---.
gi|291301089|ref|YP_003512367.1|   ----------.-------------.-------.--------------.....---....---.
Inz_gi|386835930|ref|YP_006250098.1| ----------.-------------.-------.--------------.....---....---.
fvt_gi|397670638|ref|YP_006512173.1| NGDRMAGFHA.MNSMSYEEAVQH-.-------.ASSTIACIDCHDPK.....TMEl...RITr
fvt_gi|397670639|ref|YP_006512174.1| ----------.-------------.-----YL.GDDPASCANCHAMN.....EQY....EGW.
JDb_gi|494685058|ref|YP_007950632.1| ----------.-------------.-------.--------------.....---....---.
GJn_gi|397654824|ref|YP_006495507.1| ----------.-------------.-----YL.GNDPKACVNCHVME.....PQY....NAW.
FP7_gi|379716144|ref|YP_005304481.1| ----------.-------------.------L.GNDPKACVNCHVME.....PQY....NAW.
gi|317124994|ref|YP_004099106.1|   ----TTALGN.GDEAAGWAAMNKM.PYTDATKlATHPVGCIDCHEPE.....TMAl...RVTr
gi|317124995|ref|YP_004099107.1|   ----------.-------------.-----YF.GKDPQACAQCHSMN.....DQF....TAW.
gi|317125004|ref|YP_004099116.1|   ----------.-------------.-------.---QGRCASCHRAH.....TA-....---.
gi|317124997|ref|YP_004099109.1|   ----------.-------------.-------.-QSSPGCFRCHDGA.....HYK....VVE.
gi|317125003|ref|YP_004099115.1|   TCH--AGGTG.GADVQAQYALGQP.ANDPTTR.SY------WSHDTT.....DPG....DHT.
gi|283455668|ref|YP_003360232.1|   ----------.-------------.-------.--------------.....---....---.
gi|297572021|ref|YP_003697795.1|   PNDPADGWAQ.MNKMPYDEAVQ--.------H.ANGPIGCIDCHDPKt....MKL....RVSr
gi|297572022|ref|YP_003697796.1|   ----------.-------------.----KYF.GNDPQTCNSCHAMN.....EQY....DGY.
sZN_gi|383763452|ref|YP_005442434.1| ----------.----S---QIDQR.NTKRVEV.ANQPGACINCHAAE.....APL....LIA.
sZN_gi|383763451|ref|YP_005442433.1| ----------.-------------.-------.SDDPNACVNCHIMR.....EQF....DGW.
sZN_gi|383761442|ref|YP_005440424.1| WRGSMK-SQA.GRDPLFWAALH--.-IANQDV.ENAGDFCLRCHTPRgw...FSGr...SHP.
gi|57233597|ref|YP_180800.1|       ----------.-------------.-------.--------------.....---....---.
gi|147668693|ref|YP_001213511.1|   ----------.-------------.-------.--------------.....---....---.

d19hca_                              ............CAG..........C......HA..I..........TTPKD.....DEAWCA
gi|269926701|ref|YP_003323324.1|   ............---..........-......--..-..........-----.....------
TLn_gi|427724729|ref|YP_007072006.1| ............---..........-......--..-..........--VAQ.....PKASCR
TLn_gi|427724728|ref|YP_007072005.1| ............---..........-......-F..D..........RGVNL.....QPDLCM
Cy2_gi|428218884|ref|YP_007103349.1| ............---..........-......HS..A..........NTTVA.....AADSCL
Cy2_gi|428218885|ref|YP_007103350.1| ............---..........-......--..-..........-----.....------
gi|257060488|ref|YP_003138376.1|   ............---..........-......--..-..........-----.....------
gi|166366918|ref|YP_001659191.1|   ............---..........-......--..-..........-----.....------
gi|75910524|ref|YP_324820.1|       ............---..........-......--..-..........-----.....------
gi|17229585|ref|NP_486133.1|       ............---..........-......--..-..........-----.....------
UBy_gi|414077420|ref|YP_006996738.1| ............---..........-......--..-..........-----.....------
gi|256827741|ref|YP_003151700.1|   ...........lRAD..........W......IR..A..........MGPDAdkrsvSGEVCG
gi|256826940|ref|YP_003150899.1|   ............EVS..........E......T-..-..........-----.....------
gi|256827740|ref|YP_003151699.1|   ............AVG..........F......VS..G..........NYYDP.....LDER--
gi|256827321|ref|YP_003151280.1|   ............---..........-......--..-..........-----.....------
IBJ_gi|339443845|ref|YP_004709849.1| ............VTGqyfvkslgnaA......ND..D..........AAVPM.....AAQVCG
IBJ_gi|339446157|ref|YP_004712161.1| ............ETT..........L......HA..-..........---QH.....AEDACI
IBJ_gi|339444403|ref|YP_004710407.1| ............---..........-......--..-..........-----.....------
IBJ_gi|339444455|ref|YP_004710459.1| ............---..........-......--..-..........-----.....------
IBJ_gi|339445173|ref|YP_004711177.1| ............HED..........I......RN..Vkpvsdl....QQVTV.....EKEVCT
IBJ_gi|339445234|ref|YP_004711238.1| alswvrgdfatdETG..........H......LT..T..........QGVTA.....DSKMCA
IBJ_gi|339443846|ref|YP_004709850.1| ........gmnwI--..........-......-S..G..........-----.....------
IBJ_gi|339445886|ref|YP_004711890.1| ............EAG..........D......CL..Y..........GIEDH.....ADADCV
IBJ_gi|339445619|ref|YP_004711623.1| ............---..........-......--..-..........-----.....------
IBJ_gi|339444003|ref|YP_004710007.1| .stsvalpenhyKDG..........N......VD..S..........LELDP.....LREQCI
gi|257792322|ref|YP_003182928.1|   ............VTG..........S......YF..VkalgndagegSKAPM.....NSQVCG
gi|257790295|ref|YP_003180901.1|   ............DAA..........C......PQ..A..........TAHEA.....EGVACA
gi|257790301|ref|YP_003180907.1|   ............HADvkfgdka...A......TK..A..........TVVTV.....DPETCI
gi|257790348|ref|YP_003180954.1|   ............DAA..........C......VA..S..........T---H.....EGQACI
gi|257790760|ref|YP_003181366.1|   ........gvtwVAG..........G......YA..Lpl........EQRQF.....DNAFCM
gi|257792421|ref|YP_003183027.1|   .......vtladTKG..........A......KK..L..........SKTSV.....EQDACV
gi|257792321|ref|YP_003182927.1|   ............NTN..........A......ML..A..........VSHKA.....QGKDCM
gi|257792266|ref|YP_003182872.1|   ............NTN..........A......ML..A..........VSHKA.....QGKDCM
gi|257790166|ref|YP_003180772.1|   ............LIH..........A......IH..Ynersgn....KFAEG.....SNGTCQ
gi|257790742|ref|YP_003181348.1|   ............---..........-......--..-..........-----.....------
gi|257791145|ref|YP_003181751.1|   glswvrgdfatdETG..........H......LT..T..........HGVTA.....DKKMC-
gi|257790421|ref|YP_003181027.1|   ............MHG..........V......HY..Gerng......ENFEE.....RGGKCI
gi|257792620|ref|YP_003183226.1|   ............---..........-......--..-..........-----.....------
gi|257790072|ref|YP_003180678.1|   ............LAD..........A......IH..Tlhmnst....MFLND.....DDGNCQ
gi|257790395|ref|YP_003181001.1|   ............---..........-......--..-..........-----.....------
gi|257790768|ref|YP_003181374.1|   ............---..........-......--..-..........-----.....------
gi|257790846|ref|YP_003181452.1|   ............---..........-......--..-..........-----.....------
gi|257791488|ref|YP_003182094.1|   .adatalpadhyAGG..........D......AG..S..........LEMDP.....THEQCI
gi|257792038|ref|YP_003182644.1|   ............---..........-......--..-..........-----.....------
gi|257063543|ref|YP_003143215.1|   ..........kdAMG..........A......DV..D..........TVPM-.....ESVVCG
gi|257062798|ref|YP_003142470.1|   .....pqlvyfqALG..........E......GL..V..........EQLDP.....KMAVCA
gi|257063165|ref|YP_003142837.1|   .........ietEDGse........P......EL..T..........STYFV.....DNDKCF
gi|257063496|ref|YP_003143168.1|   ............---..........-......--..-..........-----.....------
gi|257063059|ref|YP_003142731.1|   ............---..........-......--..-..........-----.....------
gi|257064375|ref|YP_003144047.1|   ............KFG..........D......IM..H..........ATHMN.....VETECW
gi|257063053|ref|YP_003142725.1|   ............SFGnl........M......HG..I..........HQGEK.....FNGDCM
gi|257064996|ref|YP_003144668.1|   ............FAD..........Aihna..HYsnV..........GFTEE.....LGGNCW
gi|257063493|ref|YP_003143165.1|   ............---..........-......--..-..........-----.....------
D6J_gi|470176640|ref|YP_007562684.1| ............---..........-......--..-..........-----.....------
gi|291301089|ref|YP_003512367.1|   ............---..........-......--..-..........-----.....------
Inz_gi|386835930|ref|YP_006250098.1| ............---..........-......--..-..........-----.....------
fvt_gi|397670638|ref|YP_006512173.1| pafmegikkakaLEG..........ItdydvnRD..A..........TNQEM.....RTYVCA
fvt_gi|397670639|ref|YP_006512174.1| ............LKG..........S......HH..-..........-----.....DVATCN
JDb_gi|494685058|ref|YP_007950632.1| ............---..........-......--..-..........-----.....------
GJn_gi|397654823|ref|YP_006495506.1| pafangirdlkaSQG..........VkdfdvnRD..A..........THEEM.....RSYVCG
GJn_gi|397654824|ref|YP_006495507.1| ............LAG..........S......HS..A..........V----.....--ATCN
FP7_gi|379716143|ref|YP_005304480.1| pafingirdlkaSQG..........V......KD..Fnvnrda....THEEM.....RSYVCG
FP7_gi|379716144|ref|YP_005304481.1| ............LAG..........S......HS..A..........V----.....--ATCN
gi|317124994|ref|YP_004099106.1|   pafiegikelkaSQG..........V......EN..Ydvnkqa....SFQEM.....RSFVCA
gi|317124995|ref|YP_004099107.1|   ............SNG..........G......HR..H..........V----.....--ATCQ
gi|317125004|ref|YP_004099116.1|   ............--K..........A......PY..L..........LNATS.....EEALCF
gi|317124997|ref|YP_004099109.1|   ............---..........-......-G..Q..........VTKET.....IPSTCN
gi|317125003|ref|YP_004099115.1|   ............LDS..........K......NE..F..........AGALS.....RHSQCS
gi|283455668|ref|YP_003360232.1|   ............---..........-......--..-..........-----.....------
gi|297572021|ref|YP_003697795.1|   pafiegikaakaAEG..........I......KD..Fdvnkda....THQEM.....RTYVCA
gi|297572022|ref|YP_003697796.1|   ............MKG..........S......HA..N..........-----.....-VATCN
sZN_gi|383763452|ref|YP_005442434.1| ............EMG..........W......EA..Fnstpyndl..KDKLH.....FGSSCA
sZN_gi|383763451|ref|YP_005442433.1| ............N--..........-......--..-..........HSTHK.....AVATCN
sZN_gi|383761442|ref|YP_005440424.1| ............ADG..........S......AL..E..........STDLV.....AGVACE
gi|57233597|ref|YP_180800.1|       ............---..........-......--..-..........-----.....------
gi|147668693|ref|YP_001213511.1|   ............---..........-......--..-..........-----.....------

                                        130                    140          150         160         
                                          |                      |            |           |         
d19hca_                              ..T..CH.....DIT........PSMTPSEMQKG...IAGTLL.PGDNEAL.AAETVLA..EA
gi|269926701|ref|YP_003323324.1|   ..-..--.....---........-----------...------.-------.----LLA..PV
TLn_gi|427724729|ref|YP_007072006.1| ..S..CH.....EDSvdtfllgkHGIRLLEGESA...LNPTMA.RLPMHKE.AANLQMG..CA
TLn_gi|427724728|ref|YP_007072005.1| ..A..CH.....EGI........IN---------...------.-------.-------..--
Cy2_gi|428218884|ref|YP_007103349.1| ..T..CH.....NDN........HSLNYEQSRHA...EIFRAK.GNIPRPD.RESVTCA..TC
Cy2_gi|428218885|ref|YP_007103350.1| ..-..--.....---........-----------...------.-------.-------..--
gi|257060488|ref|YP_003138376.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|166366918|ref|YP_001659191.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|75910524|ref|YP_324820.1|       ..-..--.....---........-----------...------.-------.-------..--
gi|17229585|ref|NP_486133.1|       ..-..--.....---........-----------...------.-------.-------..--
UBy_gi|414077420|ref|YP_006996738.1| ..-..--.....---........-----------...------.-------.-------..--
gi|256827741|ref|YP_003151700.1|   ..Q..CHc....DY-........-----------...------.--SMDAV.TGEPTSP..YD
gi|256826940|ref|YP_003150899.1|   ..-..--.....-IT........GDYYYPLEEVG...TKALQA.NSGHDDS.SGDQFCL..KS
gi|256827740|ref|YP_003151699.1|   ..-..--.....---........--------VGD...DLTHWW.GEPANKF.CVNENCH..SY
gi|256827321|ref|YP_003151280.1|   ..-..--.....---........-----------...------.-------.-------..--
IBJ_gi|339443845|ref|YP_004709849.1| ..Q..CH.....NEY........Y-FDP------...------.-------.-------..-E
IBJ_gi|339446157|ref|YP_004712161.1| ..S..CH.....DDE........QTLASAHKDYA...EKDPAV.KLKKTKV.ASETCLTsgCH
IBJ_gi|339444403|ref|YP_004710407.1| ..-..--.....---........-----------...------.-------.-------..--
IBJ_gi|339444455|ref|YP_004710459.1| ..-..--.....---........-----------...------.-------.-------..--
IBJ_gi|339445173|ref|YP_004711177.1| ..R..CH.....TIA........SLA---E-RTA...DSVALA.DNNGVT-.-------..--
IBJ_gi|339445234|ref|YP_004711238.1| ..TegCH.....NFD........EVIAMTDNWG-...------.-------.-------..--
IBJ_gi|339443846|ref|YP_004709850.1| ..-..--.....NYV........NPLEERDLEQ-...-LVEAR.GVEKDEF.CLNEACH..VK
IBJ_gi|339445886|ref|YP_004711890.1| ..E..CH.....EVT........SELKRAH--SS...FSPGAT.MRGELRR.TSVANQS..CM
IBJ_gi|339445619|ref|YP_004711623.1| ..-..--.....---........-----------...------.-------.-------..--
IBJ_gi|339444003|ref|YP_004710007.1| ..L..CH.....A--........-----------...------.-------.-------..--
gi|257792322|ref|YP_003182928.1|   ..Q..CH.....NE-........-----------...------.-------.---YYFD..GE
gi|257790295|ref|YP_003180901.1|   ..Q..CH.....TDE........GELSTAHA-DV...KFGDKP.ASKPTMV.TVD-PAT..CE
gi|257790301|ref|YP_003180907.1|   ..S..CH.....GTM........EEMAAKT---A...DSTALT.DDKGTTV.-------..--
gi|257790348|ref|YP_003180954.1|   ..S..CH.....ADA........SGLATAHEGKT...ASDTM-.PKKLKKT.EVP-DDA..CL
gi|257790760|ref|YP_003181366.1|   ngS..CH.....DIG........Q----------...------.-DSLARI.TAQ----..--
gi|257792421|ref|YP_003183027.1|   ..S..CH.....ADA........GAPEA----AA...SSTALT.DDQGTTV.N------..--
gi|257792321|ref|YP_003182927.1|   ..S..CH.....VPT........LS---EQMSEG...IN----.-----WV.TGNYVYP..LE
gi|257792266|ref|YP_003182872.1|   ..A..CH.....VPT........LS---EQMSEG...MNW---.------V.TGNYVYP..LE
gi|257790166|ref|YP_003180772.1|   ..S..CH.....DAT........AD---------...------.-------.-------..--
gi|257790742|ref|YP_003181348.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257791145|ref|YP_003181751.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257790421|ref|YP_003181027.1|   ..S..CH.....N--........-----------...------.-------.-------..--
gi|257792620|ref|YP_003183226.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257790072|ref|YP_003180678.1|   ..S..CH.....---........-----------...------.-------.-------..--
gi|257790395|ref|YP_003181001.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257790768|ref|YP_003181374.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257790846|ref|YP_003181452.1|   ..-..--.....---........PGYIAKQYEFG...------.-------.-------..--
gi|257791488|ref|YP_003182094.1|   ..T..CH.....---........-----------...------.-------.-------..--
gi|257792038|ref|YP_003182644.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257063543|ref|YP_003143215.1|   ..Q..CH.....CDY........---SMAP-ETG...IPTSPY.TGGLESM.SPENALK..FY
gi|257062798|ref|YP_003142470.1|   ..Q..CH.....NSY........DYRSRIQTEED...LATFKP.YRYGNDI.DAVFQSA..YE
gi|257063165|ref|YP_003142837.1|   ..A..CH.....GTW........EDLATATESL-...------.-------.-------..--
gi|257063496|ref|YP_003143168.1|   ..-..--.....---........-------ITEG...MHWVT-.-GNYEVLgTTSMGNT..IL
gi|257063059|ref|YP_003142731.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|257064375|ref|YP_003144047.1|   ..S..CH.....AT-........-----------...------.-------.-------..--
gi|257063053|ref|YP_003142725.1|   ..S..CH.....MAT........ADGT-------...------.-------.-------..--
gi|257064996|ref|YP_003144668.1|   ..S..CH.....AI-........-----------...------.-------.-------..--
gi|257063493|ref|YP_003143165.1|   ..-..--.....---........-----------...------.-------.-------..--
D6J_gi|470176640|ref|YP_007562684.1| ..-..--.....---........-----------...------.-------.-------..--
gi|291301089|ref|YP_003512367.1|   ..-..--.....---........-----------...------.-------.-------..--
Inz_gi|386835930|ref|YP_006250098.1| ..-..--.....---........-----------...------.-------.-------..--
fvt_gi|397670638|ref|YP_006512173.1| ..Q..CH.....VE-........-----------...------.-------.---YYFA..GE
fvt_gi|397670639|ref|YP_006512174.1| ..S..CH.....APH........NDIVYKYINKA...D-----.-------.-------..--
JDb_gi|494685058|ref|YP_007950632.1| ..-..--.....---........-----------...------.-------.-------..--
GJn_gi|397654823|ref|YP_006495506.1| ..Q..CHv....EYY........--------FKG...EDKTLT.FPWAKGI.EIDQIWD..YY
GJn_gi|397654824|ref|YP_006495507.1| ..D..CH.....VPH........DNIVHKYLVKA...EH---G.VNHGFKF.TTGWFPD..NI
FP7_gi|379716143|ref|YP_005304480.1| ..Q..CHveyyfEGE........DKTLTFPWAKG...IEIDQIwDYYKENG.HVDFVNA..KT
FP7_gi|379716144|ref|YP_005304481.1| ..D..CH.....VPH........DNIVHKYLVKA...EH---G.VNHGFKF.TTGWFPD..NI
gi|317124994|ref|YP_004099106.1|   ..Q..CH.....VEY........Y-------FKG...EEKTLT.FPWENGL.TVDGAL-..--
gi|317124995|ref|YP_004099107.1|   ..D..CHaph..DDP........VAWALDEADNG...FWHSL-.-----KF.TFG----..--
gi|317125004|ref|YP_004099116.1|   ..S..CH.....GTG........GTGATTDVQGG...VGYDTA.-------.-------..--
gi|317124997|ref|YP_004099109.1|   ..T..CH.....TFP........QGVSTPA----...-SVPIG.KGSTEPV.SVP--IG..KE
gi|317125003|ref|YP_004099115.1|   ..D..CH.....DPH........GATTSKSTMTA...TGWTAP.GGFTKVG.GVAVTNG..AA
gi|283455668|ref|YP_003360232.1|   ..-..--.....---........-----------...------.-------.-------..--
gi|297572021|ref|YP_003697795.1|   ..Q..CH.....VEY........Y-------FKG...EGKTLT.FPWTKGL.TVN----..--
gi|297572022|ref|YP_003697796.1|   ..D..CH.....APH........DSLVSKYINKAengLMHSL-.-----KF.TFGNY--..--
sZN_gi|383763452|ref|YP_005442434.1| ..D..CH.....DPQtmalritrPALVNALAKRG...IDVSKA.SRQEMRT.Y---VCA..QC
sZN_gi|383763451|ref|YP_005442433.1| ..D..CH.....TP-........HAFPDKWIVKG...ING---.FNHSLAF.TLGTYPE..HL
sZN_gi|383761442|ref|YP_005440424.1| ..T..CH.....RMV........DPEPS------...------.-GGDAAA.SARDAAI..RS
gi|57233597|ref|YP_180800.1|       ..-..--.....---........-----------...------.-------.-------..--
gi|147668693|ref|YP_001213511.1|   ..-..--.....---........-----------...------.-------.-----A-..--

                                     170         180                              190       200     
                                       |           |                                |         |     
d19hca_                              TVAPVSPML..APYKV..........V..........ID...ALADKYEPSDFTHRRHLTSL.
gi|269926701|ref|YP_003323324.1|   RESYETGKP..IEWKR..........V..........--...--YDLPEFVYFNH-------.
TLn_gi|427724729|ref|YP_007072006.1| TCHDAHSANt.IPAAV..........D..........S-...---------CLTC--HADNH.
TLn_gi|427724728|ref|YP_007072005.1| ---------..-----..........-..........--...--------------------.
Cy2_gi|428218884|ref|YP_007103349.1| HLPRQIPEN..G----..........-..........--...------DWVHVNHNNTFTL-.
Cy2_gi|428218885|ref|YP_007103350.1| ---------..-----..........-..........--...--------------------.
gi|257060488|ref|YP_003138376.1|   ---------..-----..........-..........--...--------------------.
gi|166366918|ref|YP_001659191.1|   ---------..-----..........-..........--...--------------------.
gi|75910524|ref|YP_324820.1|       ---------..-----..........-..........--...--------------------.
gi|17229585|ref|NP_486133.1|       ---------..-----..........-..........--...--------------------.
UBy_gi|414077420|ref|YP_006996738.1| ---------..-----..........-..........--...--------------------.
gi|256827741|ref|YP_003151700.1|   SISEMTPDN..AIEWY..........Dnhnf......VD...WTYESTGAKMLAVRHSEYEY.
gi|256826940|ref|YP_003150899.1|   GCHDMTRED..LTQAT..........-..........--...--------------------.
gi|256827740|ref|YP_003151699.1|   LRDEN----..--GDV..........N..........YDk..LEASTVWMDFNPHSQHHE--.
gi|256827321|ref|YP_003151280.1|   ---------..-----..........-..........--...--------------------.
IBJ_gi|339443845|ref|YP_004709849.1| TKVTSNPYV..GLEAM..........T..........PDailAYYDEMGFSDWNHKDTFAPM.
IBJ_gi|339446157|ref|YP_004712161.1| DQAEIAAAT..ASETA..........LtdtkgkvvnpHD...LPVHDDHVKGVTCASCHKMH.
IBJ_gi|339444403|ref|YP_004710407.1| ---------..-----..........-..........--...-------------HYPMNTY.
IBJ_gi|339444455|ref|YP_004710459.1| ---------..-----..........-..........--...-----------ICHSPMDTY.
IBJ_gi|339445173|ref|YP_004711177.1| ---------..----I..........N..........PH...ALLKTKGHSEIDCTACHTMH.
IBJ_gi|339445234|ref|YP_004711238.1| ---------..-----..........-..........--...-----GEEGVNPHRS-----.
IBJ_gi|339443846|ref|YP_004709850.1| DDGSV--MT..RDDLI..........A..........AT...--------------------.
IBJ_gi|339445886|ref|YP_004711890.1| TECHEDENL..VALTA..........S..........NT...VLVDSEGTVVNPHEV-----.
IBJ_gi|339445619|ref|YP_004711623.1| ---------..-----..........-..........--...--------------------.
IBJ_gi|339444003|ref|YP_004710007.1| ---------..-----..........-..........--...--------------------.
gi|257792322|ref|YP_003182928.1|   TKATTNPYT..GLDQM..........T..........PD...AILAYYDERNFKDWNHADTF.
gi|257790295|ref|YP_003180901.1|   SCHGTLEDM..AAKTA..........D..........ST...ALTDDKGTTVNPH-------.
gi|257790301|ref|YP_003180907.1|   ---------..-----..........-..........--...----------NPH-------.
gi|257790348|ref|YP_003180954.1|   SCHYGAREE..LVAAT..........V..........DV...AVVDSKGTAVNPHDVTPSE-.
gi|257790760|ref|YP_003181366.1|   ---------..-----..........-..........--...-------REYNPHS------.
gi|257792421|ref|YP_003183027.1|   ------PHD..LPQSA..........-..........--...---------------SH---.
gi|257792321|ref|YP_003182927.1|   ERD------..TDMLTe.........A..........RG...LDGDEFCLNESCHNLTRDDL.
gi|257792266|ref|YP_003182872.1|   ------ERD..TEMLTe.........A..........RG...VDADEFCLNESCHNLTRDDL.
gi|257790166|ref|YP_003180772.1|   ---------..-----..........-..........--...--------------------.
gi|257790742|ref|YP_003181348.1|   ---------..-----..........-..........--...--------------------.
gi|257791145|ref|YP_003181751.1|   ---------..-----..........-..........AS...AGCHDWEDVKAATEDW----.
gi|257790421|ref|YP_003181027.1|   ---------..-----..........-..........--...--------------------.
gi|257792620|ref|YP_003183226.1|   ---------..-----..........-..........--...--------------------.
gi|257790072|ref|YP_003180678.1|   ---------..-----..........-..........--...--------------------.
gi|257790395|ref|YP_003181001.1|   ---------..-----..........-..........--...--------------------.
gi|257790768|ref|YP_003181374.1|   ---------..-----..........-..........--...--------------------.
gi|257790846|ref|YP_003181452.1|   ---------..-----..........-..........--...---------TLMHAVHYGSR.
gi|257791488|ref|YP_003182094.1|   ---------..-----..........-..........--...--------------------.
gi|257792038|ref|YP_003182644.1|   ---------..-----..........-..........--...--------------------.
gi|257063543|ref|YP_003143215.1|   DDNNFVDWT..YESTGaq........M..........LA...IRHAEFEFNYANGGSPMINM.
gi|257062798|ref|YP_003142470.1|   DEVNFFENDlgLPESY..........-..........--...--------------------.
gi|257063165|ref|YP_003142837.1|   ---------..-----..........-..........--...---GDYN----PHD------.
gi|257063496|ref|YP_003143168.1|   DSKTLTQLT..AARGG..........T..........AD...EFCLNESCHNMTRDDLITATa
gi|257063059|ref|YP_003142731.1|   ---------..-----..........-..........--...--------------------.
gi|257064375|ref|YP_003144047.1|   ---------..-----..........-..........--...--------------------.
gi|257063053|ref|YP_003142725.1|   ---------..-----..........-..........--...--------------------.
gi|257064996|ref|YP_003144668.1|   ---------..-----..........-..........--...--------------------.
gi|257063493|ref|YP_003143165.1|   ---------..-----..........-..........--...--------------------.
D6J_gi|470176640|ref|YP_007562684.1| ---------..-----..........-..........--...--------------------.
gi|291301089|ref|YP_003512367.1|   ---------..-----..........-..........--...--------------------.
Inz_gi|386835930|ref|YP_006250098.1| ---------..-----..........-..........--...--------------------.
fvt_gi|397670638|ref|YP_006512173.1| GKTLTFPWDk.GLTAY..........D..........AM...AYYDEVGWTDYKHAESGAPI.
fvt_gi|397670639|ref|YP_006512174.1| -NGFWHALK..FTFQNype.......N..........IK...IRDHNREIVEAACIDCHGDY.
JDb_gi|494685058|ref|YP_007950632.1| ---------..-----..........-..........--...--------------------.
GJn_gi|397654823|ref|YP_006495506.1| KED------..-----..........-..........--...-----GHVDFVNTKTGADIV.
GJn_gi|397654824|ref|YP_006495507.1| QIRDA----..-SRKV..........-..........--...--------------------.
FP7_gi|379716143|ref|YP_005304480.1| GADIVKAQ-..-----..........-..........--...--------------------.
FP7_gi|379716144|ref|YP_005304481.1| QIRDA----..-----..........-..........--...-----------SR-------.
gi|317124994|ref|YP_004099106.1|   ---------..-----..........-..........--...KYYDEVGFTDFTH-------.
gi|317124995|ref|YP_004099107.1|   ---AY-PQN..IKIRE..........K..........--...----NREVVQEACLYCHKEV.
gi|317125004|ref|YP_004099116.1|   ---------..-----..........-..........--...--------------------.
gi|317124997|ref|YP_004099109.1|   PADHADPL-..-----..........-..........--...--------FVFSHRNVAGAV.
gi|317125003|ref|YP_004099115.1|   GT-------..APTYT..........W..........LD...GMVQPVTAEY----------.
gi|283455668|ref|YP_003360232.1|   ---------..-----..........-..........--...--------------------.
gi|297572021|ref|YP_003697795.1|   ---------..--DAI..........-..........--...DYYDEAGFSDFTHKDTGAEV.
gi|297572022|ref|YP_003697796.1|   ---------..---PE..........N..........IQ...IRPHNKEVTEHACIYCHGNF.
sZN_gi|383763452|ref|YP_005442434.1| HVEYYFAGE..KKELVfpwekgltidD..........IE...RYYNEYGFKDWTHKETGAPM.
sZN_gi|383763451|ref|YP_005442433.1| HIRDF----..-----..........-..........--...----NARIAEQNCRDCHTTV.
sZN_gi|383761442|ref|YP_005440424.1| TISPTLPAGh.VGSAMlild......P..........ED...NRRGPFSISPAPPHPKATWR.
gi|57233597|ref|YP_180800.1|       ----I----..-----..........-..........--...--------------------.
gi|147668693|ref|YP_001213511.1|   ---------..-----..........-..........--...--------------------.

                                           210         220                   230                    
                                             |           |                     |                    
d19hca_                              .ME..SIKDD..KLAQAFHDKPEILCATCH............HR..SPL....S.........
gi|269926701|ref|YP_003323324.1|   .--..-----..----SIHIAKGIGCSTCH............GR..VDK....Mqltykvtp.
TLn_gi|427724729|ref|YP_007072006.1| .SL..NYKNS..RHAELFDADR--------............NL..PRP....S.........
TLn_gi|427724728|ref|YP_007072005.1| .--..-----..------------------............--..---....-.........
Cy2_gi|428218884|ref|YP_007103349.1| .--..-LPRD..RMV-------SEVCMNCH............--..---....-.........
Cy2_gi|428218885|ref|YP_007103350.1| .--..-----..---------EVLTCTACHnehvhi......FS..RGV....H.........
gi|257060488|ref|YP_003138376.1|   .--..-----..-------------CPHCH............NS..I--....D.........
gi|166366918|ref|YP_001659191.1|   .--..---QS..TYVKVLHPR---------............VN..LPT....P.........
gi|75910524|ref|YP_324820.1|       .--..-----..------------------............--..---....-.........
gi|17229585|ref|NP_486133.1|       .--..-----..------------------............--..---....-.........
UBy_gi|414077420|ref|YP_006996738.1| .--..-----..------------------............--..---....-.........
gi|256827741|ref|YP_003151700.1|   .NY..GGEGN..HMTKLGY-----DCADCH............MK..VET....Dadgnaytsh
gi|256826940|ref|YP_003150899.1|   .--..--SGM..SFNPHRWQHGETECSECH............KS..HRA....S.........
gi|256827740|ref|YP_003151699.1|   .--..-----..--------DIRMDCTDCH............KG..HRA....S.........
gi|256827321|ref|YP_003151280.1|   .--..-----..-------------CANC-............-G..YPV....Q.........
IBJ_gi|339443845|ref|YP_004709849.1| .IK..VQHPE..FETMYGGD----------............-K..GPM....A.........
IBJ_gi|339446157|ref|YP_004712161.1| .GA..GTAE-..--VDAVYKASKATCLSCH............HN..E--....-.........
IBJ_gi|339444403|ref|YP_004710407.1| .VD..NYSEG..DGMARIHAEAGVTCLECHpasisqq.....V-..---....Seaftwvtgd
IBJ_gi|339444455|ref|YP_004710459.1| .YE..SYDEG..TGMARIHKEAHVTCLDCH............ET..SFG....Qqlseawtwv
IBJ_gi|339445173|ref|YP_004711177.1| .ES..-----..---SDRLETSSKMCRECH............HA..DS-....-.........
IBJ_gi|339445234|ref|YP_004711238.1| .--..-----..------HQGIAIDCSNCH............GG..HTT....S.........
IBJ_gi|339443846|ref|YP_004709850.1| .-E..DMGEY..NPHVAQHGK--IDCSECH............KG..HRA....S.........
IBJ_gi|339445886|ref|YP_004711890.1| .--..-----..--MSIGTGHSEITCGSCHswhs........NE..STE....E.........
IBJ_gi|339445619|ref|YP_004711623.1| .--..-----..------------------............--..---....-.........
IBJ_gi|339444003|ref|YP_004710007.1| .--..-----..------------------............--..---....-.........
gi|257792322|ref|YP_003182928.1|   .AP..MIK--..----VQHPEFETM----Hgg..........EQ..SPM....A.........
gi|257790295|ref|YP_003180901.1|   .--..----E..RPAGEKHEENPATCTDCH............NN..HSK....Dlpk......
gi|257790301|ref|YP_003180907.1|   .--..----D..DPSNEKHDANPATCTSCH............NN..HSKdqa.K.........
gi|257790348|ref|YP_003180954.1|   .--..-----..-------QHDTIRCADCH............GM..HDAeklaD.........
gi|257790760|ref|YP_003181366.1|   .--..-----..----NFH--EELACGTCH............KS..HTA....-.........
gi|257792421|ref|YP_003183027.1|   .--..-----..---------DTLTCGSCHtm..........HD..EKPle..E.........
gi|257792321|ref|YP_003182927.1|   .VK..ATSGM..EFNPHKAQHGEIECSECH............KA..HRA....S.........
gi|257792266|ref|YP_003182872.1|   .IK..ATSDM..EFNPHQPQHGEIECSECH............KA..HRA....S.........
gi|257790166|ref|YP_003180772.1|   .--..-----..------------------............--..---....-.........
gi|257790742|ref|YP_003181348.1|   .--..-----..----------NKLCLSCH............DR..TTI....N.........
gi|257791145|ref|YP_003181751.1|   .--..GGEAG..VNPHASHQGEAIDCSNCH............GA..HGS....-.........
gi|257790421|ref|YP_003181027.1|   .--..-----..------------------............--..---....-.........
gi|257792620|ref|YP_003183226.1|   .--..-----..------------------............--..---....-.........
gi|257790072|ref|YP_003180678.1|   .--..-----..------------------............--..---....-.........
gi|257790395|ref|YP_003181001.1|   .--..-----..------------------............--..---....-.........
gi|257790768|ref|YP_003181374.1|   .--..-----..---------DNRGCNSCH............AD..LDA....T.........
gi|257790846|ref|YP_003181452.1|   .--..--TKS..----DFVNQYQGDCMSCH............NA..---....-.........
gi|257791488|ref|YP_003182094.1|   .--..-----..------------------............--..---....-.........
gi|257792038|ref|YP_003182644.1|   .-A..-----..------------------............--..---....-.........
gi|257063543|ref|YP_003143215.1|   .IN..QATGE..NYT----------CNDCH............MG..KAT....Aedgteytnh
gi|257062798|ref|YP_003142470.1|   .VV..HPNVE..GYMSTKHNAMGVTCVDCH............MP..VTV....D.........
gi|257063165|ref|YP_003142837.1|   .--..-----..----SIH-GTVQYCNECH............KG..H--....S.........
gi|257063496|ref|YP_003143168.1|   dLS..DVRNP..HVPQHGEND----CGVCH............KG..HAQ....S.........
gi|257063059|ref|YP_003142731.1|   .--..-----..------------------............--..---....-.........
gi|257064375|ref|YP_003144047.1|   .--..-----..------------------............--..---....-.........
gi|257063053|ref|YP_003142725.1|   .--..-----..------------------............--..---....-.........
gi|257064996|ref|YP_003144668.1|   .--..-----..------------------............--..---....-.........
gi|257063493|ref|YP_003143165.1|   .--..-----..------------------............--..---....-.........
D6J_gi|470176640|ref|YP_007562684.1| .--..-----..------------SCPSCH............AK..NRVpss.S.........
gi|291301089|ref|YP_003512367.1|   .--..-----..------------------............--..---....-.........
Inz_gi|386835930|ref|YP_006250098.1| .--..-----..-------------CRDCH............GW..RPV....Gr........
fvt_gi|397670638|ref|YP_006512173.1| .LK..AQHPDfeTWSQGIHAANGVTCADCH............MA..YQR....N.........
fvt_gi|397670639|ref|YP_006512174.1| .VD..QAKNS..----SEHKGERMSCLRCH............DG..---....-.........
JDb_gi|494685058|ref|YP_007950632.1| .--..-----..--VSSRDRRGQPLCGPCH............SR..NPA....N.........
GJn_gi|397654823|ref|YP_006495506.1| .KAq.HPEFD..VWSNSIHAQNGVSCSDCH............MP..YER....H.........
GJn_gi|397654824|ref|YP_006495507.1| .--..-----..---------TNDACLTCH............GDftSDIhgtyG.........
FP7_gi|379716143|ref|YP_005304480.1| .--..HPEFD..VWSNSIHAQNGVSCSDCH............MP..YER....H.........
FP7_gi|379716144|ref|YP_005304481.1| .--..-----..-------KVTNEACLSCH............GEftSDIhgtyG.........
gi|317124994|ref|YP_004099106.1|   .--..KLTGA..RVLKAQHPDYETYSQGVH............AT..AGV....-.........
gi|317124995|ref|YP_004099107.1|   .VS..RTEMS..R----PH-GEGVSCLQCH............S-..---....-.........
gi|317125004|ref|YP_004099116.1|   .--..-----..------------------............--..---....-.........
gi|317124997|ref|YP_004099109.1|   .K-..-----..--------PAASSCGACH............EA..S--....-.........
gi|317125003|ref|YP_004099115.1|   .--..-----..-----------QLCLKCH............S-..---....-.........
gi|283455668|ref|YP_003360232.1|   .--..-----..-----------LSCSQCH............RQ..A--....-.........
gi|297572021|ref|YP_003697795.1|   .IK..AQHPDfeTWSQGIHADNGVSCADCH............MP..YKR....Dga.......
gi|297572022|ref|YP_003697796.1|   .VD..QIAHN..SV----QNGETLSCIKCH............DG..---....-.........
sZN_gi|383763452|ref|YP_005442434.1| .IKiqHPEYE..LFTTGLHYQSGVACADCHmpyvrvgsvkvsD-..---....-.........
sZN_gi|383763451|ref|YP_005442433.1| .VS..AIE--..----HFVSEEPLQCVRCH............GN..---....-.........
sZN_gi|383761442|ref|YP_005440424.1| .TEllGQGGD..PVT------EARVCGVCH............NL..DNP....T.........
gi|57233597|ref|YP_180800.1|       .--..-----..------------------............--..---....-.........
gi|147668693|ref|YP_001213511.1|   .--..-----..------------------............--..---....-.........

                                                   240         250                          260     
                                                     |           |                            |     
d19hca_                              ............LTPPKCGSC.HTK.EID..A........A.......DPGR..PNLMAAY..
gi|269926701|ref|YP_003323324.1|   ............LNMGWCLDC.HAN.PAK..Y........V.......RP--..-------..
TLn_gi|427724729|ref|YP_007072006.1| ............ANSVSCSTC.HMA.RHE..K........K.......VGDR..TTAFVNH..
TLn_gi|427724728|ref|YP_007072005.1| ............---------.---.---..G........D.......L---..-------..
Cy2_gi|428218884|ref|YP_007103349.1| ............---------.---.---..-........-.......----..-------..
Cy2_gi|428218885|ref|YP_007103350.1| ............LHPDLCMHC.HEG.VIN..G........D.......LAS-..-------..
gi|257060488|ref|YP_003138376.1|   ............SQAIRCPYC.HKS.LKA..Y........G.......HPGI..PLYQA--..
gi|166366918|ref|YP_001659191.1|   ............LGHTTCVSC.HPN.A--..-........-.......----..-------..
gi|75910524|ref|YP_324820.1|       ............----CCPQC.HTP.GFE..T........T.......ERIK..G------..
gi|17229585|ref|NP_486133.1|       ............-----CPQC.HTP.GFE..T........T.......ERIK..G------..
UBy_gi|414077420|ref|YP_006996738.1| ............---------.---.---..-........-.......----..-------..
gi|256827741|ref|YP_003151700.1|   ..ywgspldndeLIKNDCSNC.HKD.LKA..E........V.......KQTQ..EEVWGRT..
gi|256826940|ref|YP_003150899.1|   ............V--FYCTQC.HSE.---..-........-.......----..-------..
gi|256827740|ref|YP_003151699.1|   ............V--------.---.---..-........-.......----..-------..
gi|256827321|ref|YP_003151280.1|   ............ADYIICPNC.HAH.---..-........-.......----..------L..
IBJ_gi|339443845|ref|YP_004709849.1| ............KNGYSCADC.HMG.KVN..E........G.......TENE..YTSHNWIsp
IBJ_gi|339446157|ref|YP_004712161.1| ............--VYECHTC.H--.---..-........-.......----..-------..
IBJ_gi|339444403|ref|YP_004710407.1| ...fkneldmieYDNATCLTC.HISmEFQ..A........S.......KTDMleKNPHADA..
IBJ_gi|339444455|ref|YP_004710459.1| igdfsepldmmnYDDSTCLTC.HISeEFQ..A........A.......KTDLieFNPHADA..
IBJ_gi|339445173|ref|YP_004711177.1| ............---FECESC.H--.---..-........-.......----..-------..
IBJ_gi|339445234|ref|YP_004711238.1| ............--YMYCNAC.H--.---..-........-.......----..-------..
IBJ_gi|339443846|ref|YP_004709850.1| ............V--VYCTQC.HSE.---..-........-.......----..-------..
IBJ_gi|339445886|ref|YP_004711890.1| ............TAKALCISC.HHE.---..-........-.......----..-------..
IBJ_gi|339445619|ref|YP_004711623.1| ............----FCLSC.HPR.AAI..D........E.......ANEN..YSGIEGFnp
IBJ_gi|339444003|ref|YP_004710007.1| ............---------.---.---..-........-.......----..-------..
gi|257792322|ref|YP_003182928.1|   ............KAGYGCSDC.HMA.PAE..G........A.......NGEY..TSHNWVSpl
gi|257790295|ref|YP_003180901.1|   ............DSMRYCAQC.HHR.---..-........-.......----..-------..
gi|257790301|ref|YP_003180907.1|   ............DAMKYCAQC.HHR.---..-........-.......----..-------..
gi|257790348|ref|YP_003180954.1|   ............KADAECASC.HHA.DV-..-........-.......----..-------..
gi|257790760|ref|YP_003181366.1|   ............-SVMQCAQC.HSD.---..-........-.......----..-------..
gi|257792421|ref|YP_003183027.1|   ............TAAAACTQC.HHQ.NV-..-........-.......----..-------..
gi|257792321|ref|YP_003182927.1|   ............V--MYCTQC.HSE.---..-........-.......----..-------..
gi|257792266|ref|YP_003182872.1|   ............V--MYCTQC.HSE.---..-........-.......----..-------..
gi|257790166|ref|YP_003180772.1|   ............---------.---.---..-........-.......----..-------..
gi|257790742|ref|YP_003181348.1|   ............---------.---.---..-........A.......ANED..FGGIEGFnp
gi|257791145|ref|YP_003181751.1|   ............-SYMYCNAC.HD-.---..-........-.......----..-------..
gi|257790421|ref|YP_003181027.1|   ............---------.---.---..-........-.......----..-------..
gi|257792620|ref|YP_003183226.1|   ............VSDEQCLSC.HGG.SYE..A........L.......AERT..ADLGDWNph
gi|257790072|ref|YP_003180678.1|   ............---------.---.---..-........-.......----..-------..
gi|257790395|ref|YP_003181001.1|   ............-SDEQCLSC.HGG.SYE..A........L.......AETT..SSYEQSNph
gi|257790768|ref|YP_003181374.1|   ............LQ-------.HLA.QTM..H........P.......SPNS..PALDAEM..
gi|257790846|ref|YP_003181452.1|   ............---------.---.---..-........-.......----..-------..
gi|257791488|ref|YP_003182094.1|   ............---------.---.---..-........-.......----..-------..
gi|257792038|ref|YP_003182644.1|   ............---------.---.---..-........-.......----..-------..
gi|257063543|ref|YP_003143215.1|   ..qwtvpteneeLIAENCSMC.HKD.LA-..-........-.......----..-------..
gi|257062798|ref|YP_003142470.1|   ............EETGT----.--E.YRS..H........F.......SANS..PLESEDS..
gi|257063165|ref|YP_003142837.1|   ............EQVDICGEC.HPN.---..-........-.......----..-------..
gi|257063496|ref|YP_003143168.1|   ............V--NYCSTC.HN-.---..-........-.......----..-------..
gi|257063059|ref|YP_003142731.1|   ............-SYETCGEC.HGS.AEEivT........A.......TDGF..LTMKGAIpv
gi|257064375|ref|YP_003144047.1|   ............---------.---.---..-........-.......----..-------..
gi|257063053|ref|YP_003142725.1|   ............---------.---.---..-........-.......----..-------..
gi|257064996|ref|YP_003144668.1|   ............---------.---.---..-........-.......----..-------..
gi|257063493|ref|YP_003143165.1|   ............---------.---.---..-........-.......----..-------..
D6J_gi|470176640|ref|YP_007562684.1| ............SGKPTCAKC.H--.---..-........-.......----..-------..
gi|291301089|ref|YP_003512367.1|   ............AKNQRCPHC.HSP.YIE..S........-.......----..----RAW..
Inz_gi|386835930|ref|YP_006250098.1| ............RAGFRCTPCrHWR.E--..-........-.......----..------R..
fvt_gi|397670638|ref|YP_006512173.1| ............---------.---.--G..A........A.......KVSN..HQIMSPMan
fvt_gi|397670639|ref|YP_006512174.1| ............---------.---.---..-........-.......----..-------..
JDb_gi|494685058|ref|YP_007950632.1| ............--AERCVGCgHLR.PVN..N........R.......TPQG..PLCASCR..
GJn_gi|397654823|ref|YP_006495506.1| ............---------.-G-.AKK..V........S.......SHHL..QSPLLNI..
GJn_gi|397654824|ref|YP_006495507.1| ............ETQIQCTHC.HA-.---..-........-.......----..-------..
FP7_gi|379716143|ref|YP_005304480.1| ............---------.-G-.AKK..V........S.......SHHL..QSPLLNI..
FP7_gi|379716144|ref|YP_005304481.1| ............ENQIQCTHC.HA-.---..-........-.......----..-------..
gi|317124994|ref|YP_004099106.1|   ............----TCADC.HMS.YKR..EgamkitdhQ.......VRSP..MTNEATI..
gi|317124995|ref|YP_004099107.1|   ............---------.---.---..-........-.......----..-------..
gi|317125004|ref|YP_004099116.1|   ............---------.---.---..-........-.......----..-------..
gi|317124997|ref|YP_004099109.1|   ............----YCQDC.HDS.GAV..K........VdhygmlyNHAQ..SVLDAGS..
gi|317125003|ref|YP_004099115.1|   ............---------.---.---..-........-.......----..-------..
gi|283455668|ref|YP_003360232.1|   ............----RCAQC.TGP.LER..L........Q.......DGS-..-------..
gi|297572021|ref|YP_003697795.1|   ............AKI------.---.-SD..H........Q.......VRSP..MADDEQI..
gi|297572022|ref|YP_003697796.1|   ............---------.---.---..-........-.......----..-------..
sZN_gi|383763452|ref|YP_005442434.1| ............---------.---.---..-........-.......----..-------..
sZN_gi|383763451|ref|YP_005442433.1| ............---------.---.---..-........-.......----..-------..
sZN_gi|383761442|ref|YP_005440424.1| ............L--------.---.---..-........-.......----..-------..
gi|57233597|ref|YP_180800.1|       ............---------.---.---..-........-.......----..-------..
gi|147668693|ref|YP_001213511.1|   ............---------.---.---..-........-.......----..-------..

d19hca_                              ............HL.............ECMGCH.........................KGMAV
gi|269926701|ref|YP_003323324.1|   ............--.............------.........................-----
TLn_gi|427724729|ref|YP_007072006.1| ............NNtynllprdrmvgeVCINCH.........................-----
TLn_gi|427724728|ref|YP_007072005.1| ............--.............------.........................-----
Cy2_gi|428218884|ref|YP_007103349.1| ............--.............------.........................-----
Cy2_gi|428218885|ref|YP_007103350.1| ............--.............------.........................-----
gi|257060488|ref|YP_003138376.1|   ............--.............------.........................-----
gi|166366918|ref|YP_001659191.1|   ............--.............------.........................-----
gi|75910524|ref|YP_324820.1|       ............-L.............PCELCH.........................TPTTL
gi|17229585|ref|NP_486133.1|       ............-L.............PCELCH.........................MPTTL
UBy_gi|414077420|ref|YP_006996738.1| ............--.............------.........................-----
gi|256827741|ref|YP_003151700.1|   ............H-.............------.........................-----
gi|256826940|ref|YP_003150899.1|   ............--.............------.........................-----
gi|256827740|ref|YP_003151699.1|   ............-Q.............QCTGCH.........................ED---
gi|256827321|ref|YP_003151280.1|   ............KD.............LCSNCH.........................HALDP
IBJ_gi|339443845|ref|YP_004709849.1| .....lendqllEN.............DCSQCH.........................NDLKA
IBJ_gi|339446157|ref|YP_004712161.1| ............--.............------.........................-----
IBJ_gi|339444403|ref|YP_004710407.1| ............HQvl...........QCTDCH.........................RSHR-
IBJ_gi|339444455|ref|YP_004710459.1| ............HQal...........ACTDCH.........................KSHNE
IBJ_gi|339445173|ref|YP_004711177.1| ............--.............------.........................-----
IBJ_gi|339445234|ref|YP_004711238.1| ............--.............------.........................-----
IBJ_gi|339443846|ref|YP_004709850.1| ............--.............------.........................-----
IBJ_gi|339445886|ref|YP_004711890.1| ............--.............------.........................--NV-
IBJ_gi|339445619|ref|YP_004711623.1| .........hkaHLaag..........DCLTCH.........................SVDG-
IBJ_gi|339444003|ref|YP_004710007.1| ............--.............------.........................-----
gi|257792322|ref|YP_003182928.1|   ......enkqliEN.............DCSKCH.........................DD---
gi|257790295|ref|YP_003180901.1|   ............--.............------.........................-----
gi|257790301|ref|YP_003180907.1|   ............--.............------.........................-----
gi|257790348|ref|YP_003180954.1|   ............--.............------.........................-----
gi|257790760|ref|YP_003181366.1|   ............--.............------.........................-----
gi|257792421|ref|YP_003183027.1|   ............-Y.............ECYTCH.........................-----
gi|257792321|ref|YP_003182927.1|   ............--.............------.........................-----
gi|257792266|ref|YP_003182872.1|   ............--.............------.........................-----
gi|257790166|ref|YP_003180772.1|   ............--.............------.........................-----
gi|257790742|ref|YP_003181348.1|   .........hkaHLeag..........DCTSCH.........................SV---
gi|257791145|ref|YP_003181751.1|   ............--.............------.........................-----
gi|257790421|ref|YP_003181027.1|   ............--.............------.........................-----
gi|257792620|ref|YP_003183226.1|   .........dslHGgyn..........ACVNCH.........................EKDKE
gi|257790072|ref|YP_003180678.1|   ............--.............------.........................-----
gi|257790395|ref|YP_003181001.1|   .........dslHGgyn..........SCVNCH.........................ARDK-
gi|257790768|ref|YP_003181374.1|   ............TVd............QCLFCHtyspgyiptqyefgtlihnihygleADSQF
gi|257790846|ref|YP_003181452.1|   ............--.............------.........................-----
gi|257791488|ref|YP_003182094.1|   ............--.............------.........................-----
gi|257792038|ref|YP_003182644.1|   ............--.............------.........................-----
gi|257063543|ref|YP_003143215.1|   ............--.............------.........................-----
gi|257062798|ref|YP_003142470.1|   ............LN.............YCLTCH.........................KSQGI
gi|257063165|ref|YP_003142837.1|   ............--.............------.........................-----
gi|257063496|ref|YP_003143168.1|   ............--.............------.........................-----
gi|257063059|ref|YP_003142731.1|   esanphanhytsNL.............ACDNCH.........................RLDA-
gi|257064375|ref|YP_003144047.1|   ............--.............------.........................-----
gi|257063053|ref|YP_003142725.1|   ............--.............------.........................-----
gi|257064996|ref|YP_003144668.1|   ............--.............------.........................-----
gi|257063493|ref|YP_003143165.1|   ............--.............------.........................-----
D6J_gi|470176640|ref|YP_007562684.1| ............--.............------.........................-----
gi|291301089|ref|YP_003512367.1|   ............HE.............PCPTCG.........................QPAHS
Inz_gi|386835930|ref|YP_006250098.1| ............HPrg...........RCVRCR.........................RE---
fvt_gi|397670638|ref|YP_006512173.1| ........detiNA.............SCLTCH.........................HSTE-
fvt_gi|397670639|ref|YP_006512174.1| ............--.............------.........................-----
JDb_gi|494685058|ref|YP_007950632.1| ............QSpll..........TCTLCG.........................ERAPG
GJn_gi|397654823|ref|YP_006495506.1| ............NN.............SCMTCH.........................NSSDK
GJn_gi|397654824|ref|YP_006495507.1| ............--.............------.........................-----
FP7_gi|379716143|ref|YP_005304480.1| ............NN.............SCMTCH.........................NSSDE
FP7_gi|379716144|ref|YP_005304481.1| ............--.............------.........................-----
gi|317124994|ref|YP_004099106.1|   ............NQ.............ACLTCH.........................KTDEA
gi|317124995|ref|YP_004099107.1|   ............--.............------.........................-----
gi|317125004|ref|YP_004099116.1|   ............--.............------.........................-----
gi|317124997|ref|YP_004099109.1|   ............KN.............ACAVCH.........................QPAY-
gi|317125003|ref|YP_004099115.1|   ............--.............------.........................-----
gi|283455668|ref|YP_003360232.1|   ............-I.............RCRWCG.........................-----
gi|297572021|ref|YP_003697795.1|   ............NA.............TCLTCH.........................HSSA-
gi|297572022|ref|YP_003697796.1|   ............--.............------.........................-----
sZN_gi|383763452|ref|YP_005442434.1| ............--.............-----H.........................WIRSP
sZN_gi|383763451|ref|YP_005442433.1| ............--.............------.........................-----
sZN_gi|383761442|ref|YP_005440424.1| ............--.............------.........................-----
gi|57233597|ref|YP_180800.1|       ............--.............------.........................-----
gi|147668693|ref|YP_001213511.1|   ............--.............------.........................-----

                                      280          290                                              
                                        |            |                                              
d19hca_                              ARPRDTD...CTTCHKA--aa..........................................
gi|269926701|ref|YP_003323324.1|   -------...---------ksevfnmewtpp................................
TLn_gi|427724729|ref|YP_007072006.1| -------...---------gveys.......................................
TLn_gi|427724728|ref|YP_007072005.1| -------...---------kshdgftpdgcwtagchnyhd.......................
Cy2_gi|428218884|ref|YP_007103349.1| -------...---------............................................
Cy2_gi|428218885|ref|YP_007103350.1| -------...---------hegfspdgcwtagchnfhd.........................
gi|257060488|ref|YP_003138376.1|   -------...---------tqdeflcdrclyhe..............................
gi|166366918|ref|YP_001659191.1|   -------...---------srydyqtltpiw................................
gi|75910524|ref|YP_324820.1|       TLRAIYQ...CKKC-----gfrqdklfpngiefadpsqcvyc.....................
gi|17229585|ref|NP_486133.1|       TLTAIYQ...CKKC-----g...........................................
UBy_gi|414077420|ref|YP_006996738.1| -------...---------tnnidnrfrr..................................
gi|256827741|ref|YP_003151700.1|   -------...---------qvgqrtacyvqnfekalaagtvadsdlerlqyiqraaayywnsa
gi|256826940|ref|YP_003150899.1|   -------...---------aaaamp......................................
gi|256827740|ref|YP_003151699.1|   -------...---------vnl.........................................
gi|256827321|ref|YP_003151280.1|   AW---TV...CPYC-----g...........................................
IBJ_gi|339443845|ref|YP_004709849.1| -------...---------evaktqakeeervtaisekiadmtnkiaakyadeiatlkaakea
IBJ_gi|339446157|ref|YP_004712161.1| -------...---------t...........................................
IBJ_gi|339444403|ref|YP_004710407.1| --DQNDY...CAQCHD---ngdm........................................
IBJ_gi|339444455|ref|YP_004710459.1| QV---NY...CSNCHDN--ggq.........................................
IBJ_gi|339445173|ref|YP_004711177.1| -------...---------............................................
IBJ_gi|339445234|ref|YP_004711238.1| -------...---------dyet........................................
IBJ_gi|339443846|ref|YP_004709850.1| -------...---------aevpeg......................................
IBJ_gi|339445886|ref|YP_004711890.1| -----YE...CGTCH----............................................
IBJ_gi|339445619|ref|YP_004711623.1| --TSTLT...CNSCHD---ap..........................................
IBJ_gi|339444003|ref|YP_004710007.1| -------...---------q...........................................
gi|257792322|ref|YP_003182928.1|   -------...---------lekkvkdiqaseeervtaisekiedmtnkiaakyadeiaamkaa
gi|257790295|ref|YP_003180901.1|   ---GTFE...CGTCH----............................................
gi|257790301|ref|YP_003180907.1|   ---GTFE...CGTCHE---............................................
gi|257790348|ref|YP_003180954.1|   -----FE...CYTCH----............................................
gi|257790760|ref|YP_003181366.1|   -------...---------advpagw.....................................
gi|257792421|ref|YP_003183027.1|   -------...---------............................................
gi|257792321|ref|YP_003182927.1|   -------...---------aevpeg......................................
gi|257792266|ref|YP_003182872.1|   -------...---------aevpeg......................................
gi|257790166|ref|YP_003180772.1|   -------...---------gngmqlwdnvkh................................
gi|257790742|ref|YP_003181348.1|   DGTSTLS...CNECHD---apl.........................................
gi|257791145|ref|YP_003181751.1|   -------...---------yav.........................................
gi|257790421|ref|YP_003181027.1|   -------...---------............................................
gi|257792620|ref|YP_003183226.1|   --ITFNY...CENCH----vy..........................................
gi|257790072|ref|YP_003180678.1|   -------...---------............................................
gi|257790395|ref|YP_003181001.1|   -EITDNQ...CMHCHD---wp..........................................
gi|257790768|ref|YP_003181374.1|   EDEYKGN...CYSCHD---a...........................................
gi|257790846|ref|YP_003181452.1|   -------...---------tengag......................................
gi|257791488|ref|YP_003182094.1|   -------...---------aq..........................................
gi|257792038|ref|YP_003182644.1|   -------...---------pligadeelcfraaeglgggmggltetcgavsgaamaiglansn
gi|257063543|ref|YP_003143215.1|   -------...---------geikaiqdeimasehevglraclfifnfedaieagtltddqiae
gi|257062798|ref|YP_003142470.1|   ES-----...---------teamvdfvrgkqevlagdietlkadidaygtalseaiasgsmsd
gi|257063165|ref|YP_003142837.1|   -------...---------gg..........................................
gi|257063496|ref|YP_003143168.1|   -------...---------dapipe......................................
gi|257063059|ref|YP_003142731.1|   --GSTMY...CWSCHD---w...........................................
gi|257064375|ref|YP_003144047.1|   -------...---------sssnliyd....................................
gi|257063053|ref|YP_003142725.1|   -------...---------gmqlwdeekysilhginaianvegnfsydqdklggdsagwtths
gi|257064996|ref|YP_003144668.1|   -------...---------nd..........................................
gi|257063493|ref|YP_003143165.1|   -------...---------dp..........................................
D6J_gi|470176640|ref|YP_007562684.1| -------...---------............................................
gi|291301089|ref|YP_003512367.1|   AEPRTT-...---------tlsltthltppkhthsianrnqaeqaanalnafmveqsnghmsp
Inz_gi|386835930|ref|YP_006250098.1| -------...---------dlplradrcrtchp..............................
fvt_gi|397670638|ref|YP_006512173.1| -------...---------aemrqrvekiqttwqsslnvsftaleglindikaaeangtatee
fvt_gi|397670639|ref|YP_006512174.1| -------...---------vghk........................................
JDb_gi|494685058|ref|YP_007950632.1| NRSALTGqprCRSCH----a...........................................
GJn_gi|397654823|ref|YP_006495506.1| -------...---------emeqrvvqiqdrfihsrdqafdsltalikdlekakddpatpedr
GJn_gi|397654824|ref|YP_006495507.1| -------...---------tvghk.......................................
FP7_gi|379716143|ref|YP_005304480.1| E------...---------mkqrveqiqdrfihsrdqafdsltalikdlekakddpatpqdrl
FP7_gi|379716144|ref|YP_005304481.1| -------...---------tvghk.......................................
gi|317124994|ref|YP_004099106.1|   D------...---------mrarvdtihdryeaaknvsfdaltalikdiekaaqtgvaadrie
gi|317124995|ref|YP_004099107.1|   -------...---------evgh........................................
gi|317125004|ref|YP_004099116.1|   -------...---------ssttypdgttvqtvvrgstqvlplrgggfekamlgsseatkdmg
gi|317124997|ref|YP_004099109.1|   -------...CSQCHK---dpvlvqs.....................................
gi|317125003|ref|YP_004099115.1|   -------...---------gfttlpedvagkpsqsftdlavdfnpangsyhpieapgrnqtqk
gi|283455668|ref|YP_003360232.1|   AATVQWS...CPACHN---erm.........................................
gi|297572021|ref|YP_003697795.1|   -------...---------kemrgrveaiqhrwsdakdtaftavqslieditkaraegnvsea
gi|297572022|ref|YP_003697796.1|   -------...---------vghk........................................
sZN_gi|383763452|ref|YP_005442434.1| KVNVATA...CQTCHKF--seaeliqrietiqtrtaqllrsseeallaaidaivaareagasd
sZN_gi|383763451|ref|YP_005442433.1| -------...---------vgh.........................................
sZN_gi|383761442|ref|YP_005440424.1| -------...---------swnpvtgryepneedapapsfnkgelfpikrtfdewlysayatp
gi|57233597|ref|YP_180800.1|       -------...---------sgglmviglkfgqtsaedkaarekcnrlgreyikqfetrfgat.
gi|147668693|ref|YP_001213511.1|   -------...---------rgdtcgvisgglmviglkfgqasvedkaarekcnrlgreflkqf

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   ...............................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   faenskgahnrdrfmhvldqaeklldegdqll...............................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| gekptpsaelaalqklqrnaqfywdfvmvensegahnptltfetldkaeaaadealaml....
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   neaktdipaaseelaklqklqrnaqfywdfvmvensegahnskltnetldkaeaaadealaml
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   gqddr..........................................................
gi|257063543|ref|YP_003143215.1|   lqyiqraacyywnleaaensegahnpdfsreliasanewldkgdeil................
gi|257062798|ref|YP_003142470.1|   adveqakmdyakatwyyqtl...........................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   etatv..........................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   diqsllrhdqevltiivasafkgiihltrshdlspavvmaaaiaryaqdinnetqelrdtprm
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| qltlardyqrkaqfvvdysfsengrgfhapqysvsmlnqatdwarsgqlalrg..........
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| lklareyqnkasfyldyvysensngfhapdyiqriisdsldasrkgqlvlqgv..........
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| klareyqnkasfyldyvysensngfhapdytqriisdsldasrkgqlvlqgv...........
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   kaqsyqrkaqffvdyvvsensrgfhapqytlrvlndatdasrlgqlalvg.............
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   vlgahgwtsvnqlippaptqeattsshlggvnvmwgngalsatpntgkvmsspklectschdp
gi|317124997|ref|YP_004099109.1|   ...............................................................
gi|317125003|ref|YP_004099115.1|   ladslagpspyklwnfttndtvrcvschasnttgtsadpaengpdatltvhastnrgilirpy
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   nmkkaqefqrkaqfivdysvsensrgfhapqysvailneatdyarsgqlalrg..........
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| eelntalqlhrssqirwdfissenstgfhspqesarvladsinlarqaeleafkvltakq...
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| egvyapqfagarpdgvvrtcqdchmprmtgiaa..............................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   ...............................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   ...............................................................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| ...............................................................
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   ...............................................................
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   ...............................................................
gi|257063543|ref|YP_003143215.1|   ...............................................................
gi|257062798|ref|YP_003142470.1|   ...............................................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   ...............................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   rgclhceqivtdqfrwhekcqscrdahkdvisilrcltc........................
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| ...............................................................
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| ...............................................................
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| ...............................................................
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   ...............................................................
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   hgnkqyrilrpvpsdsgfsatafpdgilipdttnkvyttdnywsvgdtnvpaeeltttilgat
gi|317124997|ref|YP_004099109.1|   ...............................................................
gi|317125003|ref|YP_004099115.1|   enrvlskagqyydakgfalclachmet....................................
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   ...............................................................
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| ...............................................................
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| ...............................................................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ...............................................................
gi|269926701|ref|YP_003323324.1|   ...............................................................
TLn_gi|427724729|ref|YP_007072006.1| ...............................................................
TLn_gi|427724728|ref|YP_007072005.1| ...............................................................
Cy2_gi|428218884|ref|YP_007103349.1| ...............................................................
Cy2_gi|428218885|ref|YP_007103350.1| ...............................................................
gi|257060488|ref|YP_003138376.1|   ...............................................................
gi|166366918|ref|YP_001659191.1|   ...............................................................
gi|75910524|ref|YP_324820.1|       ...............................................................
gi|17229585|ref|NP_486133.1|       ...............................................................
UBy_gi|414077420|ref|YP_006996738.1| ...............................................................
gi|256827741|ref|YP_003151700.1|   ...............................................................
gi|256826940|ref|YP_003150899.1|   ...............................................................
gi|256827740|ref|YP_003151699.1|   ...............................................................
gi|256827321|ref|YP_003151280.1|   ...............................................................
IBJ_gi|339443845|ref|YP_004709849.1| ...............................................................
IBJ_gi|339446157|ref|YP_004712161.1| ...............................................................
IBJ_gi|339444403|ref|YP_004710407.1| ...............................................................
IBJ_gi|339444455|ref|YP_004710459.1| ...............................................................
IBJ_gi|339445173|ref|YP_004711177.1| ...............................................................
IBJ_gi|339445234|ref|YP_004711238.1| ...............................................................
IBJ_gi|339443846|ref|YP_004709850.1| ...............................................................
IBJ_gi|339445886|ref|YP_004711890.1| ...............................................................
IBJ_gi|339445619|ref|YP_004711623.1| ...............................................................
IBJ_gi|339444003|ref|YP_004710007.1| ...............................................................
gi|257792322|ref|YP_003182928.1|   ...............................................................
gi|257790295|ref|YP_003180901.1|   ...............................................................
gi|257790301|ref|YP_003180907.1|   ...............................................................
gi|257790348|ref|YP_003180954.1|   ...............................................................
gi|257790760|ref|YP_003181366.1|   ...............................................................
gi|257792421|ref|YP_003183027.1|   ...............................................................
gi|257792321|ref|YP_003182927.1|   ...............................................................
gi|257792266|ref|YP_003182872.1|   ...............................................................
gi|257790166|ref|YP_003180772.1|   ...............................................................
gi|257790742|ref|YP_003181348.1|   ...............................................................
gi|257791145|ref|YP_003181751.1|   ...............................................................
gi|257790421|ref|YP_003181027.1|   ...............................................................
gi|257792620|ref|YP_003183226.1|   ...............................................................
gi|257790072|ref|YP_003180678.1|   ...............................................................
gi|257790395|ref|YP_003181001.1|   ...............................................................
gi|257790768|ref|YP_003181374.1|   ...............................................................
gi|257790846|ref|YP_003181452.1|   ...............................................................
gi|257791488|ref|YP_003182094.1|   ...............................................................
gi|257792038|ref|YP_003182644.1|   ...............................................................
gi|257063543|ref|YP_003143215.1|   ...............................................................
gi|257062798|ref|YP_003142470.1|   ...............................................................
gi|257063165|ref|YP_003142837.1|   ...............................................................
gi|257063496|ref|YP_003143168.1|   ...............................................................
gi|257063059|ref|YP_003142731.1|   ...............................................................
gi|257064375|ref|YP_003144047.1|   ...............................................................
gi|257063053|ref|YP_003142725.1|   ...............................................................
gi|257064996|ref|YP_003144668.1|   ...............................................................
gi|257063493|ref|YP_003143165.1|   ...............................................................
D6J_gi|470176640|ref|YP_007562684.1| ...............................................................
gi|291301089|ref|YP_003512367.1|   ...............................................................
Inz_gi|386835930|ref|YP_006250098.1| ...............................................................
fvt_gi|397670638|ref|YP_006512173.1| ...............................................................
fvt_gi|397670639|ref|YP_006512174.1| ...............................................................
JDb_gi|494685058|ref|YP_007950632.1| ...............................................................
GJn_gi|397654823|ref|YP_006495506.1| ...............................................................
GJn_gi|397654824|ref|YP_006495507.1| ...............................................................
FP7_gi|379716143|ref|YP_005304480.1| ...............................................................
FP7_gi|379716144|ref|YP_005304481.1| ...............................................................
gi|317124994|ref|YP_004099106.1|   ...............................................................
gi|317124995|ref|YP_004099107.1|   ...............................................................
gi|317125004|ref|YP_004099116.1|   sivdptpkiktssvavspymanvaawcttchtrylapsqsyktdsgdavftyrhtgdnvsgdr
gi|317124997|ref|YP_004099109.1|   ...............................................................
gi|317125003|ref|YP_004099115.1|   ...............................................................
gi|283455668|ref|YP_003360232.1|   ...............................................................
gi|297572021|ref|YP_003697795.1|   ...............................................................
gi|297572022|ref|YP_003697796.1|   ...............................................................
sZN_gi|383763452|ref|YP_005442434.1| ...............................................................
sZN_gi|383763451|ref|YP_005442433.1| ...............................................................
sZN_gi|383761442|ref|YP_005440424.1| ...............................................................
gi|57233597|ref|YP_180800.1|       ...............................................................
gi|147668693|ref|YP_001213511.1|   ...............................................................

d19hca_                              ....................................................
gi|269926701|ref|YP_003323324.1|   ....................................................
TLn_gi|427724729|ref|YP_007072006.1| ....................................................
TLn_gi|427724728|ref|YP_007072005.1| ....................................................
Cy2_gi|428218884|ref|YP_007103349.1| ....................................................
Cy2_gi|428218885|ref|YP_007103350.1| ....................................................
gi|257060488|ref|YP_003138376.1|   ....................................................
gi|166366918|ref|YP_001659191.1|   ....................................................
gi|75910524|ref|YP_324820.1|       ....................................................
gi|17229585|ref|NP_486133.1|       ....................................................
UBy_gi|414077420|ref|YP_006996738.1| ....................................................
gi|256827741|ref|YP_003151700.1|   ....................................................
gi|256826940|ref|YP_003150899.1|   ....................................................
gi|256827740|ref|YP_003151699.1|   ....................................................
gi|256827321|ref|YP_003151280.1|   ....................................................
IBJ_gi|339443845|ref|YP_004709849.1| ....................................................
IBJ_gi|339446157|ref|YP_004712161.1| ....................................................
IBJ_gi|339444403|ref|YP_004710407.1| ....................................................
IBJ_gi|339444455|ref|YP_004710459.1| ....................................................
IBJ_gi|339445173|ref|YP_004711177.1| ....................................................
IBJ_gi|339445234|ref|YP_004711238.1| ....................................................
IBJ_gi|339443846|ref|YP_004709850.1| ....................................................
IBJ_gi|339445886|ref|YP_004711890.1| ....................................................
IBJ_gi|339445619|ref|YP_004711623.1| ....................................................
IBJ_gi|339444003|ref|YP_004710007.1| ....................................................
gi|257792322|ref|YP_003182928.1|   ....................................................
gi|257790295|ref|YP_003180901.1|   ....................................................
gi|257790301|ref|YP_003180907.1|   ....................................................
gi|257790348|ref|YP_003180954.1|   ....................................................
gi|257790760|ref|YP_003181366.1|   ....................................................
gi|257792421|ref|YP_003183027.1|   ....................................................
gi|257792321|ref|YP_003182927.1|   ....................................................
gi|257792266|ref|YP_003182872.1|   ....................................................
gi|257790166|ref|YP_003180772.1|   ....................................................
gi|257790742|ref|YP_003181348.1|   ....................................................
gi|257791145|ref|YP_003181751.1|   ....................................................
gi|257790421|ref|YP_003181027.1|   ....................................................
gi|257792620|ref|YP_003183226.1|   ....................................................
gi|257790072|ref|YP_003180678.1|   ....................................................
gi|257790395|ref|YP_003181001.1|   ....................................................
gi|257790768|ref|YP_003181374.1|   ....................................................
gi|257790846|ref|YP_003181452.1|   ....................................................
gi|257791488|ref|YP_003182094.1|   ....................................................
gi|257792038|ref|YP_003182644.1|   ....................................................
gi|257063543|ref|YP_003143215.1|   ....................................................
gi|257062798|ref|YP_003142470.1|   ....................................................
gi|257063165|ref|YP_003142837.1|   ....................................................
gi|257063496|ref|YP_003143168.1|   ....................................................
gi|257063059|ref|YP_003142731.1|   ....................................................
gi|257064375|ref|YP_003144047.1|   ....................................................
gi|257063053|ref|YP_003142725.1|   ....................................................
gi|257064996|ref|YP_003144668.1|   ....................................................
gi|257063493|ref|YP_003143165.1|   ....................................................
D6J_gi|470176640|ref|YP_007562684.1| ....................................................
gi|291301089|ref|YP_003512367.1|   ....................................................
Inz_gi|386835930|ref|YP_006250098.1| ....................................................
fvt_gi|397670638|ref|YP_006512173.1| ....................................................
fvt_gi|397670639|ref|YP_006512174.1| ....................................................
JDb_gi|494685058|ref|YP_007950632.1| ....................................................
GJn_gi|397654823|ref|YP_006495506.1| ....................................................
GJn_gi|397654824|ref|YP_006495507.1| ....................................................
FP7_gi|379716143|ref|YP_005304480.1| ....................................................
FP7_gi|379716144|ref|YP_005304481.1| ....................................................
gi|317124994|ref|YP_004099106.1|   ....................................................
gi|317124995|ref|YP_004099107.1|   ....................................................
gi|317125004|ref|YP_004099116.1|   darsrnciqchvahgsnavmpnssvewpdgttpssdsrllrvddrgicvmch
gi|317124997|ref|YP_004099109.1|   ....................................................
gi|317125003|ref|YP_004099115.1|   ....................................................
gi|283455668|ref|YP_003360232.1|   ....................................................
gi|297572021|ref|YP_003697795.1|   ....................................................
gi|297572022|ref|YP_003697796.1|   ....................................................
sZN_gi|383763452|ref|YP_005442434.1| ....................................................
sZN_gi|383763451|ref|YP_005442433.1| ....................................................
sZN_gi|383761442|ref|YP_005440424.1| ....................................................
gi|57233597|ref|YP_180800.1|       ....................................................
gi|147668693|ref|YP_001213511.1|   ....................................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045679 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Homo sapiens 76_38 - Human
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Mus musculus 76_38 - House mouse
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Trichoplax adhaerens
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Hydnomerulius pinastri v2.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Podospora anserina
NoYes   Trichoderma reesei 1.2
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Pichia pastoris GS115
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Kluyveromyces lactis
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba invadens 1.2
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Aquilegia coerulea v195
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma congolense 2.4
NoYes   Ectocarpus siliculosus
NoYes   Albugo laibachii 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Cyanothece sp. PCC 8802
NoYes   Microcystis aeruginosa NIES-843
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7120
NoYes   Anabaena sp. 90
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Ilumatobacter coccineus
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Propionibacterium propionicum F0230a
NoYes   Actinoplanes sp. N902-109
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Intrasporangium calvum DSM 43043
NoYes   Bifidobacterium dentium Bd1
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Ruminococcus sp.
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Clostridium difficile 630
NoYes   Clostridium saccharolyticum WM1
NoYes   [Ruminococcus] obeum
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. WN1359
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus faecalis 62
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Bacillus selenitireducens MLS10
NoYes   Solibacillus silvestris StLB046
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus epidermidis RP62A
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Candidatus Sulcia muelleri DMIN
NoYes   Candidatus Sulcia muelleri SMDSEM
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia glumae BGR1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax sp. KKS102
NoYes   Comamonas testosteroni CNB-2
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Magnetococcus marinus MC-1
NoYes   Caulobacter sp. K31
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella pneumophila str. Corby
NoYes   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Providencia stuartii MRSN 2154
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia billingiae Eb661
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Psychrobacter sp. PRwf-1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum oguniense TE7
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanoregula boonei 6A8
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus marisnigri JR1
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Natrialba magadii ATCC 43099
NoYes   Methanotorris igneus Kol 5
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis H538.4
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Cyanothece sp. PCC 8801
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. CcI3
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium pseudotuberculosis 258
NoYes   Corynebacterium pseudotuberculosis Cp162
NoYes   Corynebacterium pseudotuberculosis P54B96
NoYes   Corynebacterium pseudotuberculosis 267
NoYes   Corynebacterium pseudotuberculosis 1/06-A
NoYes   Corynebacterium pseudotuberculosis 42/02-A
NoYes   Corynebacterium pseudotuberculosis 3/99-5
NoYes   Corynebacterium pseudotuberculosis 31
NoYes   Corynebacterium pseudotuberculosis CIP 52.97
NoYes   Corynebacterium pseudotuberculosis PAT10
NoYes   Corynebacterium pseudotuberculosis I19
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Corynebacterium pseudotuberculosis C231
NoYes   Corynebacterium pseudotuberculosis 1002
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. VS
NoYes   Dehalococcoides sp. CBDB1
NoYes   Chthonomonas calidirosea T49
NoYes   Thermus oshimai JL-2
NoYes   Thermus thermophilus JL-18
NoYes   Thermus thermophilus SG0.5JP17-16
NoYes   Thermus thermophilus HB8
NoYes   [Eubacterium] cylindroides [Eubacterium] cylindroides T2-87
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus pyogenes MGAS6180
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus pyogenes MGAS10394
NoYes   Streptococcus thermophilus MN-ZLW-002
NoYes   Streptococcus thermophilus ND03
NoYes   Streptococcus salivarius JIM8777
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Staphylococcus pasteuri SP1
NoYes   Staphylococcus lugdunensis N920143
NoYes   Staphylococcus epidermidis ATCC 12228
NoYes   Chlorobium phaeobacteroides BS1
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Candidatus Sulcia muelleri CARI
NoYes   Candidatus Sulcia muelleri GWSS
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Blattabacterium sp. (Panesthia angustipennis spadica) Blattabacterium sp. (Panesthia angustipennis spadica) str. BPAA
NoYes   Blattabacterium sp. (Blaberus giganteus)
NoYes   Blattabacterium sp. (Blatta orientalis) Blattabacterium sp. (Blatta orientalis) str. Tarazona
NoYes   Blattabacterium sp. (Periplaneta americana) str. BPLAN
NoYes   Blattabacterium sp. (Cryptocercus punctulatus) str. Cpu
NoYes   Blattabacterium sp. (Mastotermes darwiniensis) str. MADAR
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Helicobacter cinaedi ATCC BAA-847
NoYes   Treponema pedis str. T A4
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Arcobacter butzleri 7h1h
NoYes   Arcobacter butzleri ED-1
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Ralstonia pickettii 12J
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Variovorax paradoxus B4
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Mannheimia succiniciproducens MBEL55E
NoYes   Bibersteinia trehalosi USDA-ARS-USMARC-192
NoYes   Aggregatibacter actinomycetemcomitans ANH9381
NoYes   Aggregatibacter actinomycetemcomitans D11S-1
NoYes   Haemophilus somnus 2336
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Haemophilus parasuis ZJ0906
NoYes   Haemophilus influenzae KR494
NoYes   Haemophilus influenzae F3047
NoYes   Haemophilus influenzae F3031
NoYes   Haemophilus influenzae 10810
NoYes   Haemophilus influenzae PittGG
NoYes   Haemophilus influenzae 86-028NP
NoYes   Haemophilus influenzae R2866
NoYes   Haemophilus influenzae R2846
NoYes   Haemophilus influenzae Rd KW20
NoYes   Actinobacillus suis H91-0380
NoYes   Actinobacillus pleuropneumoniae serovar 3 str. JL03
NoYes   Actinobacillus pleuropneumoniae serovar 7 str. AP76
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Thioflavicoccus mobilis 8321
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Pyrococcus furiosus DSM 3638
NoYes   Natronococcus occultus SP4
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Anaerobic methane oxidation (AOM) community from Eel River Basin sediment, California (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP10 from Narrow Gauge (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean1 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]