SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Fibronectin type III alignments in Caenorhabditis briggsae 2

These alignments are sequences aligned to the 0053850 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2dtge2      t......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   l......................................................................................
CBG06205   .......................................................................................
CBG06205   h......................................................................................
CBG09834   .......................................................................................
CBG06205   r......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   k......................................................................................
CBG06205   .......................................................................................
CBG06205   k......................................................................................
CBG09244   .......................................................................................
CBG17724   l......................................................................................
CBG14917   .......................................................................................
CBG17724   g......................................................................................
CBG06205   .......................................................................................
CBG17724   k......................................................................................
CBG09834   .......................................................................................
CBG13693   i......................................................................................
CBG09244   pm.....................................................................................
CBG17724   n......................................................................................
CBG11481   .......................................................................................
CBG03355   aprdfrid...............................................................................
CBG09834   a......................................................................................
CBG06205   .......................................................................................
CBG17724   q......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   y......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   t......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   a......................................................................................
CBG14221   v......................................................................................
CBG16558   .......................................................................................
CBG03240   s......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   tpr....................................................................................
CBG13693   .......................................................................................
CBG06205   gsdsgivnvtva...........................................................................
CBG09834   v......................................................................................
CBG13447   .......................................................................................
CBG06205   v......................................................................................
CBG01538   ktivfg.................................................................................
CBG14221   n......................................................................................
CBG03342   l......................................................................................
CBG17724   pvrdttsqh..............................................................................
CBG03355   vpahpv.................................................................................
CBG09834   i......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   a......................................................................................
CBG09834   p......................................................................................
CBG09834   .......................................................................................
CBG09834   r......................................................................................
CBG09834   lk.....................................................................................
CBG21718   .......................................................................................
CBG08127   pfeed..................................................................................
CBG17668   kvp....................................................................................
CBG17392   mrersqtg...............................................................................
CBG21718   sfee...................................................................................
CBG12070   s......................................................................................
CBG09834   qd.....................................................................................
CBG09247   twtkaev................................................................................
CBG15423   .......................................................................................
CBG12069   ygadktscrmisge.........................................................................
CBG16558   tg.....................................................................................
CBG04582   akl....................................................................................
CBG09834   vp.....................................................................................
CBG06205   p......................................................................................
CBG20606   f......................................................................................
CBG01082   psrv...................................................................................
CBG16558   vtgp...................................................................................
CBG07568   sfgtdylsip.............................................................................
CBG01939   tpt....................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   klg....................................................................................
CBG09834   rst....................................................................................
CBG03399   fr.....................................................................................
CBG08103   gddvvielrrts...........................................................................
CBG11320   ssssacl................................................................................
CBG24788   ssssacl................................................................................
CBG16558   nsegsdekkvpvkil........................................................................
CBG01538   k......................................................................................
CBG01538   etpakqpd...............................................................................
CBG17392   .......................................................................................
CBG16558   iqtptlvv...............................................................................
CBG14917   tlgapreirphagi.........................................................................
CBG18819   prnisvqer..............................................................................
CBG24788   d......................................................................................
CBG18819   rqtfsikvrktlcreyqpnhh..................................................................
CBG20606   vk.....................................................................................
CBG11320   d......................................................................................
CBG11546   vitqhl.................................................................................
CBG02994   tia....................................................................................
CBG05054   s......................................................................................
CBG01538   dpgvpslvenaigdkyfnvsfrpakyddetrap......................................................
CBG17392   kgvgq..................................................................................
CBG02405   hf.....................................................................................
CBG05053   dvt....................................................................................
CBG15732   vtakat.................................................................................
CBG01939   sgalv..................................................................................
CBG03226   .......................................................................................
CBG09244   tvaa...................................................................................
CBG21718   nnegnstas..............................................................................
CBG09834   l......................................................................................
CBG03240   lqd....................................................................................
CBG03226   daptldsie..............................................................................
CBG21718   rykfdls................................................................................
CBG17724   pl.....................................................................................
CBG03355   gpttlrpvrtwpp..........................................................................
CBG15191   .......................................................................................
CBG14788   k......................................................................................
CBG04582   kl.....................................................................................
CBG03342   vks....................................................................................
CBG03240   vq.....................................................................................
CBG15191   lpkig..................................................................................
CBG03362   s......................................................................................
CBG09834   nvrvkrqs...............................................................................
CBG11320   nftyflkitapditdfeavem..................................................................
CBG01538   ifftlsdvpvavhsayvsncdknslt.............................................................
CBG17668   peqpgkialaragfnllevswppvqgatayflqtgfvdtkdgpasekrvppsprkqpsaaavpqkeddknapaapslistqgttyta
CBG01939   rnv....................................................................................
CBG14320   slqc...................................................................................
CBG14320   qyvvqwk................................................................................
CBG03226   snen...................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   .......................................................................................
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   pappnttanegelpqdlfddteknertsasprpsgdaqaglstkkpdegagqsdegtekeeetsshenedddlawfdigvikdpavn
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                            10            20              30        
                                                             |             |               |        
d2dtge2      ......................................-NPSVP.LDPISV.SNSSS...QIILKWKPP......SDPNG....NIT
CBG06205   ......................................DTPGAP.GQPEAV.ETSEE...AITLQWTRP......TSDGGa...PIQ
CBG06205   ......................................DIPGAPeGPLRHK.DITKE...SVVLKWDEP......LDDGGs...PIT
CBG06205   ......................................DVPNQP.EAPTVR.DKDST...WAELEWDPP......KDGGS....KVI
CBG06205   ......................................--PEAPqGPLHIS.NIGPS...TATLSWRPP......VTDGGs...KIT
CBG06205   ......................................DKPSPPeGPLEVS.DVTKD...SCVLNWKPP......KDDGGa...EIS
CBG06205   ......................................------.------.-----...TCTLNWDAP......KDDGGa...EIA
CBG09834   ......................................-APGAV.EDLTAK.PKGPT...SVVVRWKPP......RDPNG....VIT
CBG06205   ......................................--PTPPkGPLDIT.DVCAD...GASLSWNPP......EDDGGd...PLT
CBG06205   ......................................DVPGTPeGPLKID.EVHKE...GCTLNWKPP......TDNGGt...DIL
CBG06205   ......................................DRPSKPnGPLEVS.DVFED...NLNLSWKPP......DDDGGe...PIE
CBG14917   ......................................-VPGKV.TSLVAT.ATGPE...TIDIRWSPP......SG--Gq...PAL
CBG09834   ......................................-APGAV.ANLRVQ.PIGPD...SLQCSWQPP......MNPNG....RIT
CBG06205   ......................................--PSSPlGPLEVT.NVYED...HCDLEWQVP......EDDGGa...PID
CBG06205   ......................................DHPSSPrGPLDIT.NIVKD...GCDLAWKEP......EDDGGa...EVS
CBG06205   ......................................--PTKPkGPIEVT.DVFED...RATLDWKPP......EDDGGe...PIE
CBG09244   ......................................DTPSAP.GDVSVV.KVESD...CLHIEWTAP......AENNGa...EVT
CBG17724   ......................................--PGRP.SMLSIG.DISAT...TVQLHFTPG......FDGHT....AIR
CBG14917   ......................................---STP.VGLRTE.AVSGT...SIRVMWTES......DESA-....FNT
CBG17724   ......................................----SP.RNIVVT.AEGSK...SAIVKWDPVae....LSTNG....DVI
CBG06205   ......................................DKPKPPkGPLETK.NVTAE...GLDLVWGTP......DPDEGa...PVK
CBG17724   ......................................--PAMP.ERVRAE.LHNETmpaKVRVRWNEG......FDGNE....PII
CBG09834   ......................................-APGSV.RDLRVK.ALSPN...EVHVQWLAP......LVQRG....TIV
CBG13693   ......................................--PSAP.GVPDVI.DAGIG...EVTVVWSAP......LQKNGg...EIR
CBG09244   ......................................------.----VK.VLDND...KVEVTWKTD......GENE-....---
CBG17724   ......................................------.--IITE.PLSSS...SIRVKWDAW......PKEDSe...TVT
CBG11481   ......................................-APDPP.RHLVAS.HATAD...SVMLRWSAPi.....YVDEG....KRY
CBG03355   ......................................------.-----T.QINFT...TINFTWNPVhe....NIVNG....HFV
CBG09834   ......................................--PLPP.QDLVVA.QEGTD...FFMVSWLPP......YPPYG....PHD
CBG06205   ......................................EKPGAP.DAPRVG.KITKN...SAELTWNRP......LRDGGa...PID
CBG17724   ......................................----AP.KNVRVK.VLNST...AVSLEFTAP......EQQRIpg..VNL
CBG03399   ......................................--PVAP.SSPEIK.SFTNR...SITLVWTHN......AARAHr...PIL
CBG14917   ......................................---SAP.LGLRST.SSGSR...FINVEWDPP......VQRNG....NIM
CBG03342   ......................................--PDPP.TSIEVN.PVDHD...KLSVCWQEP......EKHESnkmfPIL
CBG16558   ......................................---SAP.QNVEVI.VDPDN...RVTITWQPS......KYPNG....DIT
CBG02994   ......................................-VPSSP.RNFNAE.LTSAT...SVKLTWDAP......AAANG....ALL
CBG16558   ......................................----AP.ENIQLT.ANKPT...TISVQYEVP......SIPNG....NIS
CBG12373   ......................................-PPDPP.SDCQVV.STSAY...SVRLAWAPP......FSPDP....-DL
CBG09834   ......................................------.--PTVT.PDGAN...ALDVQWNAV......LDPKN....RVK
CBG09244   ......................................--PGIP.TGPIVYdDVTEN...TAEFSWKAP......ENNGGc...DIT
CBG14221   ......................................------.-----K.TINST...AVRLFWKKR......RVEEL....-ID
CBG16558   ......................................----AP.NEIVLL.PMPNQ...EINVEWTSP......DEVNG....QIT
CBG03240   ......................................----PA.VNVSLE.SVTRS...SATLRIVFA......THHDSt...SIS
CBG12347a  ......................................-VPNAP.QNVRV-.KTQST...SATLWWDAP......PDPTV....LIR
CBG12347c  ......................................-VPNAP.QNVRV-.KTQST...SATLWWDAP......PDPTV....LIR
CBG12347b  ......................................-VPNAP.QNVRV-.KTQST...SATLWWDAP......PDPTV....LIR
CBG09834   ......................................------.------.-----...---------......-----....---
CBG13693   ......................................---NPP.GQPQMV.EAGDD...WVKLEWAPS......AEQA-....---
CBG06205   ......................................DVPEPP.RFPIIE.NILDE...AVILSWKPP......ALDGGs...LVT
CBG09834   ......................................------.---TVE.PKGPR...EALVTWELPdkdq..KWNYG....VDI
CBG13447   ......................................-PPSRP.IKLVAN.AITAT...STRLSWNEP......SSLGGr...PEI
CBG06205   ......................................------.------.-----...---------......-----....---
CBG01538   ......................................------.------.-----...---------......-----....---
CBG14221   ......................................-FPSAP.TQPIIV.NVTDT...EVELRWNAP......STSGAg...PIT
CBG03342   ......................................--PAVV.RDLEVT.SITKD...SATITWEDV......E---A....NVI
CBG17724   ......................................------.------.--LAT...EITIRWDESlprkltEDAES....PVR
CBG03355   ......................................------.--VEAA.HCSER...KATIKWVAA......SDHGD....SIK
CBG09834   ......................................------.------.-----...---ISWRSK......EHTND....LIE
CBG17392   ......................................-RPSTP.VNPIVQ.KVKTN...EVTVAFKAS......EPNGS....PVT
CBG09834   ......................................----AP.RYPVVT.EVAQY...SLAIKWDVP......DC--G....VVG
CBG21718   ......................................--PKAP.LIVNTK.ILHNS...SVLISFVSA......DDVE-....PVE
CBG09834   ......................................------.---RVI.AEEPT...SITIEWESR......NREAG....---
CBG09834   ......................................----AP.GFVKVL.HTGAN...NAQLVWQSP......YPNPG....YVD
CBG09834   ......................................------.-ELEVT.DKTSN...SISLKWEGL......PQDQAt...HVV
CBG09834   ......................................------.----LL.SAGHD...NLKVKWTPP......AVIGE....KID
CBG21718   ......................................---DAP.TQIQVL.SVNAL...DATVVWHAP......QFPNS....PIT
CBG08127   ......................................------.------.-----...---------......-----....---
CBG17668   ......................................------.------.-----...---------......-----....---
CBG17392   ......................................------.------.-----...---------......-----....---
CBG21718   ......................................------.------.-EDDS...TLYINWNPI......ENPNG....EKL
CBG12070   ......................................-LPTPPdRGPFIK.EVTGH...YLTLSWIPTkr....APPRY....PQV
CBG09834   ......................................------.------.----N...DLIVKWKSE......GEGRG....-VY
CBG09247   ......................................------.------.-----...---------......-----....---
CBG15423   ......................................------.------.-VTGT...EVRIQWSVL......GKMEAlt..KIA
CBG12069   ......................................-TPSRP.SRPEAE.LSSDT...EIFLQWEAP......EGPTYl...EGI
CBG16558   ......................................------.------.-----...---------......-----....---
CBG04582   ......................................------.------.-----...---------......-----....---
CBG09834   ......................................------.------.-----...---------......-----....---
CBG06205   ......................................---TPPnGPLDVL.D----...---------......-----....---
CBG20606   ......................................------.------.-----...--RLKWRLPpqhrdtRDH-Sp...KVE
CBG01082   ......................................------.------.-----...---------......-----....---
CBG16558   ......................................------.------.-----...---------......-----....---
CBG07568   ......................................------.------.-----...---------......-----....---
CBG01939   ......................................------.------.---QG...IVNLTWEVP......PTMAN....RIA
CBG09834   ......................................---GVP.TNIRST.DVDSE...SIKLEWDVP......QCDETht..PID
CBG02994   ......................................---GPP.TNVRVE.ATSNS...TAVVQWDFE......SQ---....KAD
CBG15732   ......................................------.------.AVSDD...SIHFSWAQL......DLTDSdfr.KFL
CBG09834   ......................................------.------.-----...---------......-----....-VA
CBG03399   ......................................------.------.-----...---------......-----....---
CBG08103   ......................................-PPALP.LDLQKL.SATSN...SVLIGWVPQ......FD-GG....FNQ
CBG11320   ......................................------.------.-----...---------......-DVSM....PQT
CBG24788   ......................................------.------.-----...---------......-DVSM....PQT
CBG16558   ......................................------.------.-----...---------......-----....---
CBG01538   ......................................------.------.-----...---------......-----....---
CBG01538   ......................................------.------.-----...---------......-----....---
CBG17392   ......................................-RPDRV.QDVKLF.FVRQG...VLLVQWTPFdtekm.FIPNG....GKI
CBG16558   ......................................------.------.-----...---------......-----....---
CBG14917   ......................................------.------.-----...---------......-----....---
CBG18819   ......................................------.------.-KRKR...SIIIRWATGrlsk..AQQNE....NAN
CBG24788   ......................................----VP.GTLRPD.NVTGS...SLLLRWNGL......EPEHR....-PT
CBG18819   ......................................------.------.-----...---------......-----....---
CBG20606   ......................................------.------.PINAS...HVNISWIWD......TTSDCd...TKH
CBG11320   ......................................----VP.GTLRPD.NVTGS...SLLLRWNGL......EPEHR....-PT
CBG11546   ......................................------.------.-----...---------......-----....---
CBG02994   ......................................------.------.-----...---------......-----....---
CBG05054   ......................................--P---.------.-----...---------......-----....---
CBG01538   ......................................------.------.-----...---------......-----....---
CBG17392   ......................................--PKKA.RNLCVF.PVSHR...SFAITWDED......P----....-TN
CBG02405   ......................................------.------.-----...---------......-----....---
CBG05053   ......................................-KPQMA.TGLKFT.CLNSS...SMRISWIPG......YNGG-....FDQ
CBG15732   ......................................------.------.-----...---------......-----....---
CBG01939   ......................................------.------.-----...---------......-----....---
CBG03226   ......................................------.------.-----...SIKLMWDWP......VYHDFerykIVI
CBG09244   ......................................------.------.-----...---------......-----....---
CBG21718   ......................................------.------.-----...---------......-----....---
CBG09834   ......................................------.---RLL.NRTPT...TLNVAWEPV......WG--R....AHS
CBG03240   ......................................------.------.-----...---------......-----....---
CBG03226   ......................................------.------.-----...---------......-----....---
CBG21718   ......................................------.------.-----...---------......-----....---
CBG17724   ......................................----PP.SKPQI-.TSGQS...YVTLSWNDV......ANSDE....-IV
CBG03355   ......................................------.------.-----...---------......-----....---
CBG15191   ......................................----AP.QQVRVW.AVTPV...SACVRWYPS......NSNA-....---
CBG14788   ......................................--PKML.QSVSVE.AISHS...RALIQFNYK......EPQPS....IVL
CBG04582   ......................................------.-----R.ARTPN...SLTVYWPAN......WLTKA....-TS
CBG03342   ......................................------.------.-----...---------......-----....---
CBG03240   ......................................------.------.-----...---------......-----....---
CBG15191   ......................................-LPDPP.THVQVEiGPQPG...TLLVSWQPVsnqp..KPP-Sra..AVH
CBG03362   ......................................------.------.-----...-AQITWKIS......PQVRNa...EPG
CBG09834   ......................................------.------.-GTDS...LLTVEWEGI......QTGDHads.EVK
CBG11320   ......................................------.------.-----...---------......-----....---
CBG01538   ......................................------.------.-----...-AFIKFDHI......ESIHTia..PVK
CBG17668   vthyfharqapledqirelidkngfkcvndpcftaddk------.------.-----...---------......-----....---
CBG01939   ......................................------.------.-----...---------......-----....---
CBG14320   ......................................------.------.-----...---------......-----....---
CBG14320   ......................................------.------.-----...---------......-----....-QR
CBG03226   ......................................------.------.----E...MLRLDWEAP......ENANCea..FFV


                 40                                              50                                 
                  |                                               |                                 
d2dtge2      HYLVFWERQAEDSElfeld.................................Y--Clkglklpsrtwsppfesedsqkhnqseyeds
CBG06205   GYVIEKREAGTTEWtkaafgn...............................ILDT...............................
CBG06205   NYVVEKQEDGGRWVpcge..................................TSDT...............................
CBG06205   GYQVQYRDTSSGRWinaksdl...............................AEQC...............................
CBG06205   SYVVEKRDLSKDEWvtvtsn................................VKDM...............................
CBG06205   NYIVEKRDTRTNTWvpvsaf................................VTGT...............................
CBG06205   GYKIEYQEIGSQIWdkvpgl................................ISGT...............................
CBG09834   GYTLTYKLKSIGECgprsaapiekh...........................VRNE...............................
CBG06205   GYIVEAQDMDNKGKyievgrvd..............................PNTT...............................
CBG06205   HYIVEKMDTTRGTWqevgt.................................FPDC...............................
CBG06205   YYEVEKLDTATGRWvpcak.................................VKDT...............................
CBG14917   RYKIYYSHDPLEKSeketlit...............................TSTT...............................
CBG09834   QYEVTYQLISRGNCdnnqeaprtit...........................VNGS...............................
CBG06205   HYEIEKMDMATGRWvpcgr.................................SETT...............................
CBG06205   HYVIEKQDAATGRWtacge.................................SKDT...............................
CBG06205   FYEIEKMNTKDGIWvpcgr.................................SGDT...............................
CBG09244   SYVIEKKESGRRKFhkvgsvn...............................GKKT...............................
CBG17724   QWIVEGKMADSSVFahifnvss..............................PKAR...............................
CBG14917   QYTVRYSTSVDGNQhryvn.................................STET...............................
CBG17724   GYKLRVVPERESLMadetreidvpg...........................QSTL...............................
CBG06205   AYIIEMQEGRSGNWvkvge.................................TKGT...............................
CBG17724   KHAIEIRTMGPTGLwsdwttaidnipkddg......................KPCC...............................
CBG09834   GYDISYRLKHRLACpeeeprdvsrdfvtvyn.....................HKDL...............................
CBG13693   GYQLQMRELPDGEWedmgvdql..............................IKDT...............................
CBG09244   -FVVQYKSDGSSIWasidigeaa.............................AATS...............................
CBG17724   SFKVRYVPVASVLSsvsseeevmi............................VDTN...............................
CBG11481   WYTITYKPRTPQRRnnvvavdf..............................INKD...............................
CBG03355   GYEIEYWKTENTVRkysikip...............................ANST...............................
CBG09834   AYKIRYQQIPSENWienekgvkdpllkcpge.....................SPRF...............................
CBG06205   GYIIEKKKLGDNDWtrcndkp...............................VRDT...............................
CBG17724   GYKVQFWKGEPEKGelykqvildpd...........................RRQL...............................
CBG03399   RFSVSVRTVPFASYcppsivnfrfvmaap.......................SNAT...............................
CBG14917   RYHVFYKDNSIDRErmin..................................SSST...............................
CBG03342   DYAVYYKEIPNFPLlggdmgl...............................P--Lltgdysdigdiqedeyqqeeddaeevvkdst
CBG16558   KYNVYITGDPSLPVdqwqvfpvdevt..........................DPKL...............................
CBG02994   GYYVYLDRIINGEPavdknskkrmvmikd.......................STKR...............................
CBG16558   KYIIYYTPLDDQDPnhqlgqvqtkpinewlnvhdlndgv.............EGPR...............................
CBG12373   TYNIRYRLKHNEDAkvrelrg...............................IKGN...............................
CBG09834   GYIIEIRNSDTPVWqeiggvtnhdsv..........................KSTY...............................
CBG09244   EYNVERKESKNKGWkqcgk.................................TKEL...............................
CBG14221   GYYIKWRGPPRTNDnqyvnvts..............................PSTE...............................
CBG16558   NYIIHYGEIAEDGSepttwdqitip...........................RDDV...............................
CBG03240   NCQMHIVVRDMNGKsvfdkrmqlts...........................TFAP...............................
CBG12347a  GYTVEYGEGSISQRilieg.................................PDST...............................
CBG12347c  GYTVEYGEGSISQRilieg.................................PDST...............................
CBG12347b  GYTVEYGEGSISQRilieg.................................PDST...............................
CBG09834   --------------......................................---Q...............................
CBG13693   GYIVEYREVGDPTWhtanydp...............................IVQN...............................
CBG06205   NYTIEKREAMGGSWapcak.................................SRYT...............................
CBG09834   TYKLKQLGGCNEVQtgakepvtlln...........................VQEK...............................
CBG13447   WYEVRCSGRGECGSvvmtpsdkr.............................LSTR...............................
CBG06205   --------------......................................----...............................
CBG01538   --------------......................................PSAT...............................
CBG14221   GYIIQYYSPDLGQTwynipdy...............................VATT...............................
CBG03342   VFRVQLFASNGSLVntvn..................................STAD...............................
CBG17724   AVQVSYQKTNEDEWltlekkfe..............................YSKR...............................
CBG03355   KYIVEMFTDFKKNEwevineevnv............................NKEN...............................
CBG09834   SFVLEWKATTEQNWrqhrnpipyngw..........................QRPY...............................
CBG17392   GYIIRLMLNGEFFQedfvrpeevei...........................NGTF...............................
CBG09834   DYQVELTGVSAPFDvhrqt.................................VTQP...............................
CBG21718   NYTLMYKKTEEDEWkasnfqs...............................DVDG...............................
CBG09834   GFIVEYRLEGGAWQqynrripahps...........................QTTY...............................
CBG09834   KYKCRYAPTGTQQFqerqfpavspcqqrqierqnlpqsppg...........ARLH...............................
CBG09834   GYVLEFKSEDDNAEwqeyngvvkhrks.........................TQDY...............................
CBG09834   KYDLFISVASVLDQnpkkfdvs..............................GHTT...............................
CBG21718   SYIILASNDPKEDKstwlqyesnaketq........................INRM...............................
CBG08127   --------------......................................----...............................
CBG17668   --------------......................................----...............................
CBG17392   --------------......................................--QL...............................
CBG21718   EYNLYLSNYKTKV-......................................-SGP...............................
CBG12070   TYVIEIRELPEKEWtlldyn................................IPEP...............................
CBG09834   GYHVQFRSENSGWKtygqlvpyvgd...........................NMEY...............................
CBG09247   --------------......................................TKQA...............................
CBG15423   KFIIEVQTFGASEEswieadsvd.............................SHVR...............................
CBG12069   TYRLEYRVAGPNDHgapwitisek............................IDDE...............................
CBG16558   --------------......................................----...............................
CBG04582   --------------......................................---R...............................
CBG09834   --------------......................................----...............................
CBG06205   --------------......................................----...............................
CBG20606   GYLVELRTRKNRKWraaerqfign............................MEKD...............................
CBG01082   --------------......................................----...............................
CBG16558   --------------......................................----...............................
CBG07568   --------------......................................----...............................
CBG01939   SYNVEYAETGNNRYwqkiqfh...............................GASS...............................
CBG09834   GYEYIVYEASQNAPakgasy................................VGAP...............................
CBG02994   SFVVKYMHEPGNRMdtekwkqlpvlsidke......................NPKR...............................
CBG15732   GYELFYKYQKAVFLlsgsgqnrskmtidddrsacvdswssvfiqhyedgkkvIEAT...............................
CBG09834   EYQVDIRTTDERSWravepsveneqs..........................QTHY...............................
CBG03399   --------------......................................----...............................
CBG08103   SYVLESRKIDPYSGeiddnapvsrldihavqqeyeidgal............VSKT...............................
CBG11320   QYEIYFTRKNTDKVkhvrsf................................SDRI...............................
CBG24788   QYEIYFTRKNTDKVkh....................................VRSF...............................
CBG16558   --------------......................................----...............................
CBG01538   --------------......................................----...............................
CBG01538   --------------......................................----...............................
CBG17392   VYYVQRRFANTNSHyiaff.................................DESD...............................
CBG16558   --------------......................................----...............................
CBG14917   --------------......................................----...............................
CBG18819   LFLVQWRWGLHEEEsamtewqtvtv...........................RNKP...............................
CBG24788   SIAIQYRESGGANNewqsptnasfepd.........................VATE...............................
CBG18819   ---------SDTRWhdlr..................................VTEC...............................
CBG20606   AVQITCLDVRGSEIsatia.................................SDRT...............................
CBG11320   SIAIQYRESGGANNewqsptnasfepd.........................VATE...............................
CBG11546   ---VKVYDLSGNMStnkrsisvp.............................IPLT...............................
CBG02994   --------------......................................----...............................
CBG05054   --------------......................................----...............................
CBG01538   --------------......................................----...............................
CBG17392   YYDLEMYNCSTNVSkvvrkd................................LGSY...............................
CBG02405   --------------......................................----...............................
CBG05053   TFAVHAQNDMNLQWtsik..................................TSRN...............................
CBG15732   --------------......................................--GN...............................
CBG01939   --------------......................................----...............................
CBG03226   SYGIGRADSKEMEVt.....................................NKEE...............................
CBG09244   --------------......................................----...............................
CBG21718   --------------......................................----...............................
CBG09834   GYTLTARTLYSVYGnvrlqqiksfdvd.........................ASQT...............................
CBG03240   SFSIEYRQINPDKKfpvlqildipe...........................QKNL...............................
CBG03226   --------------......................................----...............................
CBG21718   --------------......................................----...............................
CBG17724   GHLLQAKRVSVAEEtengyvs...............................Q--Rprrneirgaksaaqtsassnsnrpthpigew
CBG03355   --------------......................................----...............................
CBG15191   EHVVSLNAVKVGVCp.....................................PTVF...............................
CBG14788   KFKIQWSDTEDFKTvigeiiepr.............................PLEN...............................
CBG04582   KFTIKAKTIHSPTGifkeiensaigep.........................GKAH...............................
CBG03342   --------------......................................----...............................
CBG03240   --------------......................................----...............................
CBG15191   SYLIYADGKNIAQVpqat..................................ADHV...............................
CBG03362   RYRICTIVSRQDPEfagmcddveegveavkcvp...................QMNN...............................
CBG09834   GFLVEYRPERSGEWqlhpgiipykgp..........................NHQY...............................
CBG11320   --------------......................................YTSS...............................
CBG01538   EFWVQYQMDSETEGsqwrthpspsaahpndqvtdql................RTTS...............................
CBG17668   --------------......................................----...............................
CBG01939   --------------......................................----...............................
CBG14320   --------------......................................----...............................
CBG14320   TYALGYYDESQWITasv...................................ESDG...............................
CBG03226   NYTILTLSRPRSFSl.....................................ATSD...............................


                                                                                            60      
                                                                                             |      
d2dtge2      ageccscpktdsqilkeleessfrktfedylhnvvfvprpsrkrrslgdvgnagnneehrpfekvvnkeSLVISG....LRHFTGYR
CBG06205   .....................................................................KHRVTG....LTPKKTYE
CBG06205   .....................................................................SLKVNK....LSEGHEYK
CBG06205   .....................................................................HTRVTG....LRQNGEFE
CBG06205   .....................................................................NYIVTG....LFENHEYE
CBG06205   .....................................................................SITVPK....LTEGHEYE
CBG06205   .....................................................................SYTVRG....LEHGQQYR
CBG09834   .....................................................................EQTLEG....LLPDSTYE
CBG06205   .....................................................................NLKVSG....LRNKGNYK
CBG06205   .....................................................................TAKVNK....LVPGKEYS
CBG06205   .....................................................................KAHIDG....LKKGQTYQ
CBG14917   .....................................................................HYTLHG....MDKYTGYQ
CBG09834   .....................................................................HFTITG....LHPHSKYR
CBG06205   .....................................................................KTTVPN....LQPGHEYK
CBG06205   .....................................................................NFHVDD....LVQGHEYK
CBG06205   .....................................................................HFTVDT....LNKGDHYK
CBG09244   .....................................................................SHVIDD....LEIETPYI
CBG17724   .....................................................................SIIVTG....LRPFTQYQ
CBG14917   .....................................................................WATVEG....LRPATEYE
CBG17724   .....................................................................MTKVSN....LRPFTSYY
CBG06205   .....................................................................DFKVKD....LKEHGEYK
CBG17724   .....................................................................WADIED....LRPSSTAE
CBG09834   .....................................................................DYTITG....LLPYSLYE
CBG13693   .....................................................................SCRVTN....LTSHEV-Q
CBG09244   .....................................................................KCIIDG....LREGIPYV
CBG17724   .....................................................................ECILSD....LRKFAEYQ
CBG11481   .....................................................................RYLVTG....LKSFTLYE
CBG03355   .....................................................................YKIINS....FHAVTNYS
CBG09834   .....................................................................CYNATG....LESGQQFK
CBG06205   .....................................................................AFEVKN....LGEKEEYE
CBG17724   .....................................................................STVVNE....LEKFGHYN
CBG03399   .....................................................................TVIVDN....LSPYTLYA
CBG14917   .....................................................................SATLTS....LQPFTMYL
CBG03342   ...............iaprgkrdvdfesdgikvavrekrstmvivtrddvtnsttirefafrninttdkCVTLPD....LRSATRYI
CBG16558   .....................................................................VLQRGA....LQPETPYY
CBG02994   .....................................................................YWELDN....LDPNTEYS
CBG16558   .....................................................................KVDIKDf...VNTDTAYA
CBG12373   .....................................................................TVEIMS....VDSCSLYE
CBG09834   .....................................................................FKKLTG....LDSDTLYF
CBG09244   .....................................................................KFKVDG....LEADTSYD
CBG14221   .....................................................................NFVVSN....LMPFTNYE
CBG16558   .....................................................................NHKLAN....LEPKKTYA
CBG03240   .....................................................................LLNLDG....LRPFHKYT
CBG12347a  .....................................................................SFTVTR....LAPNTNYV
CBG12347c  .....................................................................SFTVTR....LAPNTNYV
CBG12347b  .....................................................................SFTVTR....LAPNTNYV
CBG09834   .....................................................................NTLIDQ....LQPGSLYR
CBG13693   .....................................................................GIQVEG....LRRNSTYE
CBG06205   .....................................................................YTTVEG....LRAGKQYE
CBG09834   .....................................................................QIPLEN....LQPGSLYE
CBG13447   .....................................................................SIQING....LRPSSDYT
CBG06205   .....................................................................------....-----MFQ
CBG01538   .....................................................................QGTITD....LKPATLNH
CBG14221   .....................................................................EYRIKG....LKPSHSYM
CBG03342   .....................................................................IYRFSD....LSSATNYS
CBG17724   .....................................................................RAVIKH....LSPNSMFR
CBG03355   .....................................................................FEVDIT....LTPWVNYT
CBG09834   .....................................................................SVDLGE....LPQGHTYQ
CBG17392   .....................................................................KHKFQE....LKANTNYT
CBG09834   .....................................................................HVSVTN....LLPGTFYS
CBG21718   .....................................................................KVLLDG....LTPNQTYE
CBG09834   .....................................................................TATVDG....LPTNAVVD
CBG09834   .....................................................................CGRIEN....LKPEQTYD
CBG09834   .....................................................................KITVKQ....LETATLYF
CBG09834   .....................................................................DYHFRN....LDSVTQYN
CBG21718   .....................................................................LLPTGS....LEKSTEYF
CBG08127   .....................................................................-ITIPD....LAPNTQYV
CBG17668   .....................................................................------....LINGHTYR
CBG17392   .....................................................................LFEVFS....LQPNTRYT
CBG21718   .....................................................................PVRIPD....IPLNVNIS
CBG12070   .....................................................................VCKVRN....LELGKSYQ
CBG09834   .....................................................................TQTLTG....LERGNAYF
CBG09247   .....................................................................FITLFN....LVPGENYT
CBG15423   .....................................................................ATTIKS....LISDNKYK
CBG12069   .....................................................................SVVVRH....LSPFGIYQ
CBG16558   .....................................................................------....--------
CBG04582   .....................................................................DYTFVG....LAGNTTYR
CBG09834   .....................................................................------....--------
CBG06205   .....................................................................------....--------
CBG20606   .....................................................................SITVEN....LLPNTEYQ
CBG01082   .....................................................................------....--------
CBG16558   .....................................................................------....--------
CBG07568   .....................................................................------....--------
CBG01939   .....................................................................SAALHH....LKSNTEYL
CBG09834   .....................................................................HVIIRG....LRQNVDYT
CBG02994   .....................................................................FAIVSD....LNAHKPYA
CBG15732   .....................................................................LLAKDR....IRPNTLYA
CBG09834   .....................................................................RLPLGQ....LNVASTYL
CBG03399   .....................................................................------....--------
CBG08103   .....................................................................VFNFTG....LTPLSTYN
CBG11320   .....................................................................HVEN-Gi...LDKETDYD
CBG24788   .....................................................................SDRIHGengiLDKETDYD
CBG16558   .....................................................................------....--------
CBG01538   .....................................................................-----D....VKPFQPYE
CBG01538   .....................................................................------....--------
CBG17392   .....................................................................QCELEN....IPGETEVT
CBG16558   .....................................................................------....--------
CBG14917   .....................................................................------....--------
CBG18819   .....................................................................YAILKHl...LSPGRFYE
CBG24788   .....................................................................LVPVTN....LLSATTYD
CBG18819   .....................................................................TAILKG....LSFDCDYK
CBG20606   .....................................................................FWMLGG....LEAETAYD
CBG11320   .....................................................................LVPVTN....LLSATTYD
CBG11546   .....................................................................RLQIDG....LKPATAYN
CBG02994   .....................................................................------....--------
CBG05054   .....................................................................------....--------
CBG01538   .....................................................................------....--------
CBG17392   .....................................................................RTTVGE....LPPSTLFH
CBG02405   .....................................................................------....--------
CBG05053   .....................................................................ETILDH....LEPFVSYR
CBG15732   .....................................................................QWLLGN....LKHYTIYA
CBG01939   .....................................................................------....--------
CBG03226   .....................................................................FVLLDK....LEPSNQYS
CBG09244   .....................................................................------....--------
CBG21718   .....................................................................------....--------
CBG09834   .....................................................................EFVIRG....LHPSTVYN
CBG03240   .....................................................................EFYLGN....LNSGFDYS
CBG03226   .....................................................................------....--------
CBG21718   .....................................................................----VG....LKPKTFYR
CBG17724   ........................................................itlrptdgksekeQVSYRE....LQPSSFYV
CBG03355   .....................................................................------....--------
CBG15191   .....................................................................QVQLQG....LQPSTIYR
CBG14788   .....................................................................RIIIHN....LEHGKHYF
CBG04582   .....................................................................EFVVDN....LLPSSTYN
CBG03342   .....................................................................------....--------
CBG03240   .....................................................................-VIVDE....LFGGHTYN
CBG15191   .....................................................................VLRLSD....LSDDPPIF
CBG03362   .....................................................................SVVMGQ....LWRDRTYY
CBG09834   .....................................................................RVQIPK....LPTGISYL
CBG11320   .....................................................................TDVKID....VTPGNQYN
CBG01538   .....................................................................GSATVS....LQPFGKYV
CBG17668   .....................................................................----VP....LINGHTYR
CBG01939   .....................................................................------....--------
CBG14320   .....................................................................------....--------
CBG14320   .....................................................................MIKVDG....MIPGVQYK
CBG03226   .....................................................................EHANIK....MFPEHTLD


               70                   80                         90                                   
                |                    |                          |                                   
d2dtge2      IELQAC....N.QDT......PEER...........C--...--...--------................................
CBG06205   FRVAAY....N.AAG......QGEY...........SAN...SV...PITADNAPtrpkinmgmltrdvlayagdrakilvpfaasp
CBG06205   FRVKAV....N.RQG......TSAPlt.........SDHa..IV...AKNPFDE-................................
CBG06205   FRIIAK....N.AAG......FSKP...........SPP...SE...RCQLKSRY................................
CBG06205   FRVSAQ....N.ENG......IGAPlvs........EHP...IV...ARLPFDPP................................
CBG06205   FRVMAE....N.AFG......RSD-...........---...--...-SLNTDEP................................
CBG06205   FRIRAE....N.AVG......LSD-...........---...--...--YCQGVP................................
CBG09834   IHVVAH....T.SHA......-GPQ...........SSV...VT...VTTEEAAP................................
CBG06205   FRVKAV....N.NEG......ESEP...........LSA...DQ...YTQIKDPW................................
CBG06205   FRVKAV....N.LQG......ESKP...........LEA...--...-----EEP................................
CBG06205   FRVKAV....N.KEG......ASDA...........LSTdkdTK...AKNPY---................................
CBG14917   IRIEAE....G.ANG......SGLS...........SDT...VR...IRTQSDEP................................
CBG09834   VGVAAK....S.DVG......AGE-...........RVS...LE...IQTDQAAP................................
CBG06205   FRVRAV....N.KEG......ESDP...........LTT...NT...AILAKNPY................................
CBG06205   FRVKAV....N.RHG......DSDP...........LEA...RE...AIIAKDPF................................
CBG06205   FRVKAV....N.SEG......ASEP...........LET...DTdilAKNPF---................................
CBG09244   IRIAAV....N.KFG......TGEF...........IET...KP...VQTGSPFQ................................
CBG17724   LRLIAE....N.VKG......RGAP...........SEP...SRt..FETLQTNP................................
CBG14917   FAVRAV....A.SNGq.....LSTW...........SMA...AR...NRTWSAPP................................
CBG17724   VYMSAY....T.IVG......NGPEn..........STP...LS...FETLEDVP................................
CBG06205   FRVKAQ....N.ECG......LSDPlt.........GES...VL...AKNPYGVP................................
CBG17724   FRVVAS....N.KHG......PGKP...........SLP...SS...SVTMPQQP................................
CBG09834   VRVRAR....T.TEL......G--P...........EET...KE...VSTEQQPP................................
CBG13693   FRVSAY....G.RTG......FGPT...........SNP...SL...PVKIPISE................................
CBG09244   FRVAPR....N.QHG......TGEF...........SEQ...TVpv.VVLADDAPrvlkaikpvkipkkcelrlechaaghpapeyi
CBG17724   ISVSPY....N.RAG......EGK-...........MSQ...VR...EKTLEDKP................................
CBG11481   FSVYVT....T.RYG......QSVP...........IKV...QE...YTEPCT--................................
CBG03355   AHIRTR....N.KRL......RSAP...........SLP...VS...FAMPEGPP................................
CBG09834   VQVATR....I.EGGs.....YGPW...........SSL...VI...ANTLQVLP................................
CBG06205   FRVIAV....N.SAG......EGEP...........SKP...SD...LVLIEEQPgrpifditnlkditvragetiqiripyaggnp
CBG17724   LTVLCF....T.TPG......DGPK...........SNI...LR...VVTEEDTP................................
CBG03399   FSVRAE....N.SAG......SSDF...........GPE...TT...FRTLGEPP................................
CBG14917   IRVTAE....N.EAG......MGKF...........SDS...LK...VTTNKEQA................................
CBG03342   VYVTAR....N.EYG......TSVP...........SVR...NI...ASTNVHMVknnaslpdamkcctaanvssfcsskmcnvaed
CBG16558   VKIAAV....N.PHG......EGIH...........TDA...KH...FDTVSGAP................................
CBG02994   FRLNGF....N.RNG......DGEF...........TER...KN...VVTQGIPP................................
CBG16558   VVVQAI....N.DDG......PGPY...........SNQ...YT...IRTMSRAR................................
CBG12373   FRITAH....N.KFG......ESKA...........VYL...VQ...YTEPQ---................................
CBG09834   VRIKVV....D.HRQr.....VGVP...........SPE...AQ...ARTGCAAP................................
CBG09244   VKVSAI....N.TMG......TGVA...........LEG...KL...NTLKKATEkkvekveikeeks...................
CBG14221   FFVIPY....H.SGVhsv...HGAP...........SNS...MD...VLTAEAPP................................
CBG16558   VRVQAV....S.DRG......PGVI...........SAP...QV...IKTLPLAP................................
CBG03240   VNTQII....C.GGG......HETP...........QCP...AA...TRTMRQ--................................
CBG12347a  FAVSAY....N.EAEg.....EDGT...........KVM...VA...AKTRPAEG................................
CBG12347c  FAVSAY....N.EAEg.....EDGT...........KVM...VA...AKTRPAEG................................
CBG12347b  FAVSAY....N.EAEg.....EDGT...........KVM...VA...AKTRPAEG................................
CBG09834   IKVRAY....T.AEG......PGPW...........SDS...LE...IRTTGSEL................................
CBG13693   FCVISV....M.DNL......YSHP...........SET...SD...IIHLRPMG................................
CBG06205   FRITAE....N.KHG......PSKP...........CEP...TA...PVTI----................................
CBG09834   VTVTPR....R.PPSlhss..IVTP...........KTV...RT...FRTKNDVP................................
CBG13447   FLVFAK....N.KVSgelae.FSEK...........SAV...ID...IRTRSEEE................................
CBG06205   FRVAAV....N.AEG......ESEP...........LET...FG...TTLAKDPF................................
CBG01538   AYIQVT....N.GAH......EGPS...........SDT...ID...FQTDEGVP................................
CBG14221   FVIRAE....N.EKG......IGTP...........SVS...SA...LVTT----................................
CBG03342   VRVTAI....N.LQG......EGPP...........SWN...VS...FVTRPAQV................................
CBG17724   FRIRFI....G.DFL......ESSW...........SPE...SEw..MRTLPSAP................................
CBG03355   FRVVAV....N.SHG......RSDMkidgqsk....EDW...LT...CQTRPSFP................................
CBG09834   VRIVAK....DpNRG......NAYT...........SSV...VQ...VQTQSQCK................................
CBG17392   VSIAAK....N.AAG......ISC-...........KVE...VP...VQTRSE--................................
CBG09834   VKVRAV....D.RSRn.....VGPWn..........SEV...LE...AKTKGDAL................................
CBG21718   IKMFVT....G.DAV......QGIP...........SNS...AS...FTTNTTALalvktepeeeysadpqtneplsimctvksvsk
CBG09834   LRVRVV....S.QQNe.....QSNP...........SPE...VR...ARTKCSPP................................
CBG09834   FQVSAHv...K.DSG......WGPY...........SPP...ER...TKVTDSAV................................
CBG09834   FRLRVV....G.KNDk.....RGQP...........GPE...TK...ETTSCGKP................................
CBG09834   VTVQGT....S.EGN......KLWF...........ISS...VF...STTDFAEG................................
CBG21718   VCVRAK....N.TAG......IGPT...........SSL...TS...FVTLNGGP................................
CBG08127   VKARAV....N.EAG......HSDY...........TEE...IN...FETTDPWV................................
CBG17668   FRVCAV....N.GLG......KGAW...........SET...QS...FKTCTPGY................................
CBG17392   ITMCAR....M.DARkl....RGPP...........TKP...FE...FRTAPGRP................................
CBG21718   LRISAE....N.EYG......EGEK...........TFP...IW...IPTPNGGP................................
CBG12070   FRVRAE....N.IYG......ISDP...........SPA...--...--------................................
CBG09834   IHVQVL....D.RNS......YVMYt..........SAQ...SS...AKSSCSPP................................
CBG09247   FRVRAD....N.TFG......QSEP...........SEE...SE...IVYVKDNSrvleepkkkevkmkeqesvdyqkiskeagpse
CBG15423   FRIKMV....R.DDG......SHVL...........SLP...TD...WMTVEATS................................
CBG12069   FRVTAQ....N.GFG......LGLP...........SLS...SR...I-------................................
CBG16558   ------....-.---......----...........---...--...--------................................
CBG04582   ISVEGF....N.NDT......SLWY...........SSN...MA...TTSLAALP................................
CBG09834   ------....-.---......----...........---...--...FTTQSTNP................................
CBG06205   ------....-.---......----...........---...--...--------................................
CBG20606   FRVRSV....E.SAA......IGEP...........SMP...SDw..VKTAPGAP................................
CBG01082   ------....-.---......----...........---...--...--------................................
CBG16558   ------....-.---......----...........---...--...--------................................
CBG07568   ------....-.---......----...........---...II...P-------................................
CBG01939   LRIKTA....L.VNN......IVTE...........SGQ...FR...FRTPRVET................................
CBG09834   FKVRSR....S.VNG......HSQW...........SKD...VI...IETAIAGSvssgelgelnqllrvk................
CBG02994   FCVLAV....K.NNR......QGPC...........SDP...PT...VLESVTPT................................
CBG15732   YYVATQ....M.VRH......PGARngi........SKI...GF...VRTKYAVP................................
CBG09834   VRVRAL....D.SSR......STVAt..........SPS...AS...FSVLCQVP................................
CBG03399   ------....-.---......----...........---...--...--TEDSVP................................
CBG08103   LRVQAV....S.EKG......QSEF...........TPV...LI...ASTE----................................
CBG11320   VTVTWL....N.RYSp.....ASGV...........SSS...RS...FRTGFGYP................................
CBG24788   VAVTWL....N.RYSp.....ASGV...........SSS...RS...FRTGFGYP................................
CBG16558   ------....-.---......----...........---...--...--------................................
CBG01538   VQVQAV....N.SEG......RTNVv..........PET...VE...GRTGEGVP................................
CBG01538   ------....-.---......----...........---...--...--------................................
CBG17392   VYIRAAihvdD.SSV......NGDW...........SLP...AR...IITPR---................................
CBG16558   ------....-.---......----...........---...--...--------................................
CBG14917   ------....-.---......----...........---...--...--------................................
CBG18819   FRIAAV....S.QEGslg...FSAP...........SKP...FK...ISKEAKAP................................
CBG24788   YRFVAT....Y.TGT......YTIDgkvlafkedylQLI...QQ...ARTKAGVP................................
CBG18819   VEVQDTvtg.D.TVV......DGVF...........STD...TC...EQTSSLTP................................
CBG20606   CDLKAI....D.NHGn.....FGPT...........SKK...FR...IHTKQHPP................................
CBG11320   YRFVAT....Y.TGT......YTIDgkvlafkedylQLI...QQ...ARTKAGVP................................
CBG11546   VTVQAG....T.SYG......YGNK...........VWC...AY...ATLDT---................................
CBG02994   ------....-.---......----...........---...--...--TPVGSP................................
CBG05054   ------....-.---......----...........---...--...--------................................
CBG01538   ------....-.---......----...........---...--...--------................................
CBG17392   FRVKSV....N.NDG......ECW-...........SEV...RE...ATTQ----................................
CBG02405   ------....-.---......----...........---...--...-TTGQKRP................................
CBG05053   VSIESV....N.AKG......----...........---...--...--------................................
CBG15732   ITIQAC....Q.NTSnf....PHYC...........SVP...HK...AATKKRTL................................
CBG01939   ------....-.---......----...........---...--...--------................................
CBG03226   ISVRNA....S.TEL......----...........SLT...SK...ATQLEQVT................................
CBG09244   ------....-.---......----...........---...--...--------................................
CBG21718   ------....-.---......----...........-VR...IR...VLG-----................................
CBG09834   VTL---....-.---......----...........---...--...--------................................
CBG03240   VRVIAH....K.DGI......SSR-...........---...PW...ISTLTTKP................................
CBG03226   ------....-.---......----...........---...--...--------................................
CBG21718   ARIAGK....N.LHA......DGPP...........SEV...VE...FETAYSEV................................
CBG17724   FRVFTR....N.VRG......IGRA...........SPE...T-...--------................................
CBG03355   ------....-.---......----...........---...--...------RI................................
CBG15191   VSVR--....-.---......----...........---...--...--------................................
CBG14788   FTISCI....G.VNG......ESK-...........---...--...--------................................
CBG04582   ITITTS....D.DQQ......KEGG...........KKW...TQ...MRWKHGWA................................
CBG03342   ------....-.---......----...........---...--...--------................................
CBG03240   FSVRAV....T.EAG......FGET...........SPV...IPs..VSMPLMAP................................
CBG15191   ITVRTK....T.KEG......A---...........---...--...--------................................
CBG03362   VTVFVR....DqKRG......SSSA...........YEV...QT...IQTPPSPVnemvsrrkvprniprkqkknapiiltdgimgq
CBG09834   VRIK--....-.---......----...........---...--...--------................................
CBG11320   AQVQVC....S.DDF......CSTP...........SST...SN...TALPDLGGgvpfvftkkkaddiisidmlgnlvitddsvka
CBG01538   FRVLAR....N.SVG......DSA-...........---...--...--------................................
CBG17668   FRVCAV....N.GLG......KGAW...........SET...QS...FKT-----................................
CBG01939   ------....-.---......----...........---...--...--------................................
CBG14320   ------....-.---......----...........---...--...------AP................................
CBG14320   FLVTVV....G.PAGklgdtiQSEW...........TEI...SN...TLTVK---................................
CBG03226   IRVFCM....L.AGA......LSK-...........TWW...AH...RIAHLSKP................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   apkvtfskgekkisatdprikveysdflatltiekseltdgglyfvelensqgsdsa..............................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   wykdgkeiipmdnnteivnegsmsaliihelasedvglykvlvenihgtaeseaevsisdvrahfnssfselteieeghdieltcev
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   kpiidlfngnspifenertvvdvnpgeivitttgskrsdagpykisatnkygkdtc...............................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   pssfstitiattcraewpkvspciadgrnhtdcclkkgvqhdcleicsgstkelgvhsvlclnldlqaiyq................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   atvlwkvngikvsvdssfytvvtsvhedfiestiraksrtrsakftciasndagdsak.............................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   yktidihrlpndlqakyiiheelgkgaygtvyrateratgktwaakmvqvrpgvkkenviheismmnqlhhekllnlheafdmgnem
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   veleprkasvlnmkffvhplpsnqsqtaylivhacdglirlnlfrngkllkrsesfsgfkrfvvsnfkaghlryqiindddakktir
CBG09834   .......................................................................................
CBG11320   vermqnphvldnttktvylagdhsmgifkkdlddatgspkpfkdglfvemmsimpsrsmiliassykitsyrlpttfdfeyysceep
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   sdeeavvnwykdgkklvasdrvqfyamarkrtlrikgstdadsgvykcettdgrsraegevivneqephilvgpqdaivktfgetmv
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   wlieefvsggelfekileddslmseeevrdymhqillgvshmhknqivhldlkpenillkaknstdlkiidfglarkldpkksvkll
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   vwt....................................................................................
CBG09834   .......................................................................................
CBG11320   ledcaevmgissddstgmvyfltqsrngtvilwesdpenraprdiatapsivpfrrfliihdkmilvtknnhivqtdkslkvvnvat
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   lfcetskpvrkvkwfkngveiwpqmnkavmdsdgkratleiknfdkhdigaytasvsdketsapaklafevapsltipeeiregvtv
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   fgtpefcapevvnyqpvglstdmwtvgvisyvllsglspflgdsdedtlanvsaadwdfddpswddvsdlakdficrlmikdkrkrm
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   elervdrilplryaaishkieftdeikfmegsktdlqwtlsppleagtvifkvsffrekmggqdapittiqsdtnftippevlkews
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   hagnefdftvaftgfpvptihmanngtpikaiatvteyddsisvrmknvtldnsgivrviaesplgqcvk.................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   svqdalrhpwitgpllsafndlseyvkkmqpkpdksgiparqkrnflslkrwsddllpigrlakrgaifrrltmdgvferniafges
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   saqrfdvsiqaitpwatavlnr.................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   ptlhlpikmkfsdtdaapsvkkqledivanvgdliatlscdvdgvpspkvqwykddkeltvpsmkydsfyneglaeltvknivesda
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   gkytcratndlgsimthaklsvksddkkkkksetspaviekkkdrktskvvvveemidmppnfhhllqddeakigetkvlvvtnttl
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   peptvewyhngehisiqdsnylqkhdkgryelhilsvdstdegkwkavgknafgecesegkltvvvpdgqfapsfgrqlsdvkcses
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   dilklevnikanpapeinwfrneaeiehsqrhrlqfddgsgnysltiidayaedsgeykcvaknkigkahtvccvrieellakrskk
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   idgskaprfrmqlptprevpqgsdltlvcsvsgtphpnirwtkddqpidmsnkqvrhengvctlhiigardedqgryvceaenihgv
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   aqsfsvveikeavdkdhikpkfleplvncstcegneivleccvtgkpipaitwykdglkliienrmlqytdrkgvsrlnimnvvmdd
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   ageytceavntlgkdfthctvkvvdmglaktrltpvrsrsrsrsrspsvlggdiqrppvvtrpladatvtegnrellevevdgfptp
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   tiewyhdgklvaesrtlrtyfdgrvaflkiyeaheehngqyvckvsnklgavetracvvvegphaaehvtqmptfvkklqdvvlksa
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   getatftcqsyanpaaqvvwlhngkalqqtngnyktrlfddntatlvienvtdelcgtytavatnqfgdvhtsaqltitgsearkva
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                                                                                    
                                                                                                    
d2dtge2      .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG14917   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG06205   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG14917   .......................................................................................
CBG17724   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG09244   .......................................................................................
CBG17724   .......................................................................................
CBG11481   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG17724   .......................................................................................
CBG03399   .......................................................................................
CBG14917   .......................................................................................
CBG03342   .......................................................................................
CBG16558   .......................................................................................
CBG02994   .......................................................................................
CBG16558   .......................................................................................
CBG12373   .......................................................................................
CBG09834   .......................................................................................
CBG09244   .......................................................................................
CBG14221   .......................................................................................
CBG16558   .......................................................................................
CBG03240   .......................................................................................
CBG12347a  .......................................................................................
CBG12347c  .......................................................................................
CBG12347b  .......................................................................................
CBG09834   .......................................................................................
CBG13693   .......................................................................................
CBG06205   .......................................................................................
CBG09834   .......................................................................................
CBG13447   .......................................................................................
CBG06205   .......................................................................................
CBG01538   .......................................................................................
CBG14221   .......................................................................................
CBG03342   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG09834   .......................................................................................
CBG17392   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG09834   .......................................................................................
CBG21718   .......................................................................................
CBG08127   .......................................................................................
CBG17668   .......................................................................................
CBG17392   .......................................................................................
CBG21718   .......................................................................................
CBG12070   .......................................................................................
CBG09834   .......................................................................................
CBG09247   aslpyfiiepkpkinvnegatlsiqadlngsptpevvwlkdnselveseriqikcdgvsyqlvvrgvgledegtytitaenekgkvr
CBG15423   .......................................................................................
CBG12069   .......................................................................................
CBG16558   .......................................................................................
CBG04582   .......................................................................................
CBG09834   .......................................................................................
CBG06205   .......................................................................................
CBG20606   .......................................................................................
CBG01082   .......................................................................................
CBG16558   .......................................................................................
CBG07568   .......................................................................................
CBG01939   .......................................................................................
CBG09834   .......................................................................................
CBG02994   .......................................................................................
CBG15732   .......................................................................................
CBG09834   .......................................................................................
CBG03399   .......................................................................................
CBG08103   .......................................................................................
CBG11320   .......................................................................................
CBG24788   .......................................................................................
CBG16558   .......................................................................................
CBG01538   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG16558   .......................................................................................
CBG14917   .......................................................................................
CBG18819   .......................................................................................
CBG24788   .......................................................................................
CBG18819   .......................................................................................
CBG20606   .......................................................................................
CBG11320   .......................................................................................
CBG11546   .......................................................................................
CBG02994   .......................................................................................
CBG05054   .......................................................................................
CBG01538   .......................................................................................
CBG17392   .......................................................................................
CBG02405   .......................................................................................
CBG05053   .......................................................................................
CBG15732   .......................................................................................
CBG01939   .......................................................................................
CBG03226   .......................................................................................
CBG09244   .......................................................................................
CBG21718   .......................................................................................
CBG09834   .......................................................................................
CBG03240   .......................................................................................
CBG03226   .......................................................................................
CBG21718   .......................................................................................
CBG17724   .......................................................................................
CBG03355   .......................................................................................
CBG15191   .......................................................................................
CBG14788   .......................................................................................
CBG04582   .......................................................................................
CBG03342   .......................................................................................
CBG03240   .......................................................................................
CBG15191   .......................................................................................
CBG03362   .......................................................................................
CBG09834   .......................................................................................
CBG11320   .......................................................................................
CBG01538   .......................................................................................
CBG17668   .......................................................................................
CBG01939   .......................................................................................
CBG14320   .......................................................................................
CBG14320   .......................................................................................
CBG03226   .......................................................................................


                                       100           110                  120                     13
                                         |             |                    |                       
d2dtge2      ......................-----------..----..----.--...---.......--------...-....---.......
CBG06205   ......................SIRLKVVDKPA..PPQH..IRVE.DI...APD.......CCTLYWMP...P....SSD.......
CBG06205   ......................---------PD..APTD..VTPV.DW...DKD.......HVDLEWKP...P....AND.......
CBG06205   ......................-------GPPG..PPIQ..VGAK.SI...GRN.......HCTITWMP...P....LED.......
CBG06205   ......................----------T..SPIN..LEII.QV...GGD.......YVTLSWQR...P....SSD.......
CBG06205   ......................VLAKDPFGTPG..KPGK..PEIV.DT...DND.......HIDIKWDP...P....RDN.......
CBG06205   ......................VVIKDPFDPPG..APST..PEIT.GY...DTN.......QVSLSWNP...P....RDD.......
CBG09834   ......................---------TG..PPQN..VRVG.SI...TSS.......RADVTWAQ...Pec..EQR.......
CBG06205   ......................-------DEPG..KPGR..PEIT.DF...DAD.......RIDIAWEP...P....HKD.......
CBG06205   ......................IIAKNQFDVPD..PVDK..PEVT.DW...DKD.......RIDIKWNP...T....ANN.......
CBG06205   ......................-------DEPG..KTGT..PDVV.DW...DAD.......RVSLEWEP...P....KSD.......
CBG14917   ......................---------SA..PPVN..IQAE.AD...SST.......SVRVSWDE...Pek..YSV.......
CBG09834   ......................---------GG..APLY..LRTE.EI...RPT.......DVSISWQA...Ppc..LQT.......
CBG06205   ......................-------EVPG..KVDK..PELV.DW...DKD.......HVDLAWKT...P....DDG.......
CBG06205   ......................-------DRAD..KPGT..PEIV.DW...DKD.......HADLKWTP...P....ADD.......
CBG06205   ......................-------DRPD..RPGR..PEPT.DW...DSD.......HVDLKWDP...P....LSD.......
CBG09244   ......................--------VPT..VESP..PTIE.NV...TST.......SCSLNWPK...P....TDD.......
CBG17724   ......................---------ET..PSQR..LFTE.PV...SAT.......SISVSWTP...Lla..THW.......
CBG14917   ......................---------SS..APRD..LTVL.PAesgDPH.......SASLHWQP...P....KYS.......
CBG17724   ......................----------A..PPES..FQCS.QI...SEQ.......DVRMKWLP...P....GSP.......
CBG06205   ......................----------G..KPKN..MEAI.DI...DKD.......HCTLAWEA...P....EED.......
CBG17724   ......................---------PSa.APRN..VAAS.AR...SPH.......SVMVQWQQ...Pke..EQD.......
CBG09834   ......................---------SS..PPLN..LEST.YA...LER.......SLSFQWEP...Vdc..SQR.......
CBG13693   ......................NDLATSAGAPL..APGR..PTVI.AV...DGQ.......GVLLEWTA...Pia..DVH.......
CBG09244   ......................EIALKIIDKPS..EPLD..LQFK.DV...TED.......SVFLSWQP...P....VET.......
CBG17724   ......................----------G..PVGV..LRFS.DV...LMD.......SVKVSWDE...P....AQP.......
CBG11481   ......................-----------..VPQS..VRID.AI...SDE.......TATLSWRA...P....KMN.......
CBG03355   ......................----------G..KVHN..LRVY.SV...GST.......AILLQWDA...P....LQP.......
CBG09834   ......................----------D..APRA..IHLI.EK...TDH.......SLHIRWIP...P....VDP.......
CBG06205   ......................KLNVFVLDAPGk.PTGP..IRAT.YI...QAE.......AMSLSCRP...P....KEL.......
CBG17724   ......................----------E..AVDE..LSIA.EV...MYN.......GAVLTWNP...P....MKE.......
CBG03399   ......................---------NR..APQI..QKIR.NV...TSE.......CVEVTVTP...P....DEM.......
CBG14917   ......................--------VPG..KVTS..LVAT.AT...GPE.......TIDIRWSP...P....S-G.......
CBG03342   ......................CIRQGYETHPS..APGN..VTIS.DL...TAH.......SVTVHWTE...P....DSN.......
CBG16558   ......................---------ID..APTD..VLPS.VS...IDN.......TVNVTWSP...P....TQP.......
CBG02994   ......................----------E..APEI..TSVS.LD...RDEppv....VSRIEWKM...Pk...MKP.......
CBG16558   ......................---------EG..PPVE..LRVE.PD...GQR.......SAVAQWKE...P....TTS.......
CBG12373   ......................----------L..SPQH..ILAT.RL...NAN.......TIELTWEP...P....YKK.......
CBG09834   ......................---------LS..PPTN..LNLA.SP...SNV.......QVRVSWQA...P....NQNsw.....
CBG09244   ......................EEKEQKTSDLK..PIGK..PELT.SS...TAT.......SIALKWA-...-....-SD.......
CBG14221   ......................----------Sl.PPED..VRIR.ML...NLT.......TLRISWKA...P....KADgi.....
CBG16558   ......................----------Q..AITN..PIIQ.VH...PNN.......SVTIEFTP...Pddp.ENP.......
CBG03240   ......................LSFSTRQDKPA..AVQN..LKVE.PL...NSY.......SVMLTWLP...P....AMP.......
CBG12347a  ......................----LQTEKLW..PPTS..VRAR.IE...EKSlgg....SAIVSWDD...PnpenAAD.......
CBG12347c  ......................----LQTEKLW..PPTS..VRAR.IE...EKSlgg....SAIVSWDD...PnpenAAD.......
CBG12347b  ......................----LQTEKLW..PPTS..VRAR.IE...EKSlgg....SAIVSWDD...PnpenAAD.......
CBG09834   ......................----------G..PPRE..LTAV.QT...KAT.......QIQLTWLP...P....YPE.......
CBG13693   ......................-RASSLRVVPE..LAEA..PEFL.DV...DGD.......KITICWL-...P....AHS.......
CBG06205   ......................-----------..----..----.--...---.......--------...-....---.......
CBG09834   ......................---------TG..PPQN..LQST.VR...KDS.......ELGFKWDA...Pec..VQQ.......
CBG13447   ......................----------DvpPVTH..LRVD.AS...QSD.......GITIAWS-...-....-VS.......
CBG06205   ......................-------DKPG..KTSA..PDVT.DW...DKD.......HVDLEWKP...P....AND.......
CBG01538   ......................----------S..PVRS..LRAY.PM...NSKesdekg.VVVLVWKK...P....RQT.......
CBG14221   ......................-----------..----..----.--...---.......--------...-....---.......
CBG03342   ......................----YDGDRPV..APDG..LHVA.WN...SGP.......RVNVTWNR...Vtv..RRN.......
CBG17724   ......................---------FA..QPIS..LKAT.PY...ERN.......SVQLEWVV...Phk..STW.......
CBG03355   ......................---------YT..NPTG..VKGE.GT...EPD.......NLVISWKP...Ldr..YYW.......
CBG09834   ......................-------APRR..APAD..VQVS.PL...GPT.......QIRVQWAP...Lhe..SEW.......
CBG17392   ......................-----------..PPVA..PTIQcRP...DAY.......QLRLSWDD...-....-TP.......
CBG09834   ......................----------P..ISNA..IQLL.YR...TDS.......ELRVSWQP...F....MDP.......
CBG21718   ......................DVNVIIKGPGS..PPSE..ITLV.A-...EIR.......GYTISWKP...P....SHP.......
CBG09834   ......................---------TS..PPQG..VRVD.AP...STN.......EVRVSWAR...P....AKN.......
CBG09834   ......................-----------..QVLY..VRKI.GG...SEN.......SLHINWDV...R....PDD.......
CBG09834   ......................----------Ev.PPEG..LKLE.SL...DFE.......TLKITWTP...Pde..STW.......
CBG09834   ......................-----LLSWLP..APTD..LHLI.EK...SDT.......MLHVDWVP...PeifdPEQ.......
CBG21718   ......................---------DG..KPEN..MKVM.IN...EAN.......QVIVHWNT...P....NSTtevtvgf
CBG08127   ......................---------PQ..SPQQ..VTMK.C-...-SD.......YCTVSWDT...P....NSH.......
CBG17668   ......................---------PS..APSS..IRIT.K-...SPD.......GAQLTWEP...Pan..THV.......
CBG17392   ......................----------D..PPKD..LRNI.HR...GLH.......YIKVAWKA...G....NNN.......
CBG21718   ......................----------K..TAPI..LSSL.HA...QDS.......KVYITWAE...P....RLP.......
CBG12070   ......................-----------..----..----.--...---.......--------...-....---.......
CBG09834   ......................---------TH..TPSH..LQVA.AP...DAS.......HVRVSWAL...Ppq..STW.......
CBG09247   qntevsvtkskdvkekkekkkvEKKDEDKKKPG..RPGL..PRPG.AS...KTD.......QVTIAFDA...P....SE-.......
CBG15423   ......................-----GDVLPL..APKI..ITVY.QH...STS.......SAKVLFSHn..V....PIE.......
CBG12069   ......................-----------..----..----.--...---.......--------...-....---.......
CBG16558   ......................---------PG..SAPN..LKSA.SA...GRT.......SLTVRWEP...P....SII.......
CBG04582   ......................--------WLH..APTD..LTLM.DR...KNE.......SIEVSWIP...Pvv..LEA.......
CBG09834   ......................----------P..APTD..LQEE.AT...FPH.......AIEISWLP...P....TPP.......
CBG06205   ......................-----------..----..----.-V...HGD.......HVTLDWRA...P....DDD.......
CBG20606   ......................---------SE..TIDN..LKWR.SL...DSQ.......TLLVEWQP...Ieqg.QES.......
CBG01082   ......................---------PSa.PIIE..TSEC.SA...ENN.......SVTVVWR-...P....RND.......
CBG16558   ......................----------S..APER..IRY-.QI...DGD.......KVTLQWEP...P....QIT.......
CBG07568   ......................------PTNPE..EPFN..LTMT.NS...TLN.......TISVAWE-...P....RFD.......
CBG01939   ......................----------N..PIHK..VDVIySH...DVN.......SVKLQWMLe..P....HIR.......
CBG09834   ......................RQAKHLIKDPL..NIFK..LRI-.VL...SPP.......CSYLVWTP...L....TLH.......
CBG02994   ......................----------Y..MVQN..LRVR.WK...TSG.......SVQLTWD-...-....-YN.......
CBG15732   ......................----------D..PPM-..VRVD.AV...SQN.......SIKLVWDP...P....HHS.......
CBG09834   ......................----------S..APEN..VRLE.RV...SDQ.......TVRVSWES...S....QES.......
CBG03399   ......................----------Nw.SPST..IKTTpVV...GKP.......EIIVLWLA...P....PMN.......
CBG08103   ......................-----------..----..----.--...---.......--------...-....---.......
CBG11320   ......................----------S..APRD..PHAI.PV...TPD.......TVYLYWSL...P....ETL.......
CBG24788   ......................----------S..APRD..PHAI.PV...TPD.......TVYLYWSL...P....ETL.......
CBG16558   ......................-------GPGS..APIG..ITPT.PM...-HT.......GFDVAWQP...P....KIP.......
CBG01538   ......................---------SS..IPSG..LRVL.EK...SGT.......TVTLAWNGvd.P....ATA.......
CBG01538   ......................----------K..NPGE..VAAK.GT...SPE.......NLIVQWKP...Mar..EEW.......
CBG17392   ......................----------S..PPVA..VHNV.KF...DSN.......SRLLSWES...F....DQC.......
CBG16558   ......................-------MTPK..PPSD..IRFG.KN...NDD.......EQVVDFK-...P....AIT.......
CBG14917   ......................-----------..----..----.--...--D.......YILVSWLP...P....ADE.......
CBG18819   ......................----------P..PPKD..ISLG.GV...KLNeaglw..NQIVQWNP...P....PSD.......
CBG24788   ......................----------T..APQS..VEAK.I-...DTE.......GWIVTWKE...P....MSD.......
CBG18819   ......................------IECSS..LTTP..IQCQ.VT...SES.......SAHCHWTR...H....HDP.......
CBG20606   ......................------EQMPL..IGKL..MMKQ.MK...DSY.......TTILEWTA...Iel..QKP.......
CBG11320   ......................----------T..APQS..VEAK.I-...DTE.......GWIVTWKE...P....MSD.......
CBG11546   ......................----------D..EANI..LKLR.AR...TPN.......SLTVYWPA...N....WLT.......
CBG02994   ......................---------DG..EPIG..VQYE.VM...-KG.......KIVVSWRP...Ppe..EKR.......
CBG05054   ......................----------T..PPRN..LELV.SK...TNH.......SAKFIWDE...P....AEF.......
CBG01538   ......................-----------..----..----.--...---.......--------...-....---.......
CBG17392   ......................-----------..----..----.--...---.......--------...-....---.......
CBG02405   ......................--------FPP..KEED..VRIL.NS...GSSl......SCEVEWKT...P....AET.......
CBG05053   ......................-----------..----..----.--...---.......--------...-....---.......
CBG15732   ......................--AKPDIDKVD..QSTI..MTIQdKQ...EPN.......KVHITWNH...P....DET.......
CBG01939   ......................-----------..PPLH..FTAN.IM...NPT.......TVQLSWQ-...P....AMP.......
CBG03226   ......................--------API..ISST..VYPG.QI...SSN.......SININFGD...S....DPE.......
CBG09244   ......................-----------..----..----.--...DGT.......KVTLRWDE...C....PE-.......
CBG21718   ......................--------PGN..PPEN..IKLT.AY...-RN.......QINVTWQE...S....TLP.......
CBG09834   ......................-----------..----..----.--...---.......--------...-....---.......
CBG03240   ......................----------S..PVKA..VNIN.QN...SGS.......CVEVTWQT...D....EFS.......
CBG03226   ......................-----------..----..----.-T...TEH.......EATISYFP...P....QGQ.......
CBG21718   ......................----------P..IPTD..LKTD.VL...DDN.......TIHIRFSAvrdP....DDH.......
CBG17724   ......................-----------..----..----.--...---.......--------...-....---.......
CBG03355   ......................---------PD..APT-..FRVK.NI...SLD.......SFVVEWLP...Nnh..SVW.......
CBG15191   ......................-----------..----..----.--...---.......--------...-....---.......
CBG14788   ......................-----------..----..----.--...---.......--------...-....---.......
CBG04582   ......................VFSTMSQGQY-..GVAE..ARIV.VE...TDF.......AVSIVFQP...L....-KL.......
CBG03342   ......................-----HEHAPT..KVSN..VRVK.S-...SEG.......KVNVEWDY...P....LTK.......
CBG03240   ......................-------PKPT..AAPM..IMKE.SV...GSH.......SMIVRFPT...Tmf..DNR.......
CBG15191   ......................-----------..----..----.--...---.......--------...-....---.......
CBG03362   ......................STNAAQSPYPN..LPDDtsVKVV.NR...KCD.......SATIQWM-...-....-RG.......
CBG09834   ......................-----------..----..----.--...---.......--------...-....---.......
CBG11320   ......................TGLTAPVKPPT..PPTQ..LKIF.AT...QQKtvdgpraLISFFWGP...P....LEW.......
CBG01538   ......................-----------..----..----.--...---.......--------...-....---.......
CBG17668   ......................-----------..----..----.--...---.......--------...-....---.......
CBG01939   ......................-----------..----..----.--...APG.......EVEIRWTF...P....KSI.......
CBG14320   ......................----------E..PVSN..IRVA.IE...ANS.......TAQITWTA...S....AEP.......
CBG14320   ......................--------APG..APLI..VKNG.FN...SEQ.......GVVAHLHF...P....RTA.......
CBG03226   ......................----------K..ALEN..ARVA.EV...NTDefyva..SIKLMWDW...P....VYH.......


             0                       140                                                            
             |                         |                                                            
d2dtge2      --...--..--...........------...........................................................
CBG06205   GGs..PI..TN...........YIVEKL...........................................................
CBG06205   GGa..PI..DA...........YIVEKK...........................................................
CBG06205   GGs..KI..TG...........YNVEMR...........................................................
CBG06205   GGg..RL..RG...........YIIEKQ...........................................................
CBG06205   GGs..PI..DH...........YDVERK...........................................................
CBG06205   GGs..PI..IG...........YVVERF...........................................................
CBG09834   NG...KI..TD...........YEYELW...........................................................
CBG06205   GGa..PI..EE...........YIVEVR...........................................................
CBG06205   GGa..PV..TG...........YIVEKK...........................................................
CBG06205   GGa..PI..TQ...........YIIEKK...........................................................
CBG14917   NG...EV..TG...........YRLKYK...........................................................
CBG09834   NG...EI..TE...........YEYEVT...........................................................
CBG06205   GA...PI..EA...........FVIEKK...........................................................
CBG06205   GGa..PI..EG...........YLVEMR...........................................................
CBG06205   GGa..PI..EE...........YQIEKR...........................................................
CBG09244   GGs..PV..YG...........YDVYKR...........................................................
CBG17724   NG...QP..KG...........YLIVYR...........................................................
CBG14917   NG...EI..EE...........YLVFYT...........................................................
CBG17724   NG...KI..TN...........YVISYW...........................................................
CBG06205   GGa..PI..TG...........YIIERR...........................................................
CBG17724   SG...DF..LG...........YVVRYR...........................................................
CBG09834   HG...HI..VN...........YEYEIL...........................................................
CBG13693   SS...PP..QG...........YQVEYR...........................................................
CBG09244   NGa..PL..TG...........YVIERK...........................................................
CBG17724   NG...MV..IG...........YIVNYK...........................................................
CBG11481   NG...P-..ES...........YIIQFV...........................................................
CBG03355   NG...RI..RG...........YFISFQ...........................................................
CBG09834   KG...YV..TQ...........YRVSIV...........................................................
CBG06205   RS...QI..T-...........--CSKR...........................................................
CBG17724   NG...IV..TK...........YTIRHW...........................................................
CBG03399   NG...EL..EK...........YLVLIQ...........................................................
CBG14917   GQ...PA..LR...........YKIYY-...........................................................
CBG03342   AH...LV..EN...........YTMFIR...........................................................
CBG16558   LG...PI..KS...........YTVFFA...........................................................
CBG02994   NEt..PI..EK...........YNLWLR...........................................................
CBG16558   DV...PP..IG...........YEIYYV...........................................................
CBG12373   SH...EV..KN...........YVVYFT...........................................................
CBG09834   KC...SA..IR...........YKLEYI...........................................................
CBG09244   N-...DD..VT...........YTVQMK...........................................................
CBG14221   NG...IL..KG...........FQIVII...........................................................
CBG16558   GK...KI..KD...........FVIQYT...........................................................
CBG03240   NG...IL..TH...........YNVNVT...........................................................
CBG12347a  NSidaTQ..RQ...........YVINYG...........................................................
CBG12347c  NSidaTQ..RQ...........YVINYG...........................................................
CBG12347b  NSidaTQ..RQ...........YVINYG...........................................................
CBG09834   KA...IV..TA...........YRIRYS...........................................................
CBG13693   QL...PV..IG...........YDVEFR...........................................................
CBG06205   --...--..--...........------...........................................................
CBG09834   NG...NI..TQ...........YEFELV...........................................................
CBG13447   DS...DI..HD...........FEVEVR...........................................................
CBG06205   GGa..PI..EE...........YVVEMK...........................................................
CBG01538   NG...KL..AR...........YEVEYC...........................................................
CBG14221   --...--..--...........------...........................................................
CBG03342   NDpvsHP..IE...........YTLYYL...........................................................
CBG17724   NS...DA..IG...........YRIHYR...........................................................
CBG03355   NA...PN..MQ...........YLVRYK...........................................................
CBG09834   NC...DR..LW...........YIVKYS...........................................................
CBG17392   AN...ED..LT...........YKLSRF...........................................................
CBG09834   R-...-L..QH...........YEVTAV...........................................................
CBG21718   NG...KI..TK...........YVVYHT...........................................................
CBG09834   TWmc.DQ..MN...........VEISYR...........................................................
CBG09834   KN...RV..TA...........FKIVVV...........................................................
CBG09834   RC...DN..VE...........YLIDFV...........................................................
CBG09834   RE...LI..TH...........HRVTIA...........................................................
CBG21718   GD...FF..KG...........YLIYY-...........................................................
CBG08127   GS...PL..LK...........YRITIQemrlknaneskeeeehhektestsssqnsgededsvdnvesttgdneseestentenas
CBG17668   SG...KI..LE...........YSVYLA...........................................................
CBG17392   GS...LI..LY...........YHLELF...........................................................
CBG21718   NG...HI..LN...........YTIYIKkeedvdeeadggeek............................................
CBG12070   --...--..--...........------...........................................................
CBG09834   GC...SD..IQ...........FEIQPE...........................................................
CBG09247   -G...PA..DS...........YEVERR...........................................................
CBG15423   NA...AA..KT...........FVIVYN...........................................................
CBG12069   --...--..--...........------...........................................................
CBG16558   NR...PI..TT...........YTLYYT...........................................................
CBG04582   GHhf.VI..TQ...........HLVKVY...........................................................
CBG09834   HG...NV..DF...........YKVRYT...........................................................
CBG06205   GGi..PL..EN...........YVIEKY...........................................................
CBG20606   SG...DN..LR...........YRVSWS...........................................................
CBG01082   GS...AV..DG...........FALEID...........................................................
CBG16558   NG...PM..AG...........YDVYYT...........................................................
CBG07568   GG...SD..QI...........FEIKYK...........................................................
CBG01939   PE...NV..AG...........YDVYLS...........................................................
CBG09834   SQ...II..SK...........FKLMYK...........................................................
CBG02994   GP...RN..VG...........FYVNHT...........................................................
CBG15732   NG...DI..TF...........YTISWR...........................................................
CBG09834   GD...CQ..SY...........FFITGK...........................................................
CBG03399   ATe..KV..VK...........YHLYYK...........................................................
CBG08103   --...--..--...........------...........................................................
CBG11320   NA...PIseIK...........YKISQQaagisvptsiaviplsetvss......................................
CBG24788   NA...PIseIK...........YKISQQaagisvptsiaviplsetvss......................................
CBG16558   NG...RI..KD...........YVVYYS...........................................................
CBG01538   NG...NF..TG...........YKITYW...........................................................
CBG01538   NG...AK..FH...........YVVKYR...........................................................
CBG17392   AD...LQ..FS...........VNIIHT...........................................................
CBG16558   SE...PV..KE...........YTISVW...........................................................
CBG14917   QN...LV..RG...........YQIGWG...........................................................
CBG18819   L-...PI..KN...........YQVISWasstkseadafeeqmrkkttlefaahekrslasddddeflgs.................
CBG24788   GGs..PI..TS...........YAVETR...........................................................
CBG18819   MQ...TV..IG...........YRILLS...........................................................
CBG20606   NRte.NG..CG...........YKIFIY...........................................................
CBG11320   GGs..PI..TS...........YAVETR...........................................................
CBG11546   K-...AT..SK...........FTIKAK...........................................................
CBG02994   NG...NI..TS...........YKAILS...........................................................
CBG05054   AD...SL..DH...........YRIHLT...........................................................
CBG01538   --...VG..NT...........YEVQYK...........................................................
CBG17392   --...--..--...........------...........................................................
CBG02405   NG...RI..TK...........YFVSVRgamrksdgtltpddfpsaeevdkrcanwdedesks........................
CBG05053   --...--..--...........------...........................................................
CBG15732   NG...GV..LG...........YMVTVK...........................................................
CBG01939   GR...QD..IY...........YLVNVK...........................................................
CBG03226   QG...RF..DY...........YLLTFS...........................................................
CBG09244   --...-T..SL...........YKIERK...........................................................
CBG21718   NG...DI..MVtrlllcwylkkYIVYYS...........................................................
CBG09834   --...--..--...........------...........................................................
CBG03240   GAdf.YT..IQ...........YALQSN...........................................................
CBG03226   --...-N..IT...........YHIEYY...........................................................
CBG21718   SK...AI..DE...........YRIDLA...........................................................
CBG17724   --...--..--...........------...........................................................
CBG03355   KM...PG..AA...........FFVNYT...........................................................
CBG15191   --...--..--...........------...........................................................
CBG14788   --...--..--...........------...........................................................
CBG04582   PG...RI..IS...........YQIKYS...........................................................
CBG03342   D-...-Y..KY...........FAVYYR...........................................................
CBG03240   NG...EI..KQ...........FAIIVS...........................................................
CBG15191   --...--..--...........------...........................................................
CBG03362   QD...EH..LK...........YCVYQR...........................................................
CBG09834   --...--..--...........------...........................................................
CBG11320   NG...TP..YQ...........YIVNCT...........................................................
CBG01538   --...--..--...........------...........................................................
CBG17668   --...--..--...........------...........................................................
CBG01939   LD...SV..IG...........ATILYT...........................................................
CBG14320   EN...-I..LT...........YAITYQaylg.......................................................
CBG14320   Y-...DS..CY...........FRLQVK...........................................................
CBG03226   DF...ER..YK...........IVISYG...........................................................


                                                                                           150      
                                                                                             |      
d2dtge2      ....................................-..--..----................................-----...
CBG06205   ....................................D..LRhsDGKWekv.............................SSFVR...
CBG06205   ....................................D..KF..GDWVeca.............................RVDGK...
CBG06205   ....................................E..YG..STLWtvvs............................DYNVR...
CBG06205   ....................................E..EG..HDEWfrcn............................QNPSP...
CBG06205   ....................................D..AK..TGRWikvn............................TSPVQ...
CBG06205   ....................................E..KRg.GGDWapvk............................MPMVK...
CBG09834   ....................................S..MD..TWADns..............................TGHNP...
CBG06205   ....................................D..PD..TKEWke..............................VKRVP...
CBG06205   ....................................E..KG..SALWte..............................AGKAA...
CBG06205   ....................................G..KH..GRDWqecg............................KVSGD...
CBG14917   ....................................T..KA..RGAKgntl............................VIDAT...
CBG09834   ....................................A..GD..RRQTvqkt............................TENIR...
CBG06205   ....................................D..KN..GRWEeal.............................VVPGD...
CBG06205   ....................................T..PS..GDWVpav.............................KVGAG...
CBG06205   ....................................T..KY..GRWEpai.............................TVPGG...
CBG09244   ....................................E..NG..GEWQ................................KINGDelv
CBG17724   ....................................E..VD..EDNWkevr............................TPALR...
CBG14917   ....................................D..RE..SLSDkdwtin..........................YVAGD...
CBG17724   ....................................K..SH..EPRSmaida...........................QVAGN...
CBG06205   ....................................E..KS..EKDWhqvg............................QTKPD...
CBG17724   ....................................L..AGysSLTWnekn............................LTTKD...
CBG09834   ....................................G..QD..DWAKlerq............................IANTS...
CBG13693   ....................................V..YG..SRDWmian............................EQLVQ...
CBG09244   ....................................G..VD..NNRWrpcg............................HVEPT...
CBG17724   ....................................G..YR..MQEEfkned...........................QQRTS...
CBG11481   ....................................Q..EP..APQFvywnk...........................YRVGS...
CBG03355   ....................................N..DK..NETEet..............................YVIHR...
CBG09834   ....................................S..LD..DVNDkkrtq...........................VVNHP...
CBG06205   ....................................E..LR..EGDW................................VTVGHpv.
CBG17724   ....................................A..SS..SPDVktkh............................EVDGS...
CBG03399   ....................................A..VN..ETNPrkmt............................FDKPT...
CBG14917   ....................................-..--..----................................-----...
CBG03342   ....................................K..NE..HGEPvr..............................TVHNV...
CBG16558   ....................................P..EY..DDSDyktwqrisvd......................A---Pdga
CBG02994   ....................................P..QG..YPDSyiksk...........................TVDGT...
CBG16558   ....................................R..GD..KSVEeddsaglndwikis..................IDDPS...
CBG12373   ....................................E..NP..NASLsewe............................KIPVN...
CBG09834   ....................................N..GT..QPRKq...............................IDLPS...
CBG09244   ....................................E..SN..SKRPwsva............................VKECS...
CBG14221   ....................................G..QA..PNNNrni.............................TTNER...
CBG16558   ....................................T..DE..EPDDesewkelkfsdpdd..................TDDTT...
CBG03240   ....................................K..MG..SDETrtidvgvss.......................NRSDH...
CBG12347a  ....................................I..YE..SDTQq...............................KVRSN...
CBG12347c  ....................................I..YE..SDTQq...............................KVRSN...
CBG12347b  ....................................I..YE..SDTQq...............................KVRSN...
CBG09834   ....................................P..RA..DDSNptevelsgdeltcsgyksp.............IITSA...
CBG13693   ....................................D..LQ..QDDRwykvn...........................DQPVF...
CBG06205   ....................................-..--..----................................-----...
CBG09834   ....................................G..LD..EWNEgtr.............................EGVTP...
CBG13447   ....................................PaiVK..KRAFe...............................TRHVN...
CBG06205   ....................................D..EF..SPFWneva............................HVPAS...
CBG01538   ....................................K..TQ..NGKQvektcprq........................QIDAD...
CBG14221   ....................................-..--..----................................-----...
CBG03342   ....................................E..TE..HSSTwt..............................TLKTN...
CBG17724   ....................................E..YP..SNETwqmeeiavh.......................DP--Hed.
CBG03355   ....................................L..DE..PIHGwtefl...........................VEDSL...
CBG09834   ....................................T..PQ..NQGF................................KNLTN...
CBG17392   ....................................N..PE..NQQSst..............................VYQGD...
CBG09834   ....................................E..VD..EDSRrverr...........................RVEPA...
CBG21718   ....................................L..NR..DDPLsdwkki..........................DLDG-...
CBG09834   ....................................V..GN..QPEKil..............................TVPGD...
CBG09834   ....................................P..QD..GSQRaqtf............................NVDRA...
CBG09834   ....................................N..TTs.RGNW................................TVSTD...
CBG09834   ....................................P..FD..PTTGktgpskny........................TVPYP...
CBG21718   ....................................-..--..----................................-----...
CBG08127   ieitehhetsltnqhsaeilptdpttsverdslemvA..YG..SLMVl...............................EVDAS...
CBG17668   ....................................V..KN..QSANpadsqlafmr......................VYCGP...
CBG17392   ....................................A..DG..CSEGq...............................LIESK...
CBG21718   ....................................E..--..---Wkvrdekifrkiflefqkf..............VYRSNtsr
CBG12070   ....................................-..--..----................................-----...
CBG09834   ....................................E..PR..GQPA................................VVLGS...
CBG09247   ....................................C..PD..QREW................................TKCGTsk.
CBG15423   ....................................E..VS..SAQNksqvi...........................QVDGD...
CBG12069   ....................................-..--..----................................-----...
CBG16558   ....................................N..NP..QQPVknwkkl..........................EVKEP...
CBG04582   ....................................D..LS..GNMStnkrsi..........................PVPIP...
CBG09834   ....................................P..TG..EANYreirvetdrlecsd..................SNKKD...
CBG06205   ....................................D..TA..NGRWvpaa............................KVPGD...
CBG20606   ....................................E..--..----................................-----...
CBG01082   ....................................T..GR..DDGNfke.............................VYSGP...
CBG16558   ....................................D..DP..SLPRdqwkvhh.........................IDDPN...
CBG07568   ....................................K..QN..DDLIh...............................LVNTS...
CBG01939   ....................................Q..DK..DLPDsqwklv..........................RLNNK...
CBG09834   ....................................E..VS..SNKWiklvggpdhfecprg.................IADPE...
CBG02994   ....................................G..KK..DYMNhellektmstpgfgh.................DLDEK...
CBG15732   ....................................E..L-..----................................-----...
CBG09834   ....................................Q..NG..QSINq...............................RVPGS...
CBG03399   ....................................A..NN..EDQWkiehlnvnpn......................EVKSK...
CBG08103   ....................................-..--..----................................-----...
CBG11320   ....................................N..IS..SDTT................................ACLIN...
CBG24788   ....................................N..IS..SDTT................................ACLIN...
CBG16558   ....................................K..DP..DAPLsdwesr..........................TVLAD...
CBG01538   ....................................V..D-..----................................-----...
CBG01538   ....................................P..VD..EDQRdgdwkevavedpf...................ADRVT...
CBG17392   ....................................E..SK..RSIM................................KLVTT...
CBG16558   ....................................P..SS..DPTNvkkf............................TTPADv..
CBG14917   ....................................L..SV..PDTEti..............................RVTAS...
CBG18819   ....................................D..RD..RNSV................................IVPSH...
CBG24788   ....................................I..NK..TAEWeiaergldgwktwwrpgk..............S----...
CBG18819   ....................................S..PV..NQDTntt.............................INQPQ...
CBG20606   ....................................I..SE..TATEaieldmpvqr......................LSDRR...
CBG11320   ....................................I..NK..TAEWeiaergldgwktwwrpgk..............S----...
CBG11546   ....................................T..IH..SPTGifkeiensai......................GEPGK...
CBG02994   ....................................A..MD..ESTDrfek............................MVPAS...
CBG05054   ....................................Q..RT..GQYGtgk.............................YFITK...
CBG01538   ....................................P..QN..GDEWetv.............................KPS-Dd..
CBG17392   ....................................-..--..----................................-----...
CBG02405   ....................................A..--..---Qnginpi..........................DFSND...
CBG05053   ....................................-..--..----................................-----...
CBG15732   ....................................N..SM..EIPVcvpntk..........................GFDPT...
CBG01939   ....................................Q..LT..TASGstlqnq..........................QIKTA...
CBG03226   ....................................G..NN..KNISkkvemehelvkgsgynl...............HSSFS...
CBG09244   ....................................K..VG..ESEWle..............................IANTD...
CBG21718   ....................................E..NE..NDDLsdwn............................KFETA...
CBG09834   ....................................-..--..----................................-----...
CBG03240   ....................................P..SN..STNM................................TIPST...
CBG03226   ....................................P..EE..HKEYsn..............................AIDTK...
CBG21718   ....................................A..TD..NVLHaewkhiepdair....................I----...
CBG17724   ....................................-..--..----................................-----...
CBG03355   ....................................A..ES..SNTWhqse............................IIYLP...
CBG15191   ....................................-..--..----................................-----...
CBG14788   ....................................-..--..----................................-----...
CBG04582   ....................................L..KD..RNSTrltdeltdatlkcp..................KFECQ...
CBG03342   ....................................K..TN..NAQDddw.............................HKLKT...
CBG03240   ....................................E..TT..ADDSinr.............................WLETD...
CBG15191   ....................................-..--..----................................-----...
CBG03362   ....................................K..EN..SNFLehlvsladnlcqgglssstlvgcyvhsptsaeIETQS...
CBG09834   ....................................-..--..----................................-----...
CBG11320   ....................................K..DD..GKVI................................-----...
CBG01538   ....................................-..--..----................................-----...
CBG17668   ....................................-..--..----................................-----...
CBG01939   ....................................N..RK..DLTPeqwqkie.........................IEDSK...
CBG14320   ....................................P..CN..KDPTtv..............................Y----...
CBG14320   ....................................N..AT..NSVVsd..............................LRVDP...
CBG03226   ....................................I..GR..ADSKem..............................EVTNK...


                    160                         170         180       190                           
                      |                           |           |         |                           
d2dtge2      ...--------.-.------................---------.--.-----------------svaayvsartmp.........
CBG06205   ...NLNYTVGG.L.IKDNRY................RFRIRAETQ.YG.VSEPCELSEVV------v....................
CBG06205   ...TTKATADN.L.TPGETY................QFRVKAVNK.AG.PGKPSDPT---------g....................
CBG06205   ...EPEFTVDK.L.KEFNDY................EFRVVAINA.AG.KGIPSLP----------s....................
CBG06205   ...QNTYNVPN.L.IDGRKY................RYRVFAAND.AG.LSDPTE-----------l....................
CBG06205   ...GNAFSDTR.V.QKGHTY................EYRVVAVNK.AG.PGAPSDPSASATA----k....................
CBG06205   ...GTECIVPG.L.HENETY................QFRVRAVNA.AG.QGEPSNGSEPVT-----c....................
CBG09834   ...TERLNLDQ.L.IPYTQY................QIRVRAINK.EG.EGPFGEWVPFTT-----q....................
CBG06205   ...DTNASITG.L.KEGKEY................QFRVKAVNK.AG.PGQPSEPSE--------kql..................
CBG06205   ...GTTFSADN.L.KQGVEY................EFRVIAVNA.AG.PSDPSEPTDPQ------it...................
CBG06205   ...QTNAEILG.L.KEGEEY................QFRVKAINK.AG.PGEASDPS---------rkv..................
CBG14917   ...SREYTMGN.L.EPNTQY................LIRMAVVNH.NG.TGPFSEWVAVDT-----p....................
CBG09834   ...GTRARIEN.L.QPQTRY................NVKVRAYTA.RG.PGPWSTEVPFQT-----s....................
CBG06205   ...QNAATVPN.L.KEGEEY................QFRISARNK.AG.TGDPSDPS---------dr...................
CBG06205   ...ELTATVDG.L.KPGQTY................QFRVKALNK.AG.ESTPSDPSRTM------va...................
CBG06205   ...QTKATVPD.L.TPNEEY................EFRVIAVNK.GG.PSDPSDASK--------avi..................
CBG09244   ..fTESFNVRA.L.SSGKEY................EFKVEACNE.AG.LRSNSNVV---------s....................
CBG17724   ...SSEHTVTD.L.RPFTTY................EVNVFSENV.FG.RSLPTDAVKARTYESVP.....................
CBG14917   ...KLSHQVSN.L.LPKANY................FFKIQARNE.KG.HGPFSSIVG--------yt...................
CBG17724   ...LLMFSAMS.L.SPNTQY................TFAIKAKNS.KG.ESE--------------.....................
CBG06205   ...CCELTDTK.V.VEDKEY................LYRVKAVNK.AG.PGDP-------------cd...................
CBG17724   ...ARNTLVDE.L.ITWREY................EIQVAAYNK.RG.LGVFSESIEVTTAEGRP.....................
CBG09834   ...DLRVTIDG.L.TPYTKY................VMRVKAYNS.IG.GGPNTENLVVMTA----k....................
CBG13693   ...DTMFTVES.L.RPNGVY................EFRVRGKNQ.DG.LGHPS------------.....................
CBG09244   ...KLTFVAED.L.FCNQVY................GFRILAVNE.VG.ESEPCETVDVLTL----e....................
CBG17724   ...RNYFDSHG.L.AEGVTY................FFSVWAETS.AG.KGE--------------l....................
CBG11481   ...STRFTLTD.L.HADTRY................IICVTAEHN.HG.LAAMSKSMRFRT-----k....................
CBG03355   ...QKYYLHEK.S.EPDTGY................KVTVWAETR.AG.EGP--------------tt...................
CBG09834   ...TLTHLFED.L.NPETSY................NISISAGTK.QG.FGR--------------e....................
CBG06205   ...GTTLRVRN.L.DANTPY................EFRVRAENQ.YG.VGEPL------------etd..................
CBG17724   ...TTNITIDG.L.QPSTRY................GVDVMASTK.KG.DGP--------------ve...................
CBG03399   ...STPLTICA.L.TPSSEY................ALAIEADNG.FG.TSP-QATLVFRTEDSVP.....................
CBG14917   ...--------.-.------................---------.--.-----------------s....................
CBG03342   ...QSPHVELG.L.DPDSEY................VLTLQSHST.NG.TSLPSTAKLFTTL----p....................
CBG16558   dhgEITLPKEQ.F.NPNTPY................KIRVSSTND.LS.EGPASEPFRFET-----.....................
CBG02994   ...DLSTTISG.L.WMGVVY................DVLLGAENR.EG.R----------------s....................
CBG16558   ...KLTHKIQNlL.LPDTDY................VFKMRAIYP.DG.PSVFSEPCIMKTLP---d....................
CBG12373   ...GRRVVFPD.L.RFDWFY................MFSATAVFK.DG.QRS--------------plsralf..............
CBG09834   ...SSIEHLFD.S.KSNTKW................IVRIRTEND.AG.SSEWSKELEITTAEGAP.....................
CBG09244   ...ECAATIAQ.L.KEGTTY................LFRVIAQNK.AG.QTVTSEQSE--------ai...................
CBG14221   ...AASVTLFH.L.VTGMTY................KIRVAARSN.GG.VGVSHGTSEVTM-----nq...................
CBG16558   ...FVNIDGEN.F.NPDTKY................NTRIIARGE.ID.SQP-SDTTLF-------at...................
CBG03240   ...TVQVIVDE.L.FGGHTY................NFSVRAVTE.AG.FGETSPVI---------p....................
CBG12347a  ...AKAVRLTG.L.IPGKEY................EVAVKVVAG.DG.S----------------espws................
CBG12347c  ...AKAVRLTG.L.IPGKEY................EVAVKVVAG.DG.S----------------espws................
CBG12347b  ...AKAVRLTG.L.IPGKEY................EVAVKVVAG.DG.S----------------espws................
CBG09834   ...NLCATIKG.L.QPSTTY................RFAVQGQSS.SGnWGEWSSDYFSTT-----r....................
CBG13693   ...ACKMTVGD.L.ILDHDY................QFRVLAHNA.SG.CSQPSPPSQFV------hi...................
CBG06205   ...--------.-.------................---------.--.-----------------pg...................
CBG09834   ...RQNTLIDQ.L.QPGSLY................RIKVRAYTA.EG.PGPWSDSLEIRTT----g....................
CBG13447   ...QTYTTFIG.L.RHDTVY................QFRVRVKDD.LR.WSS--------------p....................
CBG06205   ...QTNATVGN.L.KEGSKY................EFRIRAKNK.AG.LGDPSDS----------as...................
CBG01538   ...AKEIRITG.L.ENETPY................RFILRAHTS.AG.EGDP-------------nssd.................
CBG14221   ...--------.-.------................---------.--.-----------------gka..................
CBG03342   ...NTWVVMRD.L.RKDALF................YVYVTAKEE.DK.ISRSSSIITV-------la...................
CBG17724   ...REEKVLAK.L.STFRHY................IIRMRLFNS.EG.EGPFSAPVFVY------vgy..................
CBG03355   ...ANFTIIRD.Q.PTFRKY................LIQVQSVNS.VG.PSI--------------v....................
CBG09834   ...GENFVVFD.S.DPYTQW................NFEVQAANP.AG.ESQFSRAQSAQT-----q....................
CBG17392   ...DRVKIVKN.L.KEDTKY................FFTLVVTNKiSG.AFATSRQTEFRTKIAPP.....................
CBG09834   ...LSSFALTG.L.RPSTKY................TIGVIAF--.--.-----------------vdhep................
CBG21718   ...SEKYVQIY.M.DTEESF................YGRVQAATE.LG.PGIISDIV---------a....................
CBG09834   ...QTEYTFPA.-.EPNQRW................VVKLRATNQ.VG.SSQWSPEQSITTRQGAP.....................
CBG09834   ...TYQYRIDN.L.RPRTTY................NVTVSAAT-.--.-----------------hk...................
CBG09834   ...APSELIVP.T.QPGTKW................DVKIRTQTV.ED.MGKP-------------qfskwsdkvsitt........
CBG09834   ...GNSIKFEG.L.RPETIY................NITVQAGTN.SG.YGH--------------.....................
CBG21718   ...--------.-.------................---------.--.-----------------tr...................
CBG08127   ...ENQLQLTN.I.KSHSYY................KVAVSAENA.IG.QGEPA------------ef...................
CBG17668   ...LAECNVHQ.P.SLQSAYvdhtnkpai.......IFRIAAKNE.KG.YGPATQVRW--------lq...................
CBG17392   ...EDTVEILN.L.KEHTAY................EARITAFTA.LG.ES---------------l....................
CBG21718   ...VEIGIDDG.L.EENERY................QMKMTATNE.RH.EGPETQVYTF-------.....................
CBG12070   ...--------.-.------................---------.--.-----------------sppsrl...............
CBG09834   ...HQTSHIFN.S.APNQMW................SVKIRAINS.AG.HSAWTPASQAKTP----p....................
CBG09247   ...SLELEVKS.L.TPNTEY................IFRVAGRNK.QG.LGEWAEM----------mt...................
CBG15423   ...QNDAIITG.L.NFDTEY................SIRAIAENA.AG.KSVHSAEYLFNT-----t....................
CBG12069   ...--------.-.------................---------.--.-----------------vqthgkgap............
CBG16558   ...TREVAIPD.L.RPDTAY................YIRVRANDQ.LG.PGKLGNQVQIRTL----k....................
CBG04582   ...LTRLQIDG.L.KPATAY................NVTVQAGTS.YG.YGN--------------.....................
CBG09834   ...RLCYRLSD.L.DPEQEY................DIQVSAHTE.GGgWSEWSDELTSRTQ----q....................
CBG06205   ...QTTAVVDG.L.IPGHEYkvtpqsilyilhivmfQFRVAAVNA.EG.ESEPLETFGTTLAK---dp...................
CBG20606   ...--------.-.------................---------.--.-----------------as...................
CBG01082   ...DTICTIDG.L.HFNTVY................TARVKSFNS.AG.ESEYSESICLQTAQ---vaw..................
CBG16558   ...ARTTTVPR.L.NEKTPY................NFFIVGRNR.LG.PGLRSSPFTATT-----wl...................
CBG07568   ...HTNLRLSG.L.AIANTY................YFQIRAINA.RGfASGWTSPVIFAT-----ln...................
CBG01939   ...ESHLSLED.L.KSSTVY................FVRVNVRNT.DG.-----------------sv...................
CBG09834   ...DYCYQLKG.L.FFGVHY................ISSI-----.--.-----------------syqltng..............
CBG02994   ...TREYLWTN.L.RPHMMY................TIHV-----.--.-----------------gvr..................
CBG15732   ...--------.-.------................---------.--.-----------------d....................
CBG09834   ...DRSVDISG.S.SQG-DW................RVQVRGVNT.AG.SGTPSR-----------dai..................
CBG03399   ...MFKYRLVD.L.NPNTLY................RIRVSASTS.KG.EGSQSADSLAQTDV---gepg.................
CBG08103   ...--------.-.------................---------.--.-----------------dvv..................
CBG11320   ...PCRVKIAN.L.RPSNEY................KFWVTAT--.--.-----------------h....................
CBG24788   ...PCRVKIAN.L.RPSNEY................KFWVTAT--.--.-----------------h....................
CBG16558   ...TRNLTIHV.D.DEDTPY................VTKVQARTD.DG.PGIISEAYEVTT-----g....................
CBG01538   ...--------.-.------................---------.--.-----------------ead..................
CBG01538   ...INLDDDKD.V.KPFQPY................EVQVQAVNS.EG.R----------------tn...................
CBG17392   ...SRNVIVEG.L.QPGDEF................SAIINATTN.VG.KSP--------------.....................
CBG16558   ...TSGVVVDG.L.DPDTEY................NIQVAAEFF.EG.EEIASEPITVKTP----p....................
CBG14917   ...TTQYKISR.L.SSERDY................VISLRAFNN.LG.SGFPIYET---------vrtlsretp............
CBG18819   ...STSSEIQG.L.FPNSVY................IVEIHAS--.--.-----------------vdssdg...............
CBG24788   ...--ETSSSM.S.YSSEVS................EFRIRAANI.EG.FGA--------------y....................
CBG18819   ...LREVRYEN.L.QPGYVY................TVEVQSITN.KG.LGR--------------tvstqf...............
CBG20606   ...NPSARLDG.L.KLMYMY................TIKVAGYNP.GG.IGPISDPRSI-------r....................
CBG11320   ...--ETSSSM.S.YSSEVS................EFRIRAANI.EG.FGA--------------y....................
CBG11546   ...AHEFVVDN.L.LPSSTY................NITIT----.--.-----------------ti...................
CBG02994   ...STSSTF-E.V.NVRRAY................LFKVAAATM.KG.IGPYSPVLT--------i....................
CBG05054   ...ERNFTLEG.L.ISNFAY................TVHVVAH--.--.-----------------ageyknnsdw...........
CBG01538   ...GLTVHVDG.L.SPGTKY................DVRVAALQV.DS.-----------------dggettktfsgiskitt....
CBG17392   ...--------.-.------................---------.--.-----------------rdf..................
CBG02405   ...FYSCKFGP.L.KPNRNY................SVSVWAENS.AG.RSL--------------p....................
CBG05053   ...--------.-.------................---------.--.-----------------st...................
CBG15732   ...THGTVFRD.L.SEG-SY................EIGIVTYSA.AS.NGE--------------.....................
CBG01939   ...ATSFTLGK.M.IAGEKY................EMTIRSAT-.--.-----------------sq...................
CBG03226   ...RKSFTFTK.L.IPGKTY................QFSVYT---.--.-----------------vyk..................
CBG09244   ...RNKFKDRS.L.TESGEY................TYQVTATGI.HA.VSSPSEETE--------pvk..................
CBG21718   ...ELETYVEA.F.GPSVNH................FIRVQAVSD.RG.PGIISTT----------fs...................
CBG09834   ...--------.-.------................---------.--.-----------------tp...................
CBG03240   ...ESSI----.-.------................---------.--.-----------------sicd.................
CBG03226   ...ASLVRLRG.L.DSGTTF................RLRIRSVYQ.G-.-----------------vfsqelidstfvtq.......
CBG21718   ...--------.-.------................---------.--.-----------------deitsmshqvdveingdsvek
CBG17724   ...--------.-.------................---------.--.-----------------eq...................
CBG03355   ...NTEILLRN.L.KEDQKY................FIQ------.--.-----------------giak.................
CBG15191   ...--------.-.------................---------.--.-----------------tk...................
CBG14788   ...--------.-.------................---------.--.-----------------p....................
CBG04582   ...WKCALIFN.LpHRPREY................KFEIRAKVD.DV.WNRWS------------pvt..................
CBG03342   ...VQQNIEIE.L.DTSEDY................EVGILAANA.LG.NSP--------------l....................
CBG03240   ...NGTYT---.-.------................---------.--.-----------------wqqv.................
CBG15191   ...--------.-.------................---------.--.-----------------vssdsnvarv...........
CBG03362   ...VLETIIGN.L.QPSSTY................RLDLLAI--.--.-----------------pmnr.................
CBG09834   ...--------.-.------................---------.--.-----------------vi...................
CBG11320   ...--------.-.------................---------.--.-----------------tidsse...............
CBG01538   ...--------.-.------................---------.--.-----------------tttvkgicet...........
CBG17668   ...--------.-.------................---------.--.-----------------.....................
CBG01939   ...NTTVLLKN.L.QEGVRY................SVQII----.--.-----------------prlytgd..............
CBG14320   ...--------.-.------................---------.--.-----------------lgapstsyemllprnvhcefm
CBG14320   ...TYSILLSH.L.EFDSSY................AVTLSALSS.--.-----------------dqnt.................
CBG03226   ...EEFVLLDK.L.EPSNQY................SISVR----.--.-----------------.....................


                                
                                
d2dtge2      ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG09834   ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG14917   ...................
CBG09834   ...................
CBG06205   ...................
CBG06205   ...................
CBG06205   ...................
CBG09244   ...................
CBG17724   ...................
CBG14917   ...................
CBG17724   ...................
CBG06205   ...................
CBG17724   ...................
CBG09834   ...................
CBG13693   ...................
CBG09244   ...................
CBG17724   ...................
CBG11481   ...................
CBG03355   ...................
CBG09834   ...................
CBG06205   ...................
CBG17724   ...................
CBG03399   ...................
CBG14917   ...................
CBG03342   ...................
CBG16558   ...................
CBG02994   ...................
CBG16558   ...................
CBG12373   ...................
CBG09834   ...................
CBG09244   ...................
CBG14221   ...................
CBG16558   ...................
CBG03240   ...................
CBG12347a  ...................
CBG12347c  ...................
CBG12347b  ...................
CBG09834   ...................
CBG13693   ...................
CBG06205   ...................
CBG09834   ...................
CBG13447   ...................
CBG06205   ...................
CBG01538   ...................
CBG14221   ...................
CBG03342   ...................
CBG17724   ...................
CBG03355   ...................
CBG09834   ...................
CBG17392   ...................
CBG09834   ...................
CBG21718   ...................
CBG09834   ...................
CBG09834   ...................
CBG09834   ...................
CBG09834   ...................
CBG21718   ...................
CBG08127   ...................
CBG17668   ...................
CBG17392   ...................
CBG21718   ...................
CBG12070   ...................
CBG09834   ...................
CBG09247   ...................
CBG15423   ...................
CBG12069   ...................
CBG16558   ...................
CBG04582   ...................
CBG09834   ...................
CBG06205   ...................
CBG20606   ...................
CBG01082   ...................
CBG16558   ...................
CBG07568   ...................
CBG01939   ...................
CBG09834   ...................
CBG02994   ...................
CBG15732   ...................
CBG09834   ...................
CBG03399   ...................
CBG08103   ...................
CBG11320   ...................
CBG24788   ...................
CBG16558   ...................
CBG01538   ...................
CBG01538   ...................
CBG17392   ...................
CBG16558   ...................
CBG14917   ...................
CBG18819   ...................
CBG24788   ...................
CBG18819   ...................
CBG20606   ...................
CBG11320   ...................
CBG11546   ...................
CBG02994   ...................
CBG05054   ...................
CBG01538   ...................
CBG17392   ...................
CBG02405   ...................
CBG05053   ...................
CBG15732   ...................
CBG01939   ...................
CBG03226   ...................
CBG09244   ...................
CBG21718   ...................
CBG09834   ...................
CBG03240   ...................
CBG03226   ...................
CBG21718   nrmywvkvta.........
CBG17724   ...................
CBG03355   ...................
CBG15191   ...................
CBG14788   ...................
CBG04582   ...................
CBG03342   ...................
CBG03240   ...................
CBG15191   ...................
CBG03362   ...................
CBG09834   ...................
CBG11320   ...................
CBG01538   ...................
CBG17668   ...................
CBG01939   ...................
CBG14320   fritnydaigreafaetri
CBG14320   ...................
CBG03226   ...................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053850 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7524
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Nocardia farcinica IFM 10152
NoYes   Mycobacterium marinum M
NoYes   Corynebacterium jeikeium K411
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Meiothermus ruber DSM 1279
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Enterococcus hirae ATCC 9790
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus acidophilus 30SC
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Isosphaera pallida ATCC 43644
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Deferribacter desulfuricans SSM1
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Neisseria meningitidis alpha14
NoYes   Thiomonas arsenitoxydans
NoYes   Leptothrix cholodnii SP-6
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Achromobacter xylosoxidans
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Roseobacter denitrificans OCh 114
NoYes   Paracoccus denitrificans PD1222
NoYes   Azospirillum brasilense Sp245
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes