SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

p53-like transcription factors alignments in Macaca mulatta 76_1

These alignments are sequences aligned to the 0045080 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ycsa_               ..............................................................................
ENSMMUP00000014032  vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgsrkfnilgtntkvmnmees
ENSMMUP00000007422  fvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvkgfrkfnilgthtkvmnmee
ENSMMUP00000007424  fvverqpcmpthpqrplvlktliqftvklrlliklpelnyqvkvkasidknvstlsnrrfvlcgtnvkamsveessng
ENSMMUP00000014026  lvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnppqvkatiiseqqaksllknentrnecsgeilnnccvme
ENSMMUP00000001096  vvetqpcmpqtphrplilktgskftvrtrllvrlqegnesltvevsidrnppqlqgfrkfni................
ENSMMUP00000011334  ..............................................................................
ENSMMUP00000035274  ..............................................................................
ENSMMUP00000040658  ..............................................................................
ENSMMUP00000040656  ..............................................................................
ENSMMUP00000021769  ..............................................................................
ENSMMUP00000040655  ..............................................................................
ENSMMUP00000021768  ..............................................................................
ENSMMUP00000021636  ..............................................................................
ENSMMUP00000038275  ..............................................................................
ENSMMUP00000021635  ..............................................................................
ENSMMUP00000021634  ..............................................................................
ENSMMUP00000034946  gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicn..............................
ENSMMUP00000004986  gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicn..............................
ENSMMUP00000023071  lrtlvtscflvekqppqvlktqtkfqagvrfllglrflgapakpplvradmvtekqarelsvpqgpgagaestgeiin
ENSMMUP00000021290  gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddhrykfadnkwsvtgkaepa
ENSMMUP00000021289  gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddhrykfadnkwsvtgkaepa
ENSMMUP00000012907  pkvtleakelwdqfhklgtemvitksgrrmfppfkvrvsgldkkakyillmdivaaddcrykfhnsrwmvagkadpem
ENSMMUP00000015631  gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddhrykfadnkwsvtgkaepa
ENSMMUP00000021288  gikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmdivpaddhrykfadnkwsvtgkaepa
ENSMMUP00000029722  nikvglhekelwkkfheagtemiitkagrrmfpsykvkvtgmnpktkyillidivpaddhrykfcdnkwmvagkaepa
ENSMMUP00000019749  pkvhleakelwdqfhkrgtemvitksgrrmfppfkvrcsgldkkakyillmdiiaaddcrykfhnsrwmvagkadpem
ENSMMUP00000032924  lrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnhrwkyvngewvpggkpepqa
ENSMMUP00000022430  lrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnhrwkyvngewvpggkpepqa
ENSMMUP00000014199  npyieiieqprqrgmrfrykcegrsagsipgehstdnnrtypsiqimnyygkgkvritlvtkndpykphphdlvgkdc
ENSMMUP00000006984  lqiiledaplwqrfkevtnemivtkngrrmfpvlkisvtgldpnamysllldfvpt......................
ENSMMUP00000013895  rvdlqgaelwkrfheigtemiitkagrrmfpamrvkisgldphqqyyiamdivpvdnkryryvyhsskwmvagnadsp
ENSMMUP00000016474  iacsletkelwdkfhelgtemiitksgrrmfptirvsfsgvdpeakyivlmdivpvdnkryryayhrsswlvagkadp
ENSMMUP00000001317  vslslenrelwkefssvgtemiitkagrrmfpacrvsvtgldpearylflldvvpvdgaryrwqgrrwepsgkaeprl
ENSMMUP00000019748  pkvhleakelwdqfhkrgtemvitksgrrmfppfkvrcsgldkkakyillmdiiaaddcrykfhnsrwmvagkadpem
ENSMMUP00000012124  eiqvelqcadlwkrfhdigtemiitkagrrmfpamrvkitgldphqqyyiamdivpvdnkryryvyhsskwmvagnad
ENSMMUP00000015629  aqvylcnrplwlkfhrhqtemiitkqgrrmfpflsfnisgldptahynifvdviladp....................
ENSMMUP00000029747  wqlpshsgpyelrievqpkshhrahyetegsrgavkasagghpivqlh..............................
ENSMMUP00000013896  rvdlqgaelwkrfheigtemiitkagrrmfpamrvkisgldphqqyyiamdivpvdnkryryvyhsskwmvagnadsp
ENSMMUP00000012126  eiqvelqcadlwkrfhdigtemiitkagrrmfpamrvkitgldphqqyyiamdivpvdnkryryvyhsskwmvagnad
ENSMMUP00000009731  gpyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtkdpphrphphelvgkdc
ENSMMUP00000037540  gpyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtkdpphrphphelvgkdc
ENSMMUP00000035698  gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkic...............................
ENSMMUP00000028761  wplpahfgqcelkievqpkthhrahyetegsrgavkastgghpvvkllgynekpinlqmfigtaddrylrphafyqvh
ENSMMUP00000032353  wplpahfgqcelkievqpkthhrahyetegsrgavkastgghpvvkllgynekpinlqmfigtaddrylrphafyqvh
ENSMMUP00000028764  wplpahfgqcelkievqpkthhrahyetegsrgavkastgghpvvkllgynekpinlqmfigtaddrylrphafyqvh
ENSMMUP00000038274  qdsdl.........................................................................
ENSMMUP00000002543  hvylcnrplwlkfhrhqtemiitkqgrrmfpflsfninglnptahynvfvevvlad......................
ENSMMUP00000003997  gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkic...............................
ENSMMUP00000003998  gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkic...............................
ENSMMUP00000024379  vtvqlemkplweefnqlgtemivtkagrrmfppfqvkilgmdsladyallmdfiplddkryryafhssawlvagkadp
ENSMMUP00000038273  aqtqfs........................................................................
ENSMMUP00000009300  lrvalnnhllwskfnqhqtemiitkqgrrmfpflsftvagleptshyrmfvdvvlvdqhhwryqsgkwv.........
ENSMMUP00000011939  diqmelqgselwkrfhdigtemiitkagrrmfpsvrvkvkgldpgkqyyvaidvvpvdskryryvyhssqwmvagntd
ENSMMUP00000013477  gitvtldnnsmwnefyhrstemiltkqgrrmfpycrywitgldsnlkyilvmdispvdnhrykwngrwwepsgkaeph
ENSMMUP00000009730  aqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtkdpphrphphelvgkdcrdgfyea
ENSMMUP00000002215  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000002211  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000035631  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000002207  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000002203  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000002205  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000003247  vevladhpgelvrtdspnflcsvlpthw..................................................
ENSMMUP00000026057  eiiadhpaelvrtdspnflcsvlpsh....................................................
ENSMMUP00000026056  eiiadhpaelvrtdspnflcsvlpsh....................................................
ENSMMUP00000020809  rltreamrnylkergdqtvlilhakvaqksygne............................................
ENSMMUP00000003249  dvladhagelvrtdspnflcsvlpshw...................................................
ENSMMUP00000020816  rltreamrnylkergdqtvlilhakvaqksygne............................................
ENSMMUP00000020813  rltreamrnylkergdqtvlilhakvaqksygne............................................
ENSMMUP00000018596  qphlviteqpkqrgmrfryecegrsagsilgessteasktlpaielrdcgglrevevtaclvwkdwphrvhphslvgk
ENSMMUP00000037704  rmfpvlkisvtgldpnamysllldfvpt..................................................
ENSMMUP00000023995  ypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghnepvvlqvfvgndsgrvkphgfyqacrvt
ENSMMUP00000032343  ypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghnepvvlqvfvgndsgrvkphgfyqacrvt
ENSMMUP00000023997  ypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghnepvvlqvfvgndsgrvkphgfyqacrvt
ENSMMUP00000004541  lrggvrrclqqqceqtvrivhakvaqksygnekrffcpppcvylsgpgwrvkpgqdqahqagetgptvcgymgldsas
ENSMMUP00000022544  vsvqlemkalwdefnqlgtemivtkagrrmfptfqvklfgmdpmadymllmdfvpvddkryrdlgghpgkwqvsacsl
ENSMMUP00000022546  vsvqlemkalwdefnqlgtemivtkagrrmfptfqvklfgmdpmadymllmdfvpvddkryrdlgghpgkwqvsacsl
ENSMMUP00000040958  mfpsvrvkvkgldpgkqyyvaidvvpvdskryryvyhssqwmvagntdhlciiprfyvhpdspc..............
ENSMMUP00000004490  wplpsqyeqlelrievqprahhrahyetegsrgavkaapgghpvvklcrhmalpfptlp...................
ENSMMUP00000016625  lewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlh............................
ENSMMUP00000032352  lqllgynekpinlqmfigtaddrylrphafyqvhritgktvatasqeiiiastkvleipllpen..............
ENSMMUP00000032351  mfigtaddrylrphafyqvhritgktvatasqeiiiastkvleipllpennmsasidcagilklrnsdielrkgetdi
ENSMMUP00000028763  mfigtaddrylrphafyqvhritgktvatasqeiiiastkvleipllpennmsasidcagilklrnsdielrkgetdi
ENSMMUP00000020812  mgsgwkkkkeqmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyi.......................
ENSMMUP00000002210  magndenysaelrnata.............................................................
ENSMMUP00000004582  vtstfiiekqppqvlktqtkfaatvrllvg................................................
ENSMMUP00000008751  gsyldpnyqsikwqphqqnkwatlydanykelpmltyrvdadkgfnfsvgddafvcqkknhfqvtvyigmlgepk...
ENSMMUP00000008748  gsyldpnyqsikwqphqqnkwatlydanykelpmltyrvdadkgfnfsvgddafvcqkknhfqvtvyigmlgepk...
ENSMMUP00000037313  gsyldpnyqsikwqphqqnkwatlydanykelpmltyrvdadkgfnfsvgddafvcqkknhfqvtvyigmlgepk...
ENSMMUP00000008750  adkgfnfsvgddafvcqkknhfqvtvyigmlgepkfvktpeglkpldcfylklhglealnqsinieqs..........
ENSMMUP00000039187  dkgfn.........................................................................
ENSMMUP00000008560  gkpnpdqryfmlvvgly.............................................................


                                                                                                    
                                                                                                    
d1ycsa_               ..............................................................................
ENSMMUP00000014032  nngslsaefkhltlreqr............................................................
ENSMMUP00000007422  stngslaaefrhlqlkeqknagtrtnegplivteelhslsfetqlcqpg.............................
ENSMMUP00000007424  slsvefrhlqpkemkssaggkgnegchmvteelhsitfetqiclygltidle..........................
ENSMMUP00000014026  yhqatgtlsahfrnmslkrikradrrgaesvteekftvlfesqfsvgsnelvfqvktlslpvvvivhgsqdhnatatv
ENSMMUP00000001096  ..............................................................................
ENSMMUP00000011334  ..............................................................................
ENSMMUP00000035274  ..............................................................................
ENSMMUP00000040658  ..............................................................................
ENSMMUP00000040656  ..............................................................................
ENSMMUP00000021769  ..............................................................................
ENSMMUP00000040655  ..............................................................................
ENSMMUP00000021768  ..............................................................................
ENSMMUP00000021636  ..............................................................................
ENSMMUP00000038275  ..............................................................................
ENSMMUP00000021635  ..............................................................................
ENSMMUP00000021634  ..............................................................................
ENSMMUP00000034946  ..............................................................................
ENSMMUP00000004986  ..............................................................................
ENSMMUP00000023071  ntvplensipgnccsalfknlllkkikrcerkgtesvteekcavlfsasftlgpgklpiq..................
ENSMMUP00000021290  mpgrlyvhpdspatgahwmrqlvsfqklklt...............................................
ENSMMUP00000021289  mpgrlyvhpdspatgahwmrqlvsfqklklt...............................................
ENSMMUP00000012907  pkrmyihpdspatgeqwmakpvafh.....................................................
ENSMMUP00000015631  mpgrlyvhpdspatgahwmrqlvsfqklklt...............................................
ENSMMUP00000021288  mpgrlyvhpdspatgahwmrqlvsfqklklt...............................................
ENSMMUP00000029722  mpgrlyvhpdspatgahwmrqlvsfqklkltnnhldpfg.......................................
ENSMMUP00000019749  pkrmyihpdspatgeqwmsk..........................................................
ENSMMUP00000032924  pscvyihpdspnfgahwmkapvsfskvkltnklngggqimlnsl..................................
ENSMMUP00000022430  pscvyihpdspnfgahwmkapvsfskvkltnklngggqimlnsl..................................
ENSMMUP00000014199  rdgyyeaefgqerrplffqnlgircvkkkevkeaiisrikaginpfnvpekqlndiedcdlnvv..............
ENSMMUP00000006984  ..............................................................................
ENSMMUP00000013895  vpprvyihpds...................................................................
ENSMMUP00000016474  plparlyvhpdspftgeqllkqmvsfekvkltnneldqhg......................................
ENSMMUP00000001317  pdrvyihpdspatgahwmrqpvsfhrvkltnstld...........................................
ENSMMUP00000019748  pkrmyihpdspatgeqwmskvvtfhklkltnnisdkhg........................................
ENSMMUP00000012124  spvpprvyihpdslasgdtwm.........................................................
ENSMMUP00000015629  ..............................................................................
ENSMMUP00000029747  ..............................................................................
ENSMMUP00000013896  vpprvyihpds...................................................................
ENSMMUP00000012126  spvpprvyihpdslasgdtwm.........................................................
ENSMMUP00000009731  rdgfyeaelcpdrci...............................................................
ENSMMUP00000037540  rdgfyeaelcpdrci...............................................................
ENSMMUP00000035698  ..............................................................................
ENSMMUP00000028761  ri............................................................................
ENSMMUP00000032353  ri............................................................................
ENSMMUP00000028764  ri............................................................................
ENSMMUP00000038274  ..............................................................................
ENSMMUP00000002543  ..............................................................................
ENSMMUP00000003997  ..............................................................................
ENSMMUP00000003998  ..............................................................................
ENSMMUP00000024379  atpgrvhfhpdspakgaqwmrqivsfd...................................................
ENSMMUP00000038273  ..............................................................................
ENSMMUP00000009300  ..............................................................................
ENSMMUP00000011939  hlciip........................................................................
ENSMMUP00000013477  vlgrvfihpespstghywmhqpvsfyk...................................................
ENSMMUP00000009730  elcpdrcihsf...................................................................
ENSMMUP00000002215  ..............................................................................
ENSMMUP00000002211  ..............................................................................
ENSMMUP00000035631  ..............................................................................
ENSMMUP00000002207  ..............................................................................
ENSMMUP00000002203  ..............................................................................
ENSMMUP00000002205  ..............................................................................
ENSMMUP00000003247  ..............................................................................
ENSMMUP00000026057  ..............................................................................
ENSMMUP00000026056  ..............................................................................
ENSMMUP00000020809  ..............................................................................
ENSMMUP00000003249  ..............................................................................
ENSMMUP00000020816  ..............................................................................
ENSMMUP00000020813  ..............................................................................
ENSMMUP00000018596  dctdgv........................................................................
ENSMMUP00000037704  ..............................................................................
ENSMMUP00000023995  grnt..........................................................................
ENSMMUP00000032343  grnt..........................................................................
ENSMMUP00000023997  grnt..........................................................................
ENSMMUP00000004541  gsaaetqkln....................................................................
ENSMMUP00000022544  ppspgnsgwgparpmlgwveqivsfdklkltnnllddnghiil...................................
ENSMMUP00000022546  ppspgnsgwgparpmlgwveqivsfdklkltnnllddnghiil...................................
ENSMMUP00000040958  ..............................................................................
ENSMMUP00000004490  ..............................................................................
ENSMMUP00000016625  ..............................................................................
ENSMMUP00000032352  ..............................................................................
ENSMMUP00000032351  grknt.........................................................................
ENSMMUP00000028763  grknt.........................................................................
ENSMMUP00000020812  ..............................................................................
ENSMMUP00000002210  ..............................................................................
ENSMMUP00000004582  ..............................................................................
ENSMMUP00000008751  ..............................................................................
ENSMMUP00000008748  ..............................................................................
ENSMMUP00000037313  ..............................................................................
ENSMMUP00000008750  ..............................................................................
ENSMMUP00000039187  ..............................................................................
ENSMMUP00000008560  ..............................................................................


                              10        20        30        40        50          60        70      
                               |         |         |         |         |           |         |      
d1ycsa_               VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDS..TPPPGTRVRAMAIYKQSQHMTEV
ENSMMUP00000014032  -----------------------------------------------------..-----------------------
ENSMMUP00000007422  -----------------------------------------------------..-----------------------
ENSMMUP00000007424  ------------------T----------------------------------..-----------------------
ENSMMUP00000014026  ----------------L------------------------------------..-----------------------
ENSMMUP00000001096  -----------------------------------------------------..-------------L---------
ENSMMUP00000011334  VPSQKTYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDS..TPPPGSRVRAMAIYKQSQHMTEV
ENSMMUP00000035274  VPSQKTYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDS..TPPPGSRVRAMAIYKQSQHMTEV
ENSMMUP00000040658  IPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVST..PPPPGTAIRAMPVYKKAEHVTDI
ENSMMUP00000040656  IPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVST..PPPPGTAIRAMPVYKKAEHVTDI
ENSMMUP00000021769  IPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVST..PPPPGTAIRAMPVYKKAEHVTDI
ENSMMUP00000040655  IPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVST..PPPPGTAIRAMPVYKKAEHVTDI
ENSMMUP00000021768  IPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVST..PPPPGTAIRAMPVYKKAEHVTDI
ENSMMUP00000021636  IPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000038275  IPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000021635  IPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000021634  IPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000034946  -----------------------------------------------------..-----------------------
ENSMMUP00000004986  -----------------------------------------------------..-----------------------
ENSMMUP00000023071  ----------------------------------------L------------..-----------------------
ENSMMUP00000021290  -----------------------------------------------------..---------------------N-
ENSMMUP00000021289  -----------------------------------------------------..---------------------N-
ENSMMUP00000012907  ---------------------------------------K-------------..-----------------------
ENSMMUP00000015631  -----------------------------------------------------..---------------------N-
ENSMMUP00000021288  -----------------------------------------------------..---------------------N-
ENSMMUP00000029722  -----------------------------------------------------..-----------------------
ENSMMUP00000019749  -----------------------------------------------------..-----------------------
ENSMMUP00000032924  -----------------------------------------------------..-----------------------
ENSMMUP00000022430  -----------------------------------------------------..-----------------------
ENSMMUP00000014199  -----------------------------------------------------..-----------------------
ENSMMUP00000006984  -----------------------------------------------------..-----------------------
ENSMMUP00000013895  -----------------------------------------------------..-----------------------
ENSMMUP00000016474  -----------------------------------------------------..-----------------------
ENSMMUP00000001317  -----------------------------------------------------..-PHGHLILHSMHKYQPRIHLVRA
ENSMMUP00000019748  ------------FT---------------------------------------..-----------------------
ENSMMUP00000012124  -----------------------------------------------------..--------R--------------
ENSMMUP00000015629  -----------------------------------------------------..-----------------------
ENSMMUP00000029747  -----------------------------------------------------..-----------------------
ENSMMUP00000013896  -----------------------------------------------------..-----------------------
ENSMMUP00000012126  -----------------------------------------------------..--------R--------------
ENSMMUP00000009731  -----------------------------------------------------..-----------------------
ENSMMUP00000037540  -----------------------------------------------------..-----------------------
ENSMMUP00000035698  -----NYEGPAKIEVDLVTHSDPPRAH--------------------------..-----------------------
ENSMMUP00000028761  -----------------------------------------------------..-------------------T---
ENSMMUP00000032353  -----------------------------------------------------..-------------------T---
ENSMMUP00000028764  -----------------------------------------------------..-------------------T---
ENSMMUP00000038274  ------------------------SDPMWYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000002543  -----------------------------------------------------..-----------------------
ENSMMUP00000003997  -----NYEGPAKIEVDLVTHSDPPRAH--------------------------..-----------------------
ENSMMUP00000003998  -----NYEGPAKIEVDLVTHSDPPRAH--------------------------..-----------------------
ENSMMUP00000024379  -----------------------------------------------------..-----------------------
ENSMMUP00000038273  ----------------------------EYSTELKKLYCQIAKTCPIQIKVMT..PPPQGAVIRAMPVYKKAEHVTEV
ENSMMUP00000009300  -----------------------------------------------------..-----------------------
ENSMMUP00000011939  -----------------------------------R-----------------..-----------------------
ENSMMUP00000013477  ---------------------------------------------------L-..-----------------------
ENSMMUP00000009730  -----------------------------------------------------..-----------------------
ENSMMUP00000002215  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000002211  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000035631  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000002207  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000002203  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000002205  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000003247  ---------------------------------------RCNKTLPIAFKVVAlgDVPDGTLVTVMAGNDE-------
ENSMMUP00000026057  ------------------------------------W--RCNKTLPVAFKVVAlgEVPDGTVVTVMAGNDE--NYSA-
ENSMMUP00000026056  ------------------------------------W--RCNKTLPVAFKVVAlgEVPDGTVVTVMAGNDE--NYSA-
ENSMMUP00000020809  -----------------------------------------------------..-----------------------
ENSMMUP00000003249  ---------------------------------------RCNKTLPVAFKVVAlgDVPDGTVVTVMA-----------
ENSMMUP00000020816  -----------------------------------------------------..-----------------------
ENSMMUP00000020813  -----------------------------------------------------..-----------------------
ENSMMUP00000018596  -----------------------------------------------------..-----------------------
ENSMMUP00000037704  -----------------------------------------------------..-----------------------
ENSMMUP00000023995  -----------------------------------------------------..-----------------------
ENSMMUP00000032343  -----------------------------------------------------..-----------------------
ENSMMUP00000023997  -----------------------------------------------------..-----------------------
ENSMMUP00000004541  -----------------------------------------------------..-----------------------
ENSMMUP00000022544  -----------------------------------------------------..-----------------------
ENSMMUP00000022546  -----------------------------------------------------..-----------------------
ENSMMUP00000040958  -----------------------------------------------------..-----------------------
ENSMMUP00000004490  -----------------------------------------------------..-----------------------
ENSMMUP00000016625  -----------------------------------------------------..-----------------------
ENSMMUP00000032352  -----------------------------------------------------..-----------------------
ENSMMUP00000032351  -----------------------------------------------------..-----------------------
ENSMMUP00000028763  -----------------------------------------------------..-----------------------
ENSMMUP00000020812  -------------------S---------------------------------..-----------------------
ENSMMUP00000002210  -----------------------------------------------------..-----------------------
ENSMMUP00000004582  -----------------------------------------------------..-----------------------
ENSMMUP00000008751  -----------------------------------------------------..-----F-----------------
ENSMMUP00000008748  -----------------------------------------------------..-----F-----------------
ENSMMUP00000037313  -----------------------------------------------------..-----F-----------------
ENSMMUP00000008750  -----------------------------------------------------..-----------------------
ENSMMUP00000039187  -----------------------------FSPADEAFVCQKKNHFQITIHVQV..WGSPK------------------
ENSMMUP00000008560  -----------------------------------------------------..-----------------------


                        80           90         100       110       120       130       140         
                         |            |           |         |         |         |         |         
d1ycsa_               VRRCPHHERCSD...SDG..LAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM..
ENSMMUP00000014032  ---C--------...---..--------------------------------------------------------..
ENSMMUP00000007422  ------------...---..-----L--------------------------------------------------..
ENSMMUP00000007424  ------------...---..--------------------------------------------------------..
ENSMMUP00000014026  ------------...---..--------------------------------------------------------..
ENSMMUP00000001096  ------------...---..--------------------------------------------------------..
ENSMMUP00000011334  VRRCPHHERCSD...SDG..LAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM..
ENSMMUP00000035274  VRRCPHHERCSD...SDG..LAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM..
ENSMMUP00000040658  VKRCPNHELGRD...FNEgqSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV..
ENSMMUP00000040656  VKRCPNHELGRD...FNEgqSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV..
ENSMMUP00000021769  VKRCPNHELGRD...FNEgqSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV..
ENSMMUP00000040655  VKRCPNHELGRD...FNEgqSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV..
ENSMMUP00000021768  VKRCPNHELGRD...FNEgqSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV..
ENSMMUP00000021636  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000038275  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000021635  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000021634  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000034946  ------------...---..--------------------------------------------------------..
ENSMMUP00000004986  ------------...---..--------------------------------------------------------..
ENSMMUP00000023071  ------------...---..--------------------------------------------------------..
ENSMMUP00000021290  ------------...---..--------------------------------------------------------..
ENSMMUP00000021289  ------------...---..--------------------------------------------------------..
ENSMMUP00000012907  ------------...---..--------------------------------------------------------..
ENSMMUP00000015631  ------------...---..--------------------------------------------------------..
ENSMMUP00000021288  ------------...---..--------------------------------------------------------..
ENSMMUP00000029722  ------H-----...---..--------------------------------------------------------..
ENSMMUP00000019749  ------------...---..---------------------------------------------V----------..
ENSMMUP00000032924  ------------...-HK..YEPRIHIVRVGGPQRMI---------------------------------------..
ENSMMUP00000022430  ------------...-HK..YEPRIHIVRVGGPQRMI---------------------------------------..
ENSMMUP00000014199  ------------...---..--------------------------------------------------------..
ENSMMUP00000006984  ------------...---..---DSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISF-------..
ENSMMUP00000013895  ------------...---..-----------------------------------P--------------------..
ENSMMUP00000016474  ------H-----...---..--------------------------------------------------------..
ENSMMUP00000001317  AQLCSQHW----...---..--------------------------------------------------------..
ENSMMUP00000019748  ------------...---..--------------------------------------------------------..
ENSMMUP00000012124  ------------...---..--------------------------------------------------------..
ENSMMUP00000015629  -----NHWRFQG...GKW..VPCGKADTNVQGNRVYMHPDSPNTG-------------------------------..
ENSMMUP00000029747  ------------...---..--------------------------------------------------------..
ENSMMUP00000013896  ------------...---..-----------------------------------P--------------------..
ENSMMUP00000012126  ------------...---..--------------------------------------------------------..
ENSMMUP00000009731  ------------...---..--------------------------------------------------------..
ENSMMUP00000037540  ------------...---..--------------------------------------------------------..
ENSMMUP00000035698  ------------...---..--------------------------------------------------------..
ENSMMUP00000028761  ------------...---..--------------------------------------------------------..
ENSMMUP00000032353  ------------...---..--------------------------------------------------------..
ENSMMUP00000028764  ------------...---..--------------------------------------------------------..
ENSMMUP00000038274  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000002543  ----PNHWRFQG...GKW..VTCGKADNNMQGNKMYVHPESPNTGS------------------------------..
ENSMMUP00000003997  ------------...---..--------------------------------------------------------..
ENSMMUP00000003998  ------------...---..--------------------------------------------------------..
ENSMMUP00000024379  ------------...---..--------------------------------------------------------..
ENSMMUP00000038273  VKRCPNHELSRE...FNEgqIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV..
ENSMMUP00000009300  ------------...---..-Q------------------------------------------------------..
ENSMMUP00000011939  ------------...---..--------------------------------------------------------..
ENSMMUP00000013477  ------------...---..--------------------------------------------------------..
ENSMMUP00000009730  ------------...---..--------------------------------------------------------..
ENSMMUP00000002215  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000002211  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000035631  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000002207  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000002203  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000002205  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000003247  --------NYSAelrNAT..AAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000026057  ---------ELR...NAS..AVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000026056  ---------ELR...NAS..AVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYH--------------..
ENSMMUP00000020809  ------------...---..----------------------------------------------KRFFCPPPCV..
ENSMMUP00000003249  ------------...---..--------------------------------------------------------..
ENSMMUP00000020816  ------------...---..----------------------------------------------KRFFCPPPCV..
ENSMMUP00000020813  ------------...---..----------------------------------------------KRFFCPPPCV..
ENSMMUP00000018596  ------------...---..--------------------------------------------------------..
ENSMMUP00000037704  ------------...---..---DSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISF-------..
ENSMMUP00000023995  ------------...---..---------------T----------------------------------------..
ENSMMUP00000032343  ------------...---..---------------T----------------------------------------..
ENSMMUP00000023997  ------------...---..---------------T----------------------------------------..
ENSMMUP00000004541  ------------...---..---------------------------------------FEQQPDSREFGCAKTLYis
ENSMMUP00000022544  ----------N-...---..--------------------------------------------------------..
ENSMMUP00000022546  ----------N-...---..--------------------------------------------------------..
ENSMMUP00000040958  ------------...---..-------------------------------------S------------------..
ENSMMUP00000004490  ------------...---..--------------------------------------------------------..
ENSMMUP00000016625  ------------...---..--------------------------------------------------------..
ENSMMUP00000032352  ------------...---..--------------------------------------------------------..
ENSMMUP00000032351  ------------...---..--------------------------------------------------------..
ENSMMUP00000028763  ------------...---..--------------------------------------------------------..
ENSMMUP00000020812  ------------...---..--------------------------------------------------------..
ENSMMUP00000002210  ------------...---..-AMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA------------..
ENSMMUP00000004582  ------------...---..------------------------G-------------------------------..
ENSMMUP00000008751  ------------...---..--------------------------------------------------------..
ENSMMUP00000008748  ------------...---..--------------------------------------------------------..
ENSMMUP00000037313  ------------...---..--------------------------------------------------------..
ENSMMUP00000008750  ------------...---..--------------------------------------------------------..
ENSMMUP00000039187  ------------...---..--------------------------------------------------------..
ENSMMUP00000008560  ------------...---..---------AANQDQFYLLSAHVSER------------------------------..


                      150       160       170       180       190                                   
                        |         |         |         |         |                                   
d1ycsa_               GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEE..................................
ENSMMUP00000014032  --------------------------------------------gnggrancdaslivteelhlitfetevyhqglki
ENSMMUP00000007422  --------------------------------------------vidlettslpvvvisnvsqlpsgwasilwynmlv
ENSMMUP00000007424  --------------------------------------------sslpvvmisnvsqlpnawasiiwynvstndsqnl
ENSMMUP00000014026  --------------------------------------------wdnafaepgrvpfavpdkvlwpqlcealnmkfka
ENSMMUP00000001096  --------------------------------------------tsnqktltpekgqsqgliwdfgyltlveqrsggs
ENSMMUP00000011334  GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEE..................................
ENSMMUP00000035274  GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEE..................................
ENSMMUP00000040658  GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADE-..................................
ENSMMUP00000040656  GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADE-..................................
ENSMMUP00000021769  GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADE-..................................
ENSMMUP00000040655  GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADE-..................................
ENSMMUP00000021768  GGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADE-..................................
ENSMMUP00000021636  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000038275  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000021635  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000021634  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000034946  ---------------------------------Y----------vgpakvivqlvtngknihlhahslvgkhcedgic
ENSMMUP00000004986  ---------------------------------Y----------vgpakvivqlvtngknihlhahslvgkhcedgic
ENSMMUP00000023071  --------------------------------------------qalslplvvivhgnqdnnakatilwdnafsemdr
ENSMMUP00000021290  --------------------------------------------nhldpfghiilnsmhkyqprlhivkadenngfgs
ENSMMUP00000021289  --------------------------------------------nhldpfghiilnsmhkyqprlhivkadenngfgs
ENSMMUP00000012907  --------------------------------------------lkltnnisdkhgftilnsmhkyqprfhivrandi
ENSMMUP00000015631  --------------------------------------------nhldpfghiilnsmhkyqprlhivkadenngfgs
ENSMMUP00000021288  --------------------------------------------nhldpfghiilnsmhkyqprlhivkadenngfgs
ENSMMUP00000029722  --------------------------------------------iilnsmhkyqprlhivkadennafgskntafcth
ENSMMUP00000019749  --------------------------------------------vtfhklkltnnisdkhgftilnsmhkyqprfhiv
ENSMMUP00000032924  --------------------------------------------tshcfpetqfiavtayqneeitalkikynpfaka
ENSMMUP00000022430  --------------------------------------------tshcfpetqfiavtayqneeitalkikynpfaka
ENSMMUP00000014199  ------RLCFQVFLPDEHGNL-----------------------ttalppvvsnpiydnrapntaelri.........
ENSMMUP00000006984  --------------------------------------------skvkltnklngggqimlnslhkyepqvhivrvgs
ENSMMUP00000013895  --------------------------------------------asgetwmrqvisfdklkltnnelddqghiilhsm
ENSMMUP00000016474  --------------------------------------------iilnsmhkyqprvhiikkkdhtasllnlkseefr
ENSMMUP00000001317  --------------------------------------------ggmasfrfpettfisvtayqnpritqlkiaanpf
ENSMMUP00000019748  --------------------------------------------lafpsdhatwqgnysfgtqtilnsmhkyqprfhi
ENSMMUP00000012124  --------------------------------------------qvvsfdklkltnnelddqghiilhsmhkyqprvh
ENSMMUP00000015629  --------------------------------------------ahwmrqeisfgklkltnnkgasnnngqmvvlqsl
ENSMMUP00000029747  G-------------------------------------------yleseplmlqlfigtaddrllrphafyqvhritg
ENSMMUP00000013896  --------------------------------------------asgetwmrqvisfdklkltnnelddqghiilhsm
ENSMMUP00000012126  --------------------------------------------qvvsfdklkltnnelddqghiilhsmhkyqprvh
ENSMMUP00000009731  H-------------------------------------------sfqnlgiqcvkkrdleqaitqriqtnnnpfqvpi
ENSMMUP00000037540  H-------------------------------------------sfqnlgiqcvkkrdleqaitqriqtnnnpfqvpi
ENSMMUP00000035698  --------------------------------------------ahslvgkqcselgicavsvgpkdmtaqfnnlgvl
ENSMMUP00000028761  --------------------------------------------gktvatasqeiiiastkvleipllpennmsasid
ENSMMUP00000032353  --------------------------------------------gktvatasqeiiiastkvleipllpennmsasid
ENSMMUP00000028764  --------------------------------------------gktvatasqeiiiastkvleipllpennmsasid
ENSMMUP00000038274  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000002543  --------------------------------------------hwmrqeisfgklkltnnkgannnntqmivlqslh
ENSMMUP00000003997  --------------------------------------------ahslvgkqcselgicavsvgpkdmtaqfnnlgvl
ENSMMUP00000003998  --------------------------------------------ahslvgkqcselgicavsvgpkdmtaqfnnlgvl
ENSMMUP00000024379  ------K-------------------------------------lkltnnllddnghiilnsmhryqprfhvvfvdpr
ENSMMUP00000038273  GGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADE-..................................
ENSMMUP00000009300  --------------------------------------------cgkaegsmpgnrlyvhpdspntgahwmrqevsfg
ENSMMUP00000011939  --------------------------------------------fyvhpdspcsgetwmrqiisfdrmkltnnemddk
ENSMMUP00000013477  --------------------------------------------kltnntldqeghiilhsmhrylprlhlvpaekav
ENSMMUP00000009730  ---Q----------------------------------------nlgiqcvkkrdleqaitqriqtnnnpfqvpieeq
ENSMMUP00000002215  --------------------------------------------raikitvdgpreprs...................
ENSMMUP00000002211  --------------------------------------------raikitvdgpreprr...................
ENSMMUP00000035631  --------------------------------------------raikitvdgpreprr...................
ENSMMUP00000002207  --------------------------------------------raikitvdgpreprr...................
ENSMMUP00000002203  --------------------------------------------raikitvdgpreprr...................
ENSMMUP00000002205  --------------------------------------------raikitvdgpreprr...................
ENSMMUP00000003247  --------------------------------------------raikitvdgprepr....................
ENSMMUP00000026057  --------------------------------------------raikvtvdgpreprr...................
ENSMMUP00000026056  --------------------------------------------raikvtvdgpreprr...................
ENSMMUP00000020809  YLMG----------------------------------------sgwkkkkeqmerdgcseqesqpcafigignsdqe
ENSMMUP00000003249  --------------------------------------------gndenysaelrnasavmknqvarfndlrfvgrsg
ENSMMUP00000020816  YLMG----------------------------------------sgwkkkkeqmerdgcseqesqpcafigignsdqe
ENSMMUP00000020813  YLMG----------------------------------------sgwkkkkeqmerdgcseqesqpcafigignsdqe
ENSMMUP00000018596  ---C----------------------------------------rvrlrphvsprhsfnnlgiqcvrkkeieaaierk
ENSMMUP00000037704  --------------------------------------------skvkltnklngggqimlnslhkyepqvhivrvgs
ENSMMUP00000023995  --------------------------------------------pckevdiegttvievgldpsnnmtlavdcvgilk
ENSMMUP00000032343  --------------------------------------------pckevdiegttvievgldpsnnmtlavdcvgilk
ENSMMUP00000023997  --------------------------------------------pckevdiegttvievgldpsnnmtlavdcvgilk
ENSMMUP00000004541  DADKRKHFRLVLRLVLRGGRELG---------------------tfhsrlikviskpsqkkqslkntd..........
ENSMMUP00000022544  --------------------------------------------smhryqprfhvvyvdprkdsekyaeenfktfvfe
ENSMMUP00000022546  --------------------------------------------smhryqprfhvvyvdprkdsekyaeenfktfvfe
ENSMMUP00000040958  --------------------------------------------getwmrqiisfdrmkltnnemddkghiilqsmhk
ENSMMUP00000004490  -------------LTWGRGWSWGRRGARTRIY------------flllckmvatasyeavvsgtkvlemtllpennma
ENSMMUP00000016625  GYMENKPLGLQIF-------------------------------igtaderilkphafyqvhritgktvtttsyekiv
ENSMMUP00000032352  -------------------------------------N------msasidcagilklrnsdielrkgetdigrkntrv
ENSMMUP00000032351  ----R---------------------------------------vrlvfrvhipqpngkvlslqiasipvecsqrsaq
ENSMMUP00000028763  ----R---------------------------------------vrlvfrvhipqpngkvlslqiasipvecsqrsaq
ENSMMUP00000020812  --------------------------------------------dsdkrkhfmlsvkmfygnsddigvflskrikvis
ENSMMUP00000002210  --------------------------------------------ikitvdgpreprr.....................
ENSMMUP00000004582  --------------------------------------------klnvhmnppqvkatiiseqqaksllknent....
ENSMMUP00000008751  --------------------------------------------vktpeglkpldcfylklhgvklealnqsinieqs
ENSMMUP00000008748  --------------------------------------------vktpeglkpldcfylklhgvklealnqsinieqs
ENSMMUP00000037313  --------------------------------------------vktpeglkpldcfylklhglqlealnqsinieqs
ENSMMUP00000008750  -----------------Q--------------------------sdrskrpfnpvtvnlppeqvtkvtvgrlhfsett
ENSMMUP00000039187  --------------------------------------------fvetemglkpiemfylkafgikveatnqiiaieq
ENSMMUP00000008560  --------------------------------------------iivrasnpgqfend....................


                                                                                                    
                                                                                                    
d1ycsa_               ..............................................................................
ENSMMUP00000014032  dlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtwdqvaevlswqfssttkrglsieqlttlae
ENSMMUP00000007422  aeprnlsfflnppcarwaqlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfwl
ENSMMUP00000007424  vffnnpppatlsqllevmswqfssyvgrglnsdqlnmlaekltvqssysdghltwakfckehlpgksftfwtwleail
ENSMMUP00000014026  evqsnrgltkenlvflaqklfnnssshledysglsvswsqfnrenlpgwnytfwqwfdgvmevlkkh...........
ENSMMUP00000001096  gkgsnkgplgvteelhiisftvkytyqglkqelktdtlpvviisnmnqlsiawasvlwfnllspnlqnqqffsnplka
ENSMMUP00000011334  ..............................................................................
ENSMMUP00000035274  ..............................................................................
ENSMMUP00000040658  ..............................................................................
ENSMMUP00000040656  ..............................................................................
ENSMMUP00000021769  ..............................................................................
ENSMMUP00000040655  ..............................................................................
ENSMMUP00000021768  ..............................................................................
ENSMMUP00000021636  ..............................................................................
ENSMMUP00000038275  ..............................................................................
ENSMMUP00000021635  ..............................................................................
ENSMMUP00000021634  ..............................................................................
ENSMMUP00000034946  tvtagpkdmvvgfanlgilhvtkkkvfetlearmteacirgynpgllvhpdlaylqaegggdrqlgdrekelirqaal
ENSMMUP00000004986  tvtagpkdmvvgfanlgilhvtkkkvfetlearmteacirgynpgllvhpdlaylqaegggdrqlgdrekelirqaal
ENSMMUP00000023071  vpfvvaervpwekmcetlnlkfmaevgtnrgllpehflflaqkifndnslsmeafqhrsvswsqfnkeillgrgftfw
ENSMMUP00000021290  kntafcthvfpetafiavtsyqnhkitqlkiennpfakgfr.....................................
ENSMMUP00000021289  kntafcthvfpetafiavtsyqnhkitqlkiennpfakgfr.....................................
ENSMMUP00000012907  lklpystfrtyvfpetdfiavtayqndkitqlkidnnpfakgfrd.................................
ENSMMUP00000015631  kntafcthvfpetafiavtsyqnhkitqlkiennpfakgfr.....................................
ENSMMUP00000021288  kntafcthvfpetafiavtsyqnhkitqlkiennpfakgfr.....................................
ENSMMUP00000029722  vfpetsfisvtsyqnhkitqlkiennpfakgfr.............................................
ENSMMUP00000019749  randilklpystfrtylfpetefiavtayqndkitqlkidnnpfakgfrd............................
ENSMMUP00000032924  fldake........................................................................
ENSMMUP00000022430  fldake........................................................................
ENSMMUP00000014199  ..............................................................................
ENSMMUP00000006984  ahrmvtncsfpetqfiavtayqneeitalkikynpfakafldaker................................
ENSMMUP00000013895  hkyqprvhvirkdcgddlspikpvpsgegvkafsfpetvfttvtayqnqqitrlkidrnpfakgfrdsgr........
ENSMMUP00000016474  tfifpetvftavtayqnqlitklkidsnpfakgfrd..........................................
ENSMMUP00000001317  akgfre........................................................................
ENSMMUP00000019748  vrandilklpystfrtylfpetefiavtayqndkitqlkidnnpfakgfrd...........................
ENSMMUP00000012124  virkdfssdlsptkpvpvgdgvktfnfpetvfttvtayqnqqitrlkidrnpfakgfrdsgr................
ENSMMUP00000015629  hkyqprlhvvevnedgtedtsqpgrvqtftfpetqfiavtayqntditqlkidhnpfakgfrdnyd............
ENSMMUP00000029747  ktvsttsheailsntkvleipllpensmravidcagilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtls
ENSMMUP00000013896  hkyqprvhvirkdcgddlspikpvpsgegvkafsfpetvfttvtayqnqqitrlkidrnpfakgfrdsgr........
ENSMMUP00000012126  virkdfssdlsptkpvpvgdgvktfnfpetvfttvtayqnqqitrlkidrnpfakgfrdsgr................
ENSMMUP00000009731  eeqrgdydlnavrlcfqvtvrdpsgrplrlppvlshpifdnrapntaelki...........................
ENSMMUP00000037540  eeqrgdydlnavrlcfqvtvrdpsgrplrlppvlshpifdnrapntaelki...........................
ENSMMUP00000035698  hvtkknmmgtmiqklqrqrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrasdgsfslplkpvisqpi
ENSMMUP00000028761  cagilklrnsdielrkgetdigrkntrvrlvfrvhipqpngkvlslqiasipvecsqrsaq.................
ENSMMUP00000032353  cagilklrnsdielrkgetdigrkntrvrlvfrvhipqpngkvlslqiasipvecsqrsaq.................
ENSMMUP00000028764  cagilklrnsdielrkgetdigrkntrvrlvfrvhipqpngkvlslqiasipvecsqrsaq.................
ENSMMUP00000038274  ..............................................................................
ENSMMUP00000002543  kyqprlhivevtedgvedlnepsktqtftfsetqfiavtayqntditqlkidhnpfakgfrdnyd.............
ENSMMUP00000003997  hvtkknmmgtmiqklqrqrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrasdgsfslplkpvisqpi
ENSMMUP00000003998  hvtkknmmgtmiqklqrqrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrasdgsfslplkpvisqpi
ENSMMUP00000024379  kdseryaqenfksfiftetqftavtayqnhritqlkiasnpfakgfre..............................
ENSMMUP00000038273  ..............................................................................
ENSMMUP00000009300  klkltnnkgasnnvtqmivlqslhkyqprlhivevndgepeaacnasnthiftfqetqfiavtayqnaeitqlkidnn
ENSMMUP00000011939  ghiilqsmhkykprvhvieqdssvdlsqlqslptegvktfsfketefttvtayqnqqitklkiernpfakgfrd....
ENSMMUP00000013477  eviqlngpgvhtftfpqteffavtayqniqitqlkidynpfakgfrd...............................
ENSMMUP00000009730  rgdydlnavrlcfqvtvrdpsgrplrlppvlshpifdnrapntaelki..............................
ENSMMUP00000002215  ..............................................................................
ENSMMUP00000002211  ..............................................................................
ENSMMUP00000035631  ..............................................................................
ENSMMUP00000002207  ..............................................................................
ENSMMUP00000002203  ..............................................................................
ENSMMUP00000002205  ..............................................................................
ENSMMUP00000003247  ..............................................................................
ENSMMUP00000026057  ..............................................................................
ENSMMUP00000026056  ..............................................................................
ENSMMUP00000020809  mqqlnlegknyctaktlyisdsdkrkhfmlsvkmfygnsddigvflskrikviskpskkkqslknad...........
ENSMMUP00000003249  rgksftltitvftnptqvatyhraikvtvdgpreprr.........................................
ENSMMUP00000020816  mqqlnlegknyctaktlyisdsdkrkhfmlsvkmfygnsddigvflskrikviskpskkkqslknad...........
ENSMMUP00000020813  mqqlnlegknyctaktlyisdsdkrkhfmlsvkmfygnsddigvflskrikviskpskkkqslknad...........
ENSMMUP00000018596  iqlgidpynagslknhqevdmnvvricfqasyrdqqgqmrrmdpvlsepvydkkstntselri...............
ENSMMUP00000037704  ahrmvtncsfpetqfiavtayqneeitalkikynpfakafldaker................................
ENSMMUP00000023995  lrnadvearigiagskkkstrarlvfrvnitrkdgstltlqtpsspilctqpagv.......................
ENSMMUP00000032343  lrnadvearigiagskkkstrarlvfrvnitrkdgstltlqtpsspilctqpagv.......................
ENSMMUP00000023997  lrnadvearigiagskkkstrarlvfrvnitrkdgstltlqtpsspilctqpagv.......................
ENSMMUP00000004541  ..............................................................................
ENSMMUP00000022544  etrftavtayqnhrraqgqvakgpfprgf.................................................
ENSMMUP00000022546  etrftavtayqnhrraqgqvakgpfprgf.................................................
ENSMMUP00000040958  ykprvhvieqdssvdlsqlqslptegvktfsfketefttvtayqnqqitklkiernpfakgfrd..............
ENSMMUP00000004490  anidcagilklrnsdielrkgetdigrkntrvrlvfrvhvpqgggkvvsvqaasvpiecsqrsaq.............
ENSMMUP00000016625  gntkvleiplepknnmratidsrgllelrnsdlvvrikg.......................................
ENSMMUP00000032352  rlvfrvhipqpngkvlslqiasipvecsqrsaq.............................................
ENSMMUP00000032351  ..............................................................................
ENSMMUP00000028763  ..............................................................................
ENSMMUP00000020812  kpskkkqslknad.................................................................
ENSMMUP00000002210  ..............................................................................
ENSMMUP00000004582  ..............................................................................
ENSMMUP00000008751  qsdrskrpfnpvtvnlppeqvtkvtvgrlhfsettannmrkkgkpnpdqryfmlvvalqahaqnqnytlaaqiserii
ENSMMUP00000008748  qsdrskrpfnpvtvnlppeqvtkvtvgrlhfsettannmrkkgkpnpdqryfmlvvalqahaqnqnytlaaqiserii
ENSMMUP00000037313  qsdrskrpfnpvtvnlppeqvtkvtvgrlhfsettannmrkkgkpnpdqryfmlvvalqahaqnqnytlaaqiserii
ENSMMUP00000008750  annmrkkgkpnpdqryfmlvvalqahaqnqnytlaaqiseriivrasnpgqfesd.......................
ENSMMUP00000039187  sqadrskkifnpvkidlladqvtkvtlgrlhfsettannmrkkgkpnpdqryfmlvvglyaanqdqfyllsahvseri
ENSMMUP00000008560  ..............................................................................


                                                                                                  
                                                                                                  
d1ycsa_               ............................................................................
ENSMMUP00000014032  kllgpgvnysgcqitwakfckenmagkgfsfwvwldniidlvkky...............................
ENSMMUP00000007422  wiesilelikkh................................................................
ENSMMUP00000007424  dlikkh......................................................................
ENSMMUP00000014026  ............................................................................
ENSMMUP00000001096  pwsllgpalswqfssyvgrglnsdqlsmlrnklfgqncrtedpllswadftkresppgklpfwtwldkilelvhdh
ENSMMUP00000011334  ............................................................................
ENSMMUP00000035274  ............................................................................
ENSMMUP00000040658  ............................................................................
ENSMMUP00000040656  ............................................................................
ENSMMUP00000021769  ............................................................................
ENSMMUP00000040655  ............................................................................
ENSMMUP00000021768  ............................................................................
ENSMMUP00000021636  ............................................................................
ENSMMUP00000038275  ............................................................................
ENSMMUP00000021635  ............................................................................
ENSMMUP00000021634  ............................................................................
ENSMMUP00000034946  qqtkemdlsvvrlmftaflpdstgsftrrlepvvsdaiydskapnasnlki.........................
ENSMMUP00000004986  qqtkemdlsvvrlmftaflpdstgsftrrlepvvsdaiydskapnasnlki.........................
ENSMMUP00000023071  qwfdgvldltkrc...............................................................
ENSMMUP00000021290  ............................................................................
ENSMMUP00000021289  ............................................................................
ENSMMUP00000012907  ............................................................................
ENSMMUP00000015631  ............................................................................
ENSMMUP00000021288  ............................................................................
ENSMMUP00000029722  ............................................................................
ENSMMUP00000019749  ............................................................................
ENSMMUP00000032924  ............................................................................
ENSMMUP00000022430  ............................................................................
ENSMMUP00000014199  ............................................................................
ENSMMUP00000006984  ............................................................................
ENSMMUP00000013895  ............................................................................
ENSMMUP00000016474  ............................................................................
ENSMMUP00000001317  ............................................................................
ENSMMUP00000019748  ............................................................................
ENSMMUP00000012124  ............................................................................
ENSMMUP00000015629  ............................................................................
ENSMMUP00000029747  lqvasnpiecsqrsaq............................................................
ENSMMUP00000013896  ............................................................................
ENSMMUP00000012126  ............................................................................
ENSMMUP00000009731  ............................................................................
ENSMMUP00000037540  ............................................................................
ENSMMUP00000035698  hdskspgasnlki...............................................................
ENSMMUP00000028761  ............................................................................
ENSMMUP00000032353  ............................................................................
ENSMMUP00000028764  ............................................................................
ENSMMUP00000038274  ............................................................................
ENSMMUP00000002543  ............................................................................
ENSMMUP00000003997  hdskspgasnlki...............................................................
ENSMMUP00000003998  hdskspgasnlki...............................................................
ENSMMUP00000024379  ............................................................................
ENSMMUP00000038273  ............................................................................
ENSMMUP00000009300  pfakgfrenfe.................................................................
ENSMMUP00000011939  ............................................................................
ENSMMUP00000013477  ............................................................................
ENSMMUP00000009730  ............................................................................
ENSMMUP00000002215  ............................................................................
ENSMMUP00000002211  ............................................................................
ENSMMUP00000035631  ............................................................................
ENSMMUP00000002207  ............................................................................
ENSMMUP00000002203  ............................................................................
ENSMMUP00000002205  ............................................................................
ENSMMUP00000003247  ............................................................................
ENSMMUP00000026057  ............................................................................
ENSMMUP00000026056  ............................................................................
ENSMMUP00000020809  ............................................................................
ENSMMUP00000003249  ............................................................................
ENSMMUP00000020816  ............................................................................
ENSMMUP00000020813  ............................................................................
ENSMMUP00000018596  ............................................................................
ENSMMUP00000037704  ............................................................................
ENSMMUP00000023995  ............................................................................
ENSMMUP00000032343  ............................................................................
ENSMMUP00000023997  ............................................................................
ENSMMUP00000004541  ............................................................................
ENSMMUP00000022544  ............................................................................
ENSMMUP00000022546  ............................................................................
ENSMMUP00000040958  ............................................................................
ENSMMUP00000004490  ............................................................................
ENSMMUP00000016625  ............................................................................
ENSMMUP00000032352  ............................................................................
ENSMMUP00000032351  ............................................................................
ENSMMUP00000028763  ............................................................................
ENSMMUP00000020812  ............................................................................
ENSMMUP00000002210  ............................................................................
ENSMMUP00000004582  ............................................................................
ENSMMUP00000008751  vrasnpgqfesd................................................................
ENSMMUP00000008748  vrasnpgqfesd................................................................
ENSMMUP00000037313  vrasnpgqfesd................................................................
ENSMMUP00000008750  ............................................................................
ENSMMUP00000039187  ivrasnpgqfend...............................................................
ENSMMUP00000008560  ............................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045080 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Thecamonas trahens ATCC 50062
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Mouse Gut Community lean2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]