SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Spermadhesin, CUB domain alignments in Oreochromis niloticus 69_1.0

These alignments are sequences aligned to the 0043701 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                      10           20                       30          40          
                                       |            |                        |           |          
d1sppb_               ...aring-----PDECGRVI..KDTSG.SISNT....DRQ.........K..NLCTWTILMK..PDQKVRMAIPY..
ENSONIP00000019007  ........-------GCGGTF..TDSEG.IIISP....NWPnnynh....N..RQCIYLIRLP..EGGQVALNFTD..
ENSONIP00000019007  ........-------GCGDTL..TSPSG.TITSP....GHPssyph....G..ANCTWYISVS..PGNLIRLTFES..
ENSONIP00000020995  .......e--------CGGQK..IGPYG.YLASP....NHPgpyph....Q..QLCIWHISVE..EGHVITLSFRN..
ENSONIP00000017189  .......e--------CGGVL..TEQQK.IIQSP....GFPeeyed....E..QICYWHIRVR..LGQKIRLHFME..
ENSONIP00000004411  .......g--------CDHVI..NSVSG.TIASP....NWPdkyps....K..KACTWSLSTT..PGHRIKLIFNE..
ENSONIP00000014730  .......d-------------..---NG.QIQSP....NYPddyrp....N..KVCVWKISVA..QGFHVGLTFQS..
ENSONIP00000007433  ........--------CGGNI..TEESG.VIGSQ....GYPgvypp....N..TKCVWRITVP..EGKVVVLSFRF..
ENSONIP00000012734  .......i-------------..HSPSG.TLSSP....NWPdkyps....R..KECTWDITAT..PGHRVKITFNE..
ENSONIP00000023367  ........--------CGGIL..SAPSG.NFSSP....NFPdlypy....N..THCSWLIVVA..EGSSVLLTFHY..
ENSONIP00000012734  .......l-------------..QESTG.NFSSP....GYPngyp.....Sy.THCVWRISVT..PGEKIVLNFTT..
ENSONIP00000023367  ........------------L..TGLSG.VISSP....GYPqeysn....N..ADCSWAIHVS..NTSVVTLVFLD..
ENSONIP00000019007  ........-------GCGGDL..SGPSG.SFNSP....GYPnrypd....N..RECIWYITTS..AGSSITITIHE..
ENSONIP00000012734  ........--------CGGEI..TKDSG.QIQSP....NYPddyrp....S..KECVWRISVS..EGYNVGLSFQA..
ENSONIP00000019007  ........--------CGEEL..TAPYG.NINSP....GYPgnypp....S..RDCYWTVTVD..PGLLITFAFGT..
ENSONIP00000019007  ........-------GCGGTL..TTASG.AFSSP....NYPlpyhp....N..AECYWNIRTS..QGNKLLLSFSD..
ENSONIP00000004411  .......e-------------..---SG.QIQSP....NYPdeyqs....N..KECVWKITVA..EGFDVGLSFQS..
ENSONIP00000014730  .......g--------CDHTV..NSVSG.IITSP....NWPdkyps....K..KACTWALTTT..PGHRIKIAFNE..
ENSONIP00000019007  .......d-------------..--PPG.YITSP....NYPqnypq....N..IDCIWVITVP..NGEAVQIDFEDq.
ENSONIP00000019007  .......e--------CGGWQ..TGDSG.VLASP....DYPnlyps....P..SRCAWLLEAP..EGHTITLTFTY..
ENSONIP00000012734  ........--------CGGLL..SKLNG.TISTP....GWPkeypp....N..KNCVWQVVAP..TQYRISMQFEA..
ENSONIP00000019007  .......d--------CGQTF..TTPTG.SFSSP....NYPqyyp.....Ns.RDCIFKIIVD..VNMQIMLNFTD..
ENSONIP00000014730  .......l-------------..QDSSG.NFSSP....GFPngysa....Y..MHCIWRISVT..PGEKIILNFTS..
ENSONIP00000014730  ........--------CGGFI..TKLNG.SITSP....GWPreypp....N..KNCIWQLVAP..TQYRITLLFDV..
ENSONIP00000004411  .......l-------------..QDSSG.NFSSP....GFPngysa....Y..THCVWRISVT..PGEKIVLNFTS..
ENSONIP00000019007  ........-------------..TAPSG.EIHSP....LYPnsypn....N..VDCSWVISVD..PNHRVFLNFTD..
ENSONIP00000004411  ........--------CGGFI..TKLNG.SITTP....GWPkeypp....N..KNCVWQLVAP..IQYRITLVFDV..
ENSONIP00000002284  ........--------CGGRI..TKAQG.EIKTP....NWPdkkydp...G..TSCSWLITVD..PNMVIHVNFDK..
ENSONIP00000003482  ........-------PCGGNL..TGSNG.FILSP....NYPhpyph....S..KDCDWLIAVN..PDYVLSLAFIS..
ENSONIP00000005534  .......d--------CSRNF..TSPSG.LIESP....GFPdkyph....N..LECAFIIIVP..PRMDVTLTFLT..
ENSONIP00000011626  ........--------CGGRL..TKSQG.SVKTP....NWPnsnypa...G..ISCSWHISVE..PSNVIEVQFEK..
ENSONIP00000019007  .......s--------CGGDL..VMETG.AFNSP....NYPdaypp....N..VECVWTIRSS..PGNRIQLSFIT..
ENSONIP00000019007  .......a------QGCGGYL..SMPMG.MFGSP....DPNldgvyep..R..MDCLWTIEMP..VNKAVNLTFDS..
ENSONIP00000005907  ........-------PCGGNL..TGPSG.LILSP....DYPepyph....G..RECDWTVTVT..QDYVISLTFNQ..
ENSONIP00000018753  ......dg-------------..----G.TFSSP....NYPntypp....N..KECLYVLEAL..PRQRIELMFDEv.
ENSONIP00000015351  ........--------CFRNF..TSPSG.MIESP....GFPdkyph....N..LECSYMIIAP..PHMDITLTFLT..
ENSONIP00000011626  ........--------CGGHL..VTDSG.IVASE....GFPslykp....N..SKCTWYITVP..EDHVVMLSFRL..
ENSONIP00000004631  ......ta-------------..----N.YLTSP....GYPasypp....S..QRCVWVISAPg.PHQRILINFNPh.
ENSONIP00000018847  .......d-------------..-----.YLTSP....GYPsaypp....S..QQCVWVITAPe.AGQKILINFNPh.
ENSONIP00000009059  ........-------PCGGNV..TGSSG.FILSP....NYPhpyph....S..KDCDWLIAVH..SDYVISLAFIS..
ENSONIP00000020995  .......s--------CGGVL..TDTEG.SFSSP....NHPasypp....N..SLCVWVIQVL..PPYVVQIHVSS..
ENSONIP00000002284  ........--------CGGDM..VAESG.LVGSE....GFPsfykp....N..TKCTWRITVP..EGNVVTLSFRI..
ENSONIP00000007433  ........--------CGGRL..LKPSG.TFKTP....NWPekdypa...G..VTCSWHIVAP..KNQIIEVKFEK..
ENSONIP00000019007  .......s--------CSRTY..EQEYG.YLKSP....GWPdiypn....N..MDCTIILKAP..QSNYISFFFNN..
ENSONIP00000002907  .......e------------M..TGLYG.SFTSP....NFPqpypd....N..QHVVWNITVP..DGHRVKLYFTH..
ENSONIP00000019007  ........-------------..TGESG.QIASP....LYPrtypn....N..ADYHWTITVD..GDSYIQIRFLD..
ENSONIP00000003482  .......p--------CMSNF..TAPSG.TVLSP....DYPegygn....N..MNCVWLIQSD..PGSRIHLAFND..
ENSONIP00000019007  ........-------------..---SG.QFHSP....YHPnayph....N..KVCEWVINQP..EGYVVTLDFLS..
ENSONIP00000019007  .......e--------CGGEL..NAPSG.TISSP....NYPnlyph....S..RVCRWELVVS..PDRRITLTIND..
ENSONIP00000023367  ......ls-------------..-HVSG.NFSSP....NFPniypn....N..INCHWSITLA..AGYRIKLFFPL..
ENSONIP00000003482  .......i--PKCEAPCGGHY..SAPSG.VILSP....GWPgyykd....S..LNCEWVIEAE..PGRAIKITFDR..
ENSONIP00000006911  ........--------CGGVL..TEMSG.VILSP....GFPgnypg....N..LDCTWQITLP..TGYGAHIQFQN..
ENSONIP00000006911  ........--------CGGNV..SGPSG.VILSP....NYPqpypp....G..KECDWRIRVN..PDFVIALIFKS..
ENSONIP00000019007  ......ng-------------..----G.AIASP....RYPaqypp....N..QNCSWIIRAQe.PLNHVTLSFTD..
ENSONIP00000005907  .......v--PRCEAPCGGDL..KAPSG.IILSP....GWPelyke....A..LNCEWIIEAP..PGYPIKIIFDK..
ENSONIP00000009059  ........------------F..TAPMG.TVLSP....DYPegygn....N..LNCVWLIISE..PGSRIHLAFND..
ENSONIP00000003936  .......d--------CGTWI..RNINGgSFSSP....NYPnpypp....N..KECVYILEAL..PRQRIQLSFDKn.
ENSONIP00000006911  .......v--PRCEAPCGGHL..TAPTG.VLLSP....GWPsfykd....S..LNCQWVIEAQ..ADHAVKIHFDK..
ENSONIP00000005534  ......da-------------..----G.YITTP....GYPleypp....H..QNCRWVITAPe.PSQRIVLNFNPh.
ENSONIP00000018033  .......g-------------..----G.LFTSP....NYPnkypp....D..TECVYILEAP..PRQCIDLHFEEn.
ENSONIP00000015351  .......a-------------..----G.YITSP....GYPleypp....H..QNCHWIITAPe.PSQRIVLNFNPh.
ENSONIP00000005907  .......p---SCIVPCGGNL..TQRTG.TILSP....GFPepyln....G..LNCVWKITVP..EGSGIQIQVIS..
ENSONIP00000006911  ........-------PCSGNL..TERRG.TILSP....GYPepyp.....Nt.LNCLWRIHVS..EGAGIQIQVMT..
ENSONIP00000009059  .......p---KCEAPCGGHY..SGPSG.VILSP....GWPgyykd....S..LSCEWVIEAE..LGRSIKISFDR..
ENSONIP00000018343  .......d-----CMKCGGVI..HKRQG.HLVLE....SYPn........N..ARCEWTIQVD..RPFTIELRFMM..
ENSONIP00000003482  ........-------PCGGVL..TSRRG.TILSP....GYPepydn....N..QNCVWKVSVP..EGAGIQIQVVS..
ENSONIP00000000681  ........-------------..---SG.TFSSP....NYPsyyhd....N..AYCMWQLRAA..YDQRIFLQFTF..
ENSONIP00000006911  .......s--------CFFNF..TAPSG.TVLSP....NYPeeygn....N..LNCVWLIISE..PGSRIHLLFSD..
ENSONIP00000007446  .......d-----CKTCGGVI..QRAQG.HIALE....SYPt........N..ARCEWIVQME..RGSSIQLRFSL..
ENSONIP00000003482  ........--------CGGTV..RGGSG.VVTSP....GYPgnyg.....Nq.ADCTWILLAE..PGDTISVIFTD..
ENSONIP00000019007  ........-------PCGGFF..NSTAG.TVSSP....GLSmtnyhh...N..INCTYHIWVQ..ANRVVDLKFNT..
ENSONIP00000009059  ........-------QCGGSM..TDFSG.VILSP....GFPgnyqs....S..LDCSWRVQLP..IGFGIHLQFLN..
ENSONIP00000019007  .......e-------------..--TPG.FLYSP....GWPenypp....N..QECTWLIHSP..-DSTVELTILS..
ENSONIP00000005907  ........-------QCGGIR..EEMEG.MILSP....GFPgnyps....N..SDCTWRIYLP..VGYGAHIQFLN..
ENSONIP00000021992  ...cgapq-----------EL..SGESG.TFTSA....NYPssyds....G..QSCAWHITVD..PEKVIHLWFEE..
ENSONIP00000009059  .......v--PTCVVPCGGVL..TERKG.TILSP....GYPdpya.....Ny.LNCAWKISVP..EGAGIQIQVVT..
ENSONIP00000003482  ........-------HCGGSM..ADVSG.VILSP....GYPgnyps....G..LDCTWTVNLP..VGFGIHLQFLN..
ENSONIP00000003482  .......p---RCEALCGGNI..TSLNG.TIYSP....GHPeeyp.....Nf.QDCVWSVRVP..PGHGIYINFTV..
ENSONIP00000005907  ........-------NCSYTL..HNPNG.TIESP....GYPygyp.....Ny.ANCTWVIVAA..EHNRIQLVFQG..
ENSONIP00000019007  .......h-------------..---RG.VIESL....NFPnnypd....N..SQCSWTIQAS..GGNTVNYTFTA..
ENSONIP00000005907  ........-------GCGGTL..RGQSG.VITTP....NYPseynn....N..ADCTWTVLAE..PGDTIALVFSD..
ENSONIP00000022432  .......l-------------..WEPNS.TFNTP....NYPesygn....G..AECLWTLHAL..EGHNIQLHFLD..
ENSONIP00000011349  .......g-------------..----G.YFTSP....NYPekypp....E..RECIYIIEAS..PRQCIDLFFDEk.
ENSONIP00000016272  .......q-------------..--MYG.EVQSP....LYPqpypp....N..LQEQWDLAVP..EGYQIRLTFTH..
ENSONIP00000019303  .......l-------------..RASSG.IITSP....GWPfqypa....R..MNCSWNIRAR..PGDAITISFQD..
ENSONIP00000021764  .......l-------------..SGMYG.SLRSP....NFPepypr....E..TQLRWNISVP..DGFRIKLYFSH..
ENSONIP00000009059  .......s--------CGGTL..KGRNG.TIESP....GFPygypn....G..ANCTWVIVAE..EGNRIHIVFQS..
ENSONIP00000005907  .......s--------CFFNF..TTPSG.VLLSP....NYPqeygn....N..MHCVWLIITN..PESRINLAFND..
ENSONIP00000005907  ........--------CGGLL..RGPSG.VITSP....NYPvqydn....N..ANCTWVITATd.TSKVIKLTFED..
ENSONIP00000006911  ........--------CGGTL..RGTAG.SITSP....GYPaeydn....N..LDCTWSILAE..PGDTIALVFND..
ENSONIP00000003482  ........--------CGGTL..KGRNG.SIESP....GFPygypn....G..ANCTWVIVGE..EGSRIQLIFLS..
ENSONIP00000023649  ........-------NCNLVL..TESQG.EITSP....CYPqryp.....Ns.YNCRWIMKAP..AGFIIQLSFLD..
ENSONIP00000004631  .......e--------CSRNF..TSNSG.IIKSP....GFPekypn....N..LDCTFMIFAP..KMSEIILEFES..
ENSONIP00000018847  .......e--------CSRNF..TAPSG.VIKTP....GFPekypn....N..LECTFMIFAP..KMTEIVVEFDS..
ENSONIP00000021992  .......g--------CGGPKelTGTGG.TLSSM....GYPgtys.....Nt.AQCQWNIQVP..EGKSVHLHFHN..
ENSONIP00000014730  .......n-------------..-----.-----....NYPg........A..SDCEWVISAE..KGYGVELIFQT..
ENSONIP00000004411  .......n-------------..-----.-----....NYPg........G..SDCLWVVTAE..KGYGVEIIFQV..
ENSONIP00000019007  ........--------CGGYL..TGPAG.SFSYP....NTPghdeydh..E..VSCAWVIHTD..ANKILRITFPF..
ENSONIP00000019007  ........-------GCGGTL..FGDQG.SFASP....NYPgtypn....N..THCEWSIMAP..RGRVVTVTFNQ..
ENSONIP00000009059  .......p---RCEALCGGNI..TSMNG.TIYSP....GHPaeyp.....Hf.QDCMWTVRVP..PGYGIYINFSV..
ENSONIP00000012734  .......n-------------..-----.-----....NYPg........H..TDCEWLLTAE..QGYGIELSFIT..
ENSONIP00000021992  .......g--------CGFSS..KEETG.VIKSQ....DWPmnykp....N..TECMWNIDVP..SGKKITLTFTH..
ENSONIP00000006911  .......p---RCEAPCGYNV..TAENG.TIYSP....QYPneyp.....Ns.QDCSWLITVP..HGHGVYINFTL..
ENSONIP00000019007  ........-------GCGGLL..HVDRG.VMSSP....NYPqnyrp....G..LDCSWHVMVT..PGFRISVTFQTp.
ENSONIP00000013820  ......gc---------GTLVl.VEDKA.SIHSP....NHPqaysn....D..CVLRWVIHAP..LGHVVKLEFTD..
ENSONIP00000021992  ........-------PCGGTF..SSDQG.EITSP....NWPndyqt....Q..TVCTWRINIP..SSRIIHVAFTH..
ENSONIP00000019007  ........--------CGGTY..IGQRG.VIYSP....GFPgsnypd...S..SSCEWYLEGP..TGHYLTLSYGN..
ENSONIP00000003485  .......k--------CGGSL..SQKEG.NFTSP....LYPsfypp....R..KNCSWTITVA..PGSKVRLRFTM..
ENSONIP00000003482  .......l--PSCIAECGGRFk.GESSG.RILSP....GYPfpydn....N..LRCTWTIEVD..SGNIVSLQFLA..
ENSONIP00000009059  ........--------CGSNL..QGPSG.TFTSP....NFPiqyes....N..SQCVWIITASd.PNKVIQINFEE..
ENSONIP00000019007  ........--------CGANF..TADSG.RVVSP....NYPadyps....R..ANCNYTIDAG..EKTVVILTFQT..
ENSONIP00000005907  .......e--------CGGTIk.DEPSG.RVLSP....GYPapyeh....N..LHCMWTIEAA..PGSTISLHFLV..
ENSONIP00000021992  .......l-------------..QGDQG.NLMTP....GFPeqnyp....Ng.ALYQWRITVP..EGETVRLTFTS..
ENSONIP00000002907  .....cqs----------QVL..TSPSG.VLTSP....GYPnpyp.....Pm.SRCNHTIRLP..EGSRIILNFLEt.
ENSONIP00000006911  ........--------CGSNL..RGPRG.VITSP....NYPvqyen....N..AHCVWVITAMd.ADKVIKLSFEE..
ENSONIP00000021764  ....cssd-----------VF..RERSG.VLSSI....DFPapypk....S..CECSYRIEVE..DGFRLHLQFDSr.
ENSONIP00000003482  .......d-------------..--SSG.VILSP....GWPesyp.....Nl.QMCSWSVTVE..KGYNVTITFES..
ENSONIP00000006911  .......e--------CGGHIt.GAVSG.RILSP....GYPapydn....N..LHCTWTIEAD..TGKTISLHFIV..
ENSONIP00000005907  .......e--------CGSSV..TGMQG.VLLSP....NYPgyygn....N..HECIYSIQTQ..PGKGIQLRARD..
ENSONIP00000003482  ........--------CGSNL..QGPSG.TFTSP....NFPiqyen....N..AQCVWIISASn.PNKVIQINFEE..
ENSONIP00000009059  .......d-------------..--STG.VILSP....GYPdnyp.....Nl.QMCSWLINVE..KGYNITLHFEL..
ENSONIP00000018445  ........-------NCGGTL..TGEKG.SISSP....FFPsnypp....R..TTCVWNIEVA..NNKFLKVLFNK..
ENSONIP00000008477  .......g--------CGHTLl.APESG.TLASQ....NYPgtyps....N..TWCKWRLRVP..QGRTLRLLFGD..
ENSONIP00000008443  ......gp-------------..--ESG.TLSSL....GYPrtypn....N..TVCEWEISVP..RDKRIHFLFAL..
ENSONIP00000006911  .......s-------------..--SSG.VILSP....GFPsnyp.....Ns.QTCSWLLRMI..PGYTINIYVEM..
ENSONIP00000006911  ........-------------..-GPEG.VLLSP....NFPsnynn....N..HECIYRITTE..KGKGIRLKAES..
ENSONIP00000003931  .cseqvei------------H..TERRG.VIYSP....SWPlnypp....G..VNCSWHIQGG..QGEVITISFRN..
ENSONIP00000009059  .......l--PSCIAECGGSFk.GESTG.RILSP....GYPfpydn....N..LRCTWTIEVN..SGNIVSLQFLA..
ENSONIP00000003482  .......e--------CGSSV..INNEG.ILLSP....NYPmnydn....N..HECIYSIQVQ..AGKGINISART..
ENSONIP00000005907  ........-------PCGGNI..TSDNG.TIFSP....GYPeeyps....S..ADCSWLITVA..PGFGIKLNFSL..
ENSONIP00000013251  ........--------CGGNY..TSPSG.VIYSP....DFPdkyga....G..RVCYWTIQVP..GSSAILFNFTF..
ENSONIP00000006405  ......qg-------------..----G.VIHSP....RYPnaypr....N..LLLSWKLLSP..PGSRIHLEFDGh.
ENSONIP00000009059  .......e--------CGSTV..SNNEG.VLLSP....NYPmnyd.....Ns.HECVYSIQVQ..TGKGINITAST..
ENSONIP00000019303  ........--------CGELL..RNFYG.SFSSP....NYPdfypp....G..SNCTWLIDTG..DHRKVILRFTD..
ENSONIP00000009059  ........--------CGGTL..RGSSG.LISSF....DFPsglgs....S..GECKWTILAD..PGDTISLVFTE..
ENSONIP00000005907  ........--------CGGYI..QGNAG.TILSP....GFPdfyph....N..LNCTWIIETS..HGKGVQFTFHT..
ENSONIP00000009059  .......s--------CGGDI..RGPGG.IILSP....GYPelyp.....Ns.LNCTWTVEVS..HGKGVQFTFHS..
ENSONIP00000006911  .......p---SCDALCGGYV..YGKTG.TILSP....GFPdfyp.....Ns.LNCTWTIEVS..HGKGVHLVFHT..
ENSONIP00000014407  .tgackgh---------RQVL..RGPPG.YVTDGag..NYSv........N..GNCEWLIKAPs.NSHRIVLNFTF..
ENSONIP00000003485  ......tn-------------..---PQ.NFSSP....GYPtsypp....K..SRCQWQIRAS..EENVIIVNFLY..
ENSONIP00000005130  ........--------CGEKL..IGSKG.NFSSP....NHPnyypp....K..ITCEWLIEVP..AGKVVKLVFKK..
ENSONIP00000003482  ........--------CGGDV..RGPWG.TILSP....GYPdsyps....S..LNCTWTVEVS..HGKGVQFQFNS..
ENSONIP00000017799  ........-------GCGGSI..SSWNG.SISSP....YYPsyypp....N..IDCIWTLRVPl.PGYLISVTIVT..
ENSONIP00000019007  .......e--------CGGILn.NPDGG.NFTSP....GYLvsnysn...N..INCEWLIQNPqhINSSIVVLIED..
ENSONIP00000018792  ........--------CGGEL..TEPSG.TILSP....DWPqsysk....G..LDCMWQIHGN..EEKRIELDVQI..
ENSONIP00000007669  ......lg-------------..-DFTG.YIESP....NYPgnypa....N..IECTWIINPP..PKRRILIVVPE..
ENSONIP00000013820  ......gp------------V..SDING.VIKNP....RLHgdrydn...N..QLCLWSISVP..PGYSILLEFDL..
ENSONIP00000009059  ........-------PCGGHF..TGSEG.TVLSP....NYPhnyti....G..QTCVYDIFVP..GDFVLFGQFVV..
ENSONIP00000016272  .....scg---------GGIF..DEPEG.HLFSP....GYPnhpph....A..VSCQYVISVQ..EGFTITLNFTDn.
ENSONIP00000014378  ........-------QCGGDL..SGPGG.LILSP....NWPewyge....G..EDCSWRIHVG..EDKRVLLDVQL..
ENSONIP00000001495  ........-------------..---EG.MVHSP....DFPhtypr....N..TVLVWRLVAS..SNMRIQLTFDEr.
ENSONIP00000005907  .......k--PICIAPCGGQY..SGTEG.VVLSP....GYPgnyss....A..RTCLYSVVVP..KDYVVFSQFAF..
ENSONIP00000015104  ......lg-------------..-EYTG.YIESP....NYPgdyps....N..VDCVWMINPP..HKRRILIVVPE..
ENSONIP00000006911  .......l--PSCKAPCGGQY..GGSEG.VVLSP....NYPlnytt....K..QTCSYYITVS..PQFVVFGQFAV..
ENSONIP00000015493  ........--------CGGRFrlTGPSG.YLTDGpg..NYKy........K..TKCTWLIEGQ..PNTILRLRFNH..
ENSONIP00000019007  ........-------GCGGVI..HADAG.TIKSP....NYPqnfpa....N..VECTWKIIAH..EGNHLEMSFSSd.
ENSONIP00000005907  scdvtcpm---------NEIL..TASTG.VIMSQspgnGFP.........Hf.ESCSWVVKVE..PGYNITFTIEH..
ENSONIP00000002442  .......s--------CGGMIk.NATYG.RIVSP....GFPgnysn....N..LTCHWVLEAP..EGHRLHVHFEK..
ENSONIP00000010465  ........------------I..TDSAG.VVLSP....NWPesydk....G..QDCIWGIHVE..EDKRIMLDIQV..
ENSONIP00000003482  ........-------PCGSRS..TGSEG.TVLSP....NFPrnyts....G..QTCVYSISVP..REFVLFGQFVL..
ENSONIP00000002442  ........------------I..TDSAG.VVLSP....NWPeaydk....G..QDCIWGIHVE..EDKRIMLDIQV..
ENSONIP00000021992  .....dgr-------------..---KG.DLQSS....GFPnpypa....H..LNNSWEISVS..KGFLVKLEITD..
ENSONIP00000005130  ......vd-------------..--YIG.RIQSP....GFPdspypp...N..TFIQWQLRAD..PGYVVKLEFGT..
ENSONIP00000021427  ........-------QCGGEM..GEFMG.YIESP....NYPgnypa....N..VECIWNINPP..SKRKILIVVPE..
ENSONIP00000018445  .......n-------------..---SG.HVESP....GFPnspyps...N..AYLQWKFRAD..PQHRIQLDFDD..
ENSONIP00000022432  .......l----CATACDGQFvlRGPIG.LFSSS....KSDkyns.....S..SFCRWIIRVD..DGLSVQVTFPQ..
ENSONIP00000010465  ........--------CGGLVr.NITVG.RIVSP....GFPsnysn....N..LTCHWLLEAP..EGQRLHIHFEK..
ENSONIP00000020660  ........-----CQHCQGRFklTEPSG.YLTDGpi..NYKy........K..TKCTWLIEGY..PNAVLRLRFNH..
ENSONIP00000019007  .....svv-------------..----Q.TVTSP....FFPneyp.....Py.TSCRWILDAP..ALETIKMSIQT..
ENSONIP00000001940  .......c------QHCQGRFklTDLSG.SLTDG....PFNyky......K..TKCTWLIEGF..PNAVLRLRFNH..
ENSONIP00000018753  .......p-----IPDCQFEL..SGADG.VIRSS....QVDeeykvkpdqA..VDCIWTIRAP..TKNRIYLRFLE..
ENSONIP00000003936  .......p-----IPECQFNV..GGWDG.IIHSS....QVEeekrvkpgdA..LDCIWTIKAP..SQSKIYLRFID..
ENSONIP00000018033  .......l------PSCQYDM..VGPEG.IVESH....QITrdgkagateA..VDCKWYIRAP..PRSKIYLRFLD..
ENSONIP00000011349  .......p-------FCEFEM..NGPEG.YVDST....QIAkegraqqteA..VDCRWYIRAP..PRAKIYMRFLE..
ENSONIP00000014378  .......p---VCRALCGGTVk.NATVG.RVLSP....SPHhgpnatl..D..RSCSWSLEAP..KDQRLHLHLER..
ENSONIP00000018792  ......va------VSCGGWIr.NATVG.RILSP....PPPsvsnhsngnN..LSCHWLIEAK..EGHRLHLHFER..
ENSONIP00000017391  .......s-------------..-GVQG.TLKTP....FFPsyypp....D..TNCTWSFTMPs.AGMGLCLTFEG..
ENSONIP00000003931  ......pd------TTCGKRL..GNFYG.SFASP....DFFranrsget.E..LRCSWLLDTQ..DPKPIVLQL-D..
ENSONIP00000018792  ......hm-----PVQCNATL..LAMED.VVESP....DPAasssfs...P..LECTYSITVY..AGYGVEIQVRK..
ENSONIP00000015672  .......r-------SCHRLL..YSDSG.EFFSP....DYLcsnp.....P..LWCNWTIQVD..PSKRIHLYLED..
ENSONIP00000000681  ........-------------..-----.-----....---.........N..SDCIWYIR-P..GNQIIQLELSD..
ENSONIP00000014378  .......s-------SCMVIF..TDPEG.YIDSS....DDPplpd.....GtfLRCTYTVTVY..TGYGVELQVKS..
ENSONIP00000013744  .......h------QDCDIQL..FSPSG.VFENP....ITSst.......N..HTCRVLINAP..PSVKIRIQALH..
ENSONIP00000017806  .....swg-------------..-----.-----....---.........G..INCHVKLTAV..PGSLIRLTITS..
ENSONIP00000017799  ....kpyy-------------..-----.-----....---.........-..---QWRLRVP..SGHVVRLVVLT..
ENSONIP00000017391  vvssspvl-------------..-----.-LRGP....NTQ.........R..SSCLWHLQTT..PGSQLELHMEW..
ENSONIP00000018178  ...lrcld------------M..LATDG.LFTFV....ASKp........Q..LACAAFIIAE..PSEVISLELSD..
ENSONIP00000022615  ........----CDCPCGGLL..QTFYG.TFSPP....GCQgq.......S..KSCVWTLDPQ..DSRPLRLELQK..
ENSONIP00000005842  ......df--------CGQTI..QGDGM.IINSH....QESkkyyfvim.G..TDCHLTMQASs.PKDKVQFYFRF..
ENSONIP00000002442  ........-------PCSLNF..TDPEG.NIEIL....QQVds.......G..VECNYLITVY..LGYGIEVQVLN..
ENSONIP00000019441  ..rrplrc----------LDM..VAVEG.QFTFTa...ERP.........Q..LSCAAFFMAE..PNEVISVDYDS..
ENSONIP00000017806  ......rd-------------..-----.RIYSP....FYPsmlpp....Q..CSCTWKFKTQn.STLGVALHFHN..
ENSONIP00000008581  .......s-------------..---SS.ELLSP....DYPesfpd....D..DIMGWYFRVP..EKHRVDVQFLN..
ENSONIP00000022615  ........-------------..-----.-----....---.........-..----WIITGP..EDEPIVLSFSQ..
ENSONIP00000014407  .......s-------------..-----.-----....---.........-..-HCLWVLSVT..ENLAPCLPRQFcp


                       50                                                   60                      
                        |                                                    |                      
d1sppb_               .LNLA.........................................C..GKEYVEV......................
ENSONIP00000019007  .MDLEshsg.....................................C..AFDYVEV......................
ENSONIP00000019007  .FNLEyhtn.....................................C..NFDYLEV......................
ENSONIP00000020995  .FSLEtqdv.....................................C..EFDYVEV......................
ENSONIP00000017189  .FDVEddte.....................................C..LADYLEV......................
ENSONIP00000004411  .VDMEahle.....................................C..AYDHLEI......................
ENSONIP00000014730  .FEIErhds.....................................C..AYDYLEV......................
ENSONIP00000007433  .IDLEndnl.....................................C..RYDYVDV......................
ENSONIP00000012734  .FEIEqhqe.....................................C..AYDHLEA......................
ENSONIP00000023367  .FELEyhas.....................................C..AYDYIKI......................
ENSONIP00000012734  .MDLYkssl.....................................C..WYDYIEV......................
ENSONIP00000023367  .FQLEnneg.....................................C..NFDFVAL......................
ENSONIP00000019007  .FDVEyhqd.....................................C..NYDVLEV......................
ENSONIP00000012734  .FEIErhds.....................................C..AYDYLEV......................
ENSONIP00000019007  .LSLEhhpn.....................................C..NFDFLEI......................
ENSONIP00000019007  .FHLEsnan.....................................C..YYDYVAV......................
ENSONIP00000004411  .FEIEkhds.....................................C..AYDYVEV......................
ENSONIP00000014730  .IDMEahle.....................................C..AYDHIDI......................
ENSONIP00000019007  .FYIEptss.....................................C..MYDYLEL......................
ENSONIP00000019007  .FNLEshnt.....................................C..GWDSLTI......................
ENSONIP00000012734  .FELEgnev.....................................C..KYDYVEV......................
ENSONIP00000019007  .FELEglhps....................................C..SFDFVEI......................
ENSONIP00000014730  .MDLYrshl.....................................C..WYDHVEI......................
ENSONIP00000014730  .FETEgndv.....................................C..KYDYVEV......................
ENSONIP00000004411  .MDLFrshl.....................................C..WYDHVEV......................
ENSONIP00000019007  .LDIEyhss.....................................C..DFDY--I......................
ENSONIP00000004411  .FETEgndv.....................................C..KYDFVEV......................
ENSONIP00000002284  .FALEdday.....................................C..RFDYVAF......................
ENSONIP00000003482  .FNIE.........................................P..NYDFLYI......................
ENSONIP00000005534  .FDLEndplpggdgd...............................C..KYDWLEV......................
ENSONIP00000011626  .LDLEpdmy.....................................C..RYDYVAL......................
ENSONIP00000019007  .FQLQgdsd.....................................C..QNDYLEI......................
ENSONIP00000019007  .FELEtstt.....................................C..RYDYVRV......................
ENSONIP00000005907  .FSLE.........................................P..SYDFLHI......................
ENSONIP00000018753  .FHIEasfe.....................................C..RFDHIEV......................
ENSONIP00000015351  .FDLEndpllvgegd...............................C..KYDWLDV......................
ENSONIP00000011626  .FDLEadpi.....................................C..RYDYLDV......................
ENSONIP00000004631  .FDLEdre......................................C..KYDYVEV......................
ENSONIP00000018847  .FDLEdrd......................................C..KYDYVEV......................
ENSONIP00000009059  .FSIE.........................................P..NYDFLYI......................
ENSONIP00000020995  .LTVEgpsp.....................................C..LFDWVEV......................
ENSONIP00000002284  .FDLEadsq.....................................C..RYDYLDV......................
ENSONIP00000007433  .FDVErdny.....................................C..RYDHVSI......................
ENSONIP00000019007  .FDVEshtd.....................................C..QFDYLEI......................
ENSONIP00000002907  .FSMElsdq.....................................C..EYDYIQV......................
ENSONIP00000019007  .MDIEdlyd.....................................C..YYDHLKI......................
ENSONIP00000003482  .FDLE.........................................A..PYDSLTV......................
ENSONIP00000019007  .FDVEggs......................................C..RYDYVEV......................
ENSONIP00000019007  .LRLEgsdts....................................C..IFDYVDV......................
ENSONIP00000023367  .MDLEdrnslsde.................................C..DYDSVTV......................
ENSONIP00000003482  .FQTE.........................................L..GYDFLEI......................
ENSONIP00000006911  .FSSE.........................................D..NHDFLEV......................
ENSONIP00000006911  .FNME.........................................P..SYDFLHI......................
ENSONIP00000019007  .FDLErifan....................................C..SHDFLEI......................
ENSONIP00000005907  .FRTE.........................................V..NYDVLEV......................
ENSONIP00000009059  .FDLE.........................................P..PYDFLTI......................
ENSONIP00000003936  .YYIEpsfe.....................................C..RFDHIEI......................
ENSONIP00000006911  .FQTE.........................................V..NYDTLEI......................
ENSONIP00000005534  .FEIEkld......................................C..RYDYVEI......................
ENSONIP00000018033  .YSIEsswe.....................................C..KFDNIEV......................
ENSONIP00000015351  .FEIErld......................................C..KYDFIEI......................
ENSONIP00000005907  .FVTE.........................................Q..NWDSLEV......................
ENSONIP00000006911  .FATE.........................................H..NWDSLEI......................
ENSONIP00000009059  .FQTE.........................................L..SYDFLEV......................
ENSONIP00000018343  .LSLEfhhs.....................................C..HYDYVEV......................
ENSONIP00000003482  .FATE.........................................H..NWDSLDF......................
ENSONIP00000000681  .LQLEdc.......................................C..SCDYIEI......................
ENSONIP00000006911  .FDLE.........................................P..QFDWLVV......................
ENSONIP00000007446  .LSLEsdhs.....................................C..RYDYVEV......................
ENSONIP00000003482  .FQTE.........................................E..KYDYLEV......................
ENSONIP00000019007  .FHLEasss.....................................C..QFDSVAV......................
ENSONIP00000009059  .FSTE.........................................P..VHDYLEI......................
ENSONIP00000019007  .LDIEdsht.....................................C..YFDSVVV......................
ENSONIP00000005907  .FSTE.........................................A..NHDFLEI......................
ENSONIP00000021992  .FTLEdtql.....................................C..TADFITL......................
ENSONIP00000009059  .FATE.........................................H..NWDSLDF......................
ENSONIP00000003482  .FSTE.........................................A..IHDYLEI......................
ENSONIP00000003482  .LSTE.........................................P..IYDYITV......................
ENSONIP00000005907  .FALE.........................................E..DFDILSV......................
ENSONIP00000019007  .FQLEassaa....................................C..TFDYIKL......................
ENSONIP00000005907  .FQLE.........................................D..DYDLLEV......................
ENSONIP00000022432  .FDIE.........................................A..SSDMVEV......................
ENSONIP00000011349  .YSIEpswe.....................................C..KFDHIEV......................
ENSONIP00000016272  .LDIEasan.....................................C..YYDSLTV......................
ENSONIP00000019303  .FDLQgshr.....................................C..TSDWMSI......................
ENSONIP00000021764  .FDLEpsyl.....................................C..EYDYVKV......................
ENSONIP00000009059  .FAVE.........................................E..EYDFLSL......................
ENSONIP00000005907  .LSME.........................................K..QFDFLSI......................
ENSONIP00000005907  .FDLE.........................................R..GYDTLTV......................
ENSONIP00000006911  .FLLE.........................................D..KYDFLEI......................
ENSONIP00000003482  .FAIE.........................................E..EYDFLSL......................
ENSONIP00000023649  .FELEeapg.....................................C..IYDWVKV......................
ENSONIP00000004631  .FELEpdptpptgvf...............................C..RYDRLEI......................
ENSONIP00000018847  .FDMEpdttpppgal...............................C..RYDWLEI......................
ENSONIP00000021992  .FSLEesdl.....................................C..LNDKVRL......................
ENSONIP00000014730  .FEIEeead.....................................C..GYDYMEL......................
ENSONIP00000004411  .FEIEeead.....................................C..GYDYVEL......................
ENSONIP00000019007  .FDLEnsan.....................................C..NFDFLQI......................
ENSONIP00000019007  .ISIDdpgd.....................................C..QNNFLKL......................
ENSONIP00000009059  .INTE.........................................P..IYDYITV......................
ENSONIP00000012734  .FEVEeead.....................................C..GYDYIEL......................
ENSONIP00000021992  .FDLEakdalts..................................T..CYDNIMV......................
ENSONIP00000006911  .LQTE.........................................P..VTDYIAV......................
ENSONIP00000019007  .FQIQgygtg....................................Cs.TGDYLEL......................
ENSONIP00000013820  .FDLEeser.....................................C..LYDSLTV......................
ENSONIP00000021992  .FELQavnllg...................................N..CVDYVEV......................
ENSONIP00000019007  .FSLQntdg.....................................C..SADYVEI......................
ENSONIP00000003485  .FRMKepgvdtrf.................................C..HKDYVEI......................
ENSONIP00000003482  .FDTE.........................................A..SHDMLKV......................
ENSONIP00000009059  .FDLE.........................................I..GYDSLTI......................
ENSONIP00000019007  .FQVEahst.....................................C..LYDGLKI......................
ENSONIP00000005907  .FHTE.........................................E..VHDVLRI......................
ENSONIP00000021992  .FDLVpe.......................................A..CGDFVQV......................
ENSONIP00000002907  .FDIEghpqap...................................C..PYDMLKI......................
ENSONIP00000006911  .FDLE.........................................R..GYDTLTV......................
ENSONIP00000021764  .FDVEdhpdvs...................................C..PYDYIKI......................
ENSONIP00000003482  .FHTE.........................................R..EFDVLEI......................
ENSONIP00000006911  .FDTE.........................................V..GHDILRV......................
ENSONIP00000005907  .FRLE.........................................-..EDDILKV......................
ENSONIP00000003482  .FDLE.........................................I..AYDTLTI......................
ENSONIP00000009059  .FQTE.........................................K..EFDILEI......................
ENSONIP00000018445  .FSLGnkteg....................................C..GHDYVEI......................
ENSONIP00000008477  .FDVEsspg.....................................C..SFNYLLI......................
ENSONIP00000008443  .LDIEdsd......................................C..QVNYLRL......................
ENSONIP00000006911  .FHSE.........................................K..QFDELEI......................
ENSONIP00000006911  .FSLQ.........................................-..DGDNLKV......................
ENSONIP00000003931  .FDLAesgk.....................................C..MGDWLLL......................
ENSONIP00000009059  .FDTE.........................................A..SHDILKV......................
ENSONIP00000003482  .FHLA.........................................-..QGDILKI......................
ENSONIP00000005907  .LQVH.........................................G..PHDFITV......................
ENSONIP00000013251  .FDIS.........................................D..QTDMVEL......................
ENSONIP00000006405  .FGLEeaengm...................................C..RYDFVEV......................
ENSONIP00000009059  .FELA.........................................-..QGDVLKL......................
ENSONIP00000019303  .FKLDgt.......................................G..YGDYVKV......................
ENSONIP00000009059  .FQME.........................................E..KSDYLEI......................
ENSONIP00000005907  .FHLE.........................................S..PHDHLLV......................
ENSONIP00000009059  .FHLE.........................................D..HHDYLLI......................
ENSONIP00000006911  .FHLE.........................................E..NHDYLSI......................
ENSONIP00000014407  .MDTE.........................................C..TYDYLFV......................
ENSONIP00000003485  .FYIEdd.......................................C..SDDFVYI......................
ENSONIP00000005130  .LLLSqlgkkntn.................................C..DKDYVEV......................
ENSONIP00000003482  .FHLE.........................................D..QHDYLLV......................
ENSONIP00000017799  .MDIQdspssdg..................................C..EKDWLDV......................
ENSONIP00000019007  .LHLEdhqt.....................................C..EADYLQF......................
ENSONIP00000018792  .LNIR.........................................-..HTDVLTI......................
ENSONIP00000007669  .IYLPied......................................E..CGDYLVM......................
ENSONIP00000013820  .FDLEndsy.....................................C..RYDRLTV......................
ENSONIP00000009059  .FQTL.........................................-..ISDVVEI......................
ENSONIP00000016272  .FHIEsmdspegpq................................C..LHHWLEL......................
ENSONIP00000014378  .LNIS.........................................-..DSDMLTI......................
ENSONIP00000001495  .FGLEdpedgi...................................C..KYDFVEI......................
ENSONIP00000005907  .FQTA.........................................-..LNDIVEV......................
ENSONIP00000015104  .IFLPied......................................E..CGDVLVM......................
ENSONIP00000006911  .FQTA.........................................-..MNDSVEL......................
ENSONIP00000015493  .FATE.........................................C..SWDHLYV......................
ENSONIP00000019007  .FEIPdsagt....................................C..ESSYIKV......................
ENSONIP00000005907  .FQTS.........................................R..QFDELEI......................
ENSONIP00000002442  .VALA.........................................E..DDDRLLI......................
ENSONIP00000010465  .LNIG.........................................-..KNDLLTF......................
ENSONIP00000003482  .FQTS.........................................-..LNDVVEI......................
ENSONIP00000002442  .LHLG.........................................-..KNDLLTF......................
ENSONIP00000021992  .LAITgetgm....................................C..KEDKLII......................
ENSONIP00000005130  .FELEes.......................................C..ENDFIKI......................
ENSONIP00000021427  .IFLPsed......................................E..CGDVLVM......................
ENSONIP00000018445  .LILEdd.......................................C..QRDFIKI......................
ENSONIP00000022432  .FETE.........................................E..NSDTLRL......................
ENSONIP00000010465  .VALA.........................................E..DDDRLLI......................
ENSONIP00000020660  .FATE.........................................C..SWDHMYV......................
ENSONIP00000019007  .FVLQpdqs.....................................C..STNYLEL......................
ENSONIP00000001940  .FATE.........................................C..SWDHMYV......................
ENSONIP00000018753  .YQMEnsne.....................................C..KKNFVAV......................
ENSONIP00000003936  .YQMEhsne.....................................C..KKNFVAV......................
ENSONIP00000018033  .YEMAnsne.....................................C..KRNFVAV......................
ENSONIP00000011349  .YEMHnsne.....................................C..KRNFVGI......................
ENSONIP00000014378  .LALG.........................................-..PTDRLVL......................
ENSONIP00000018792  .IALD.........................................E..DDDKLIV......................
ENSONIP00000017391  .YELSrasynqa..................................C..TQGQWVI......................
ENSONIP00000003931  .LQLG.........................................-..PGDLLHI......................
ENSONIP00000018792  .ANLS.........................................-..KDESLTI......................
ENSONIP00000015672  .LTPDdi.......................................CnlKQDQIHI......................
ENSONIP00000000681  .VNVNhste.....................................C..GYDYVYV......................
ENSONIP00000014378  .VNLS.........................................-..DGEQLSI......................
ENSONIP00000013744  .IGLVfnttn....................................S..QSTYITI......................
ENSONIP00000017806  .FVIEpsd......................................C..VNDALTV......................
ENSONIP00000017799  .LHGAtpgs.....................................C..TAHKLSA......................
ENSONIP00000017391  .LLPE.........................................-..CSDRLLV......................
ENSONIP00000018178  .VSID.........................................Cs.AGDFIKI......................
ENSONIP00000022615  .LTLA.........................................-..FEDRLTV......................
ENSONIP00000005842  .FLVYsllrvaplspapvlpespsphgsaplsprlqstsgensedpCh.AGSYVQF......................
ENSONIP00000002442  .VSVL.........................................-..EGEQVTV......................
ENSONIP00000019441  .VDID.........................................Ci.GGDFITV......................
ENSONIP00000017806  .YVLKpkdmng...................................C..DQGWWKV......................
ENSONIP00000008581  .LTQPd........................................C..VKKEVAVeyhqkgrvtsvlglndtqplqk
ENSONIP00000022615  .FSVR.........................................C..KKEWVSI......................
ENSONIP00000014407  pVALTlhpdshth.................................C..KSSYVYV......................


                                                                                                    
                                                                                                    
d1sppb_               ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000020995  ..............................................................................
ENSONIP00000017189  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000007433  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000002284  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005534  ..............................................................................
ENSONIP00000011626  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000018753  ..............................................................................
ENSONIP00000015351  ..............................................................................
ENSONIP00000011626  ..............................................................................
ENSONIP00000004631  ..............................................................................
ENSONIP00000018847  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000020995  ..............................................................................
ENSONIP00000002284  ..............................................................................
ENSONIP00000007433  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000002907  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003936  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000005534  ..............................................................................
ENSONIP00000018033  ..............................................................................
ENSONIP00000015351  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000018343  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000000681  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000007446  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000022432  ..............................................................................
ENSONIP00000011349  ..............................................................................
ENSONIP00000016272  ..............................................................................
ENSONIP00000019303  ..............................................................................
ENSONIP00000021764  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000023649  ..............................................................................
ENSONIP00000004631  ..............................................................................
ENSONIP00000018847  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000013820  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000003485  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000002907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000021764  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000018445  ..............................................................................
ENSONIP00000008477  ..............................................................................
ENSONIP00000008443  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000003931  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000013251  ..............................................................................
ENSONIP00000006405  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019303  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000014407  ..............................................................................
ENSONIP00000003485  ..............................................................................
ENSONIP00000005130  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000017799  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000007669  ..............................................................................
ENSONIP00000013820  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000016272  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000001495  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000015104  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000015493  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000010465  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000005130  ..............................................................................
ENSONIP00000021427  ..............................................................................
ENSONIP00000018445  ..............................................................................
ENSONIP00000022432  ..............................................................................
ENSONIP00000010465  ..............................................................................
ENSONIP00000020660  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000001940  ..............................................................................
ENSONIP00000018753  ..............................................................................
ENSONIP00000003936  ..............................................................................
ENSONIP00000018033  ..............................................................................
ENSONIP00000011349  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000017391  ..............................................................................
ENSONIP00000003931  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000015672  ..............................................................................
ENSONIP00000000681  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000013744  ..............................................................................
ENSONIP00000017806  ..............................................................................
ENSONIP00000017799  ..............................................................................
ENSONIP00000017391  ..............................................................................
ENSONIP00000018178  ..............................................................................
ENSONIP00000022615  ..............................................................................
ENSONIP00000005842  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000019441  ..............................................................................
ENSONIP00000017806  ..............................................................................
ENSONIP00000008581  qgdflltlrncemerapadspgltftlkvsasspastvsckvdlskteglslnistltptpdcvmkinsvkkdnitvt
ENSONIP00000022615  ..............................................................................
ENSONIP00000014407  ..............................................................................


                                                                                                    
                                                                                                    
d1sppb_               ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000020995  ..............................................................................
ENSONIP00000017189  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000007433  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000002284  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005534  ..............................................................................
ENSONIP00000011626  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000018753  ..............................................................................
ENSONIP00000015351  ..............................................................................
ENSONIP00000011626  ..............................................................................
ENSONIP00000004631  ..............................................................................
ENSONIP00000018847  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000020995  ..............................................................................
ENSONIP00000002284  ..............................................................................
ENSONIP00000007433  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000002907  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000023367  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003936  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000005534  ..............................................................................
ENSONIP00000018033  ..............................................................................
ENSONIP00000015351  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000018343  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000000681  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000007446  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000022432  ..............................................................................
ENSONIP00000011349  ..............................................................................
ENSONIP00000016272  ..............................................................................
ENSONIP00000019303  ..............................................................................
ENSONIP00000021764  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000023649  ..............................................................................
ENSONIP00000004631  ..............................................................................
ENSONIP00000018847  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000014730  ..............................................................................
ENSONIP00000004411  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000012734  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000013820  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000003485  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000002907  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000021764  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000018445  ..............................................................................
ENSONIP00000008477  ..............................................................................
ENSONIP00000008443  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000003931  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000013251  ..............................................................................
ENSONIP00000006405  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000019303  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000014407  ..............................................................................
ENSONIP00000003485  ..............................................................................
ENSONIP00000005130  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000017799  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000007669  ..............................................................................
ENSONIP00000013820  ..............................................................................
ENSONIP00000009059  ..............................................................................
ENSONIP00000016272  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000001495  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000015104  ..............................................................................
ENSONIP00000006911  ..............................................................................
ENSONIP00000015493  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000005907  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000010465  ..............................................................................
ENSONIP00000003482  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000021992  ..............................................................................
ENSONIP00000005130  ..............................................................................
ENSONIP00000021427  ..............................................................................
ENSONIP00000018445  ..............................................................................
ENSONIP00000022432  ..............................................................................
ENSONIP00000010465  ..............................................................................
ENSONIP00000020660  ..............................................................................
ENSONIP00000019007  ..............................................................................
ENSONIP00000001940  ..............................................................................
ENSONIP00000018753  ..............................................................................
ENSONIP00000003936  ..............................................................................
ENSONIP00000018033  ..............................................................................
ENSONIP00000011349  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000017391  ..............................................................................
ENSONIP00000003931  ..............................................................................
ENSONIP00000018792  ..............................................................................
ENSONIP00000015672  ..............................................................................
ENSONIP00000000681  ..............................................................................
ENSONIP00000014378  ..............................................................................
ENSONIP00000013744  ..............................................................................
ENSONIP00000017806  ..............................................................................
ENSONIP00000017799  ..............................................................................
ENSONIP00000017391  ..............................................................................
ENSONIP00000018178  ..............................................................................
ENSONIP00000022615  ..............................................................................
ENSONIP00000005842  ..............................................................................
ENSONIP00000002442  ..............................................................................
ENSONIP00000019441  ..............................................................................
ENSONIP00000017806  ..............................................................................
ENSONIP00000008581  ssfsyhnsvfilytrlliwvlkeevtavdcssgkcpdpvsllvpllpfclpaplsrvtwilrpgrhgtvklisptgpl
ENSONIP00000022615  ..............................................................................
ENSONIP00000014407  ..............................................................................


                                                              70                          80        
                                                               |                           |        
d1sppb_               ..............FDG..............LL....SGPSY.GK...LCA.........GAAI.....VFLST.ANT
ENSONIP00000019007  ..............RDG..............RTe...TDPLI.GK...YCG.........NTLPa....PVLSS.SNV
ENSONIP00000019007  ..............YDN..............GTvq..TGNKI.GR...YCG.........RSVPp....SITST.DNQ
ENSONIP00000020995  ..............HDS..............VStg..AGRVL.GR...FCG.........TTFPp....ELTSS.GPH
ENSONIP00000017189  ..............YDS..............YDd...VSGFA.GR...FCG.........DYLPd....DIIST.GNV
ENSONIP00000004411  ..............YDG..............RDn...RAASL.GR...FCG.........TKKPs....PVISS.ANK
ENSONIP00000014730  ..............RDG..............ISe...NSPLL.GR...FCG.........YDKPd....DIKTS.SNH
ENSONIP00000007433  ..............YSG..............HV....NGQRL.GR...FCG.........TFKPg....ALVST.GNK
ENSONIP00000012734  ..............FDG..............DSd...TAAIL.GR...LCG.........SKIPe....SLVST.GNK
ENSONIP00000023367  ..............YNG..............ISed..EGNLL.GT...FCG.........DISPp....QFTSS.WNV
ENSONIP00000012734  ..............RDG..............YWr...KAPLL.GR...FCG.........DKVPd....VLIST.DSR
ENSONIP00000023367  ..............FDG..............PTv...THRHL.GK...YCG.........ADKPp....NIITT.SNQ
ENSONIP00000019007  ..............YGG..............PDl...SAPQL.AK...LCS.........TTSTpm...HVSST.GNL
ENSONIP00000012734  ..............RDG..............PLe...TSPLI.GR...FCG.........YDKPe....DVRST.SHT
ENSONIP00000019007  ..............RDG..............LLs...EDPVL.GK...YCS.........TASPp....PIQTT.GPA
ENSONIP00000019007  ..............HDG..............NSs...NAPQL.AK...LCG.........SDLPs....TINSS.SNE
ENSONIP00000004411  ..............RDG..............ASe...SSPLL.GR...FCG.........YDKPd....DIKST.SNQ
ENSONIP00000014730  ..............YDG..............RDg...KAQKL.GR...FCG.........TKKPp....PITSS.GNK
ENSONIP00000019007  ..............RDG..............STs...NNNII.SR...LCG.........NTRPs....TQHST.GSS
ENSONIP00000019007  ..............FNG..............GSp...GSPII.GQ...YCG.........TTSPg....TIQSG.SNK
ENSONIP00000012734  ..............RSG..............LSs...DSKLH.GK...YCG.........TEVPe....VITSQ.YNN
ENSONIP00000019007  ..............RDG..............GFe...TSPLI.GK...FCA.........NQRPp....VLMSH.SNR
ENSONIP00000014730  ..............RDG..............YWr...KAPLK.GR...FCG.........DKLPe....PIIST.DSR
ENSONIP00000014730  ..............RSG..............LSa...DSKLH.GK...FCG.........AEKPe....AITSQ.YNN
ENSONIP00000004411  ..............RDG..............FWr...KAPLK.GR...FCG.........DTLPa....QIIST.DSR
ENSONIP00000019007  ..............HDG..............PTs...SSPLL.GR...VCG.........SSVP.....PFTST.QNT
ENSONIP00000004411  ..............RSG..............LSs...DSKLH.GK...FCG.........AEKPe....VITSQ.QNN
ENSONIP00000002284  ..............FNG..............GErd..DSRLI.GK...YCG.........DQVPe....PIVTS.GNV
ENSONIP00000003482  ..............YDG..............PDs...NSPLI.GS...FQD.........SKLPe....RIESS.SNT
ENSONIP00000005534  ..............WDG..............LPg...VGPLI.GR...YCG.........TRVPp....EIQSS.TGI
ENSONIP00000011626  ..............FNG..............GEtd..DSRRI.GK...FCG.........DKPPg....TIVTN.GNE
ENSONIP00000019007  ..............REG..............NA....TGPLV.DR...FCG.........NSLPsn...YTSVI.AHI
ENSONIP00000019007  ..............YDG..............DNm...NFPLV.GT...FCG.........TSVPa....SFISS.GNF
ENSONIP00000005907  ..............YDG..............PDs...LSALL.GS...FYG.........TDVPd....RIESS.SNT
ENSONIP00000018753  ..............RDG..............PFs...FSPLI.NR...FCG.........SASPg....LILSS.GRF
ENSONIP00000015351  ..............WDG..............LPq...VAPLI.GR...YCG.........TKIPp....EIQSS.SGL
ENSONIP00000011626  ..............YNG..............HSr...LVQKL.GR...FCG.........TFRPg....ALIST.SNT
ENSONIP00000004631  ..............RDG..............TDe...SGQLV.GK...YCG.........KIAPs....PVVSS.GNQ
ENSONIP00000018847  ..............YNG..............GDe...SSPML.GK...FCG.........KIAPs....PIIST.GGQ
ENSONIP00000009059  ..............YDG..............PDs...SAHLI.GS...FQD.........SKLPe....KIEST.SNF
ENSONIP00000020995  ..............QEQ..............IE....QTSVV.TR...FCG.........NVAPp....TVNTN.SST
ENSONIP00000002284  ..............YNG..............HSn...LVQKL.GR...FCG.........TFRPg....ALIST.TNM
ENSONIP00000007433  ..............FNG..............PEin..DAKRI.GK...YCG.........DSPPa....PVLSE.GNQ
ENSONIP00000019007  ..............RNG..............STa...DSPLI.GK...FCG.........STLPs....PVFPQ.SNQ
ENSONIP00000002907  ..............LAE..............--....-GNET.LR...FCGeeeknh...ESTPrnt..IILSA.RNL
ENSONIP00000019007  ..............FDG..............PSv...HYYPI.GT...FCG.........LSLPp....PVRSL.GST
ENSONIP00000003482  ..............KDG..............ETn...DATVI.GR...FSG.........AESPs....HLTSN.TNT
ENSONIP00000019007  ..............RDG..............ATs...SSPLL.GT...FCG.........AEIPp....RLQST.QRS
ENSONIP00000019007  ..............MNG..............LAv...DAPHL.QR...FCG.........TVPAgt...QVRSS.GNT
ENSONIP00000023367  ..............YDG..............NSq...TDPLM.GR...WCG.........REHPs....SLVSK.GNK
ENSONIP00000003482  ..............HDG..............PNl...LSPLV.GS...FNG.........TQVPq....FLFSS.SNF
ENSONIP00000006911  ..............RAG..............PQh...SSSLI.GQ...FTG.........SQLPp....PLLST.THL
ENSONIP00000006911  ..............YEG..............EDs...NGPLL.AS...LQG.........NQAPe....RIESS.GNS
ENSONIP00000019007  ..............LDG..............DNy...NSPTI.GR...YCG.........SEIPh....PVTSF.SNS
ENSONIP00000005907  ..............RDG..............RFp...SSPLI.GS...YQG.........TQVPq....FLIST.SNF
ENSONIP00000009059  ..............KDG..............DQs...GATIL.GR...FSG.........AEVPs....HLTSN.SNV
ENSONIP00000003936  ..............RDG..............PFg...FSPLI.DR...FCG.........GKNPe....IVTST.GRF
ENSONIP00000006911  ..............RDG..............PSa...SSPLI.GE...YHG.........TQAPh....FLIST.SNF
ENSONIP00000005534  ..............HDG..............NSe...SADLL.GK...HCS.........NIAPp....PIISS.GPA
ENSONIP00000018033  ..............RDG..............PFg...FSPIL.GR...YCG.........QHSPp....DIRSS.GRY
ENSONIP00000015351  ..............RDG..............TSe...TADVL.GR...HCS.........NIAPg....PIISS.GPS
ENSONIP00000005907  ..............FDG..............GDn...TDTML.GS...FSG.........TTVPa....LLNST.SNQ
ENSONIP00000006911  ..............YDG..............GDm...TAPKL.GS...FSG.........TTAPa....LLNST.SNQ
ENSONIP00000009059  ..............HDG..............PNl...LSPLI.GS...FNG.........TQVPq....FLFSS.SNF
ENSONIP00000018343  ..............RDG..............DSi...HSRVI.GR...YCG.........NNRPa....PVHSS.GNS
ENSONIP00000003482  ..............YDG..............ADn...HAPRL.GS...YSG.........TTIPp....LLNST.SNN
ENSONIP00000000681  ..............YDG..............PYv...YSPFL.GK...VCN.........NSLS.....TFFST.SNY
ENSONIP00000006911  ..............KDE..............GLs...EPTTF.GT...FSG.........KDVPs....QIASN.GHI
ENSONIP00000007446  ..............RDG..............DSv...ASPVI.GR...FCG.........DQLPp....PIKSS.RNF
ENSONIP00000003482  ..............EG-..............--....SEPPT.IW...LSG.........TNVPs....PIVSN.KNW
ENSONIP00000019007  ..............YDG..............PDt...LSPLL.GK...FCG.........TVLPp....NLRSS.TNQ
ENSONIP00000009059  ..............RSG..............SLe...TGTVI.DR...FSG.........PTLPn....PLFST.THE
ENSONIP00000019007  ..............RDG..............ATs...QSPVL.AD...VCG.........RDHPg....SLHST.GDF
ENSONIP00000005907  ..............RNG..............PLe...TSAVI.GR...FSG.........QDVPs....SLLTT.SHE
ENSONIP00000021992  ..............QDS..............V-....--GVI.GK...YCG.........YNKPn....PVVSL.TNQ
ENSONIP00000009059  ..............FDG..............VDg...NAPRL.GS...YSG.........TTIPq....LLNST.SNN
ENSONIP00000003482  ..............RSG..............TLe...TGSVI.DR...FSG.........PVMPk....PLFST.THQ
ENSONIP00000003482  ..............WDG..............PDq...SSPQI.GQ...FSG.........NTALe....SVYST.SNI
ENSONIP00000005907  ..............YDG..............PPs...PGNLR.TR...LTG.........FQLPp....PIVST.GSR
ENSONIP00000019007  ..............YDG..............PNq...EAPLI.GT...FCG.........YTPPp....AGSTT.SSA
ENSONIP00000005907  ..............SGT..............--....-EGSS.QW...FTG.........PNLPs....PIISS.KNW
ENSONIP00000022432  ..............RDG..............AGs...NSTLL.AV...LTG.........NGPTh....DLFST.ANQ
ENSONIP00000011349  ..............RDG..............PFg...FSPII.GR...YCG.........QESPs....YVRSS.GRY
ENSONIP00000016272  ..............FY-..............--....KEKAL.WK...FCGsensad...GHHPgnq..PILSP.GNS
ENSONIP00000019303  ..............SSY..............RNl...DG---.LR...VCG.........SSLPp....PYISS.QDH
ENSONIP00000021764  ..............EA-..............--....EGEVL.AL...FCGkeqtdt...EVVPaqq..ALTSP.RNS
ENSONIP00000009059  ..............YDG..............HPh...PANFR.TR...LTG.........FTIPp....PVTSS.GSI
ENSONIP00000005907  ..............KDG..............GKa...ESPIL.GT...FSG.........DVLPp....PITTS.AHV
ENSONIP00000005907  ..............GDG..............EVvgd.QKTIF.HV...LSG.........STTPd....LVVST.SHQ
ENSONIP00000006911  ..............SG-..............--....TEAPS.IW...LTG.........TTLPs....PVISN.KNW
ENSONIP00000003482  ..............YDG..............HPh...PANFR.TR...LTG.........FQVPp....PVTST.GNV
ENSONIP00000023649  ..............NTG..............S-....---AE.VV...FCG.........LTANgl...TQNST.GNE
ENSONIP00000004631  ..............WDG..............FPg...VGPHV.GR...YCG.........QNTPg....RIISY.TGI
ENSONIP00000018847  ..............WDG..............FPa...VGPHI.GR...YCG.........QTSPg....RVISY.TGI
ENSONIP00000021992  ..............SD-..............--....KTGSL.GT...YCS.........HVPPa....DMVSD.GNT
ENSONIP00000014730  ..............FDG..............PDt...KSPRL.GR...YCG.........SGPPe....EIYSA.GDS
ENSONIP00000004411  ..............YDG..............ADt...KSPRL.GR...YCG.........SGAPe....DVYSA.GDS
ENSONIP00000019007  ..............HDG..............ESa...SAYMI.GK...YCG.........QNSPa....ELYSS.HNS
ENSONIP00000019007  ..............YDG..............PDt...SSQFV.GP...YCG.........VETNia...PFTAT.AHQ
ENSONIP00000009059  ..............WDG..............PDq...SSPQI.GQ...FSG.........SSVQe....GVSTT.ANQ
ENSONIP00000012734  ..............YNG..............YDa...NSHRL.GR...FCG.........SGPRe....GIYSP.GDA
ENSONIP00000021992  ..............YDI..............NGltsaLIQSY.GQ...FCG.........TTLPd....PIQTN.GNR
ENSONIP00000006911  ..............WDG..............PDt...SSPQL.GV...FSG.........NTALe....TAYST.SPK
ENSONIP00000019007  ..............RNG..............PDg...SSPLLgGR...LCG.........SSPPs....VLQTT.DNH
ENSONIP00000013820  ..............LGD..............VE....GTEEI.AL...LCG.........GSIPp....PVLSY.NST
ENSONIP00000021992  ..............ING..............E-....TMASL.GR...FCG.........FAPPp....LISIP.SNT
ENSONIP00000019007  ..............REY..............NA....SGRLL.GR...HCG.........NNLPa....PMETS.DSF
ENSONIP00000003485  ..............MGN..............--....-----.-K...YCG.........EVASl....SLTSD.TNV
ENSONIP00000003482  ..............WDG..............PPe...NEMSL.AE...LSG.........SLLPe....GIHST.LNT
ENSONIP00000009059  ..............GDG..............GEvgd.SKTII.QV...LTG.........SFVPd....LIVSM.SHQ
ENSONIP00000019007  ..............YSL..............AT....SGIPI.AT...LCG.........TTIP.....GSFST.FGP
ENSONIP00000005907  ..............WDG..............PQd...GGVLL.RE...LSG.........SALPq....DVHST.FNT
ENSONIP00000021992  ..............YDY..............NQa...SPQLA.GK...LCG.........GTMPt....PLEIS.SNT
ENSONIP00000002907  ..............ST-..............--....AGKEY.GP...FCG.........PTPPd....RIDTG.SYD
ENSONIP00000006911  ..............GDG..............GKigd.TRRVL.YV...LTG.........SSVPd....LIVSL.SNQ
ENSONIP00000021764  ..............KAG..............--....-SAEF.GP...FCG.........DRSPg....VIQTD.SNV
ENSONIP00000003482  ..............FDG..............PTs...NSPTL.AT...LSG.........DLPTpf...NLTTS.GHQ
ENSONIP00000006911  ..............WDG..............PSgpsdGGILL.KE...WSG.........PALPe....DIHST.FNI
ENSONIP00000005907  ..............FDG..............SSn...KARLL.GV...FTG.........NDLLdt...TLNST.SSS
ENSONIP00000003482  ..............GDG..............GEvgd.PTTIL.QV...LSG.........SFVPd....LIVSM.THQ
ENSONIP00000009059  ..............FDG..............PNi...YSQSL.SS...LSG.........DIETpf...SLTTT.GHQ
ENSONIP00000018445  ..............NGE..............--....-----.-R...LCG.........SDLKsp...VFTIN.SNK
ENSONIP00000008477  ..............NNK..............VKtf..GGRIK.GP...LCG.........KLDAagk..NVTFN.SNE
ENSONIP00000008443  ..............YNG..............IGp...NRSEI.VK...LCG.........LGLKveh..LINST.GNE
ENSONIP00000006911  ..............FDG..............SSg...QSPLL.VA...LSG.........NHSSql...NFTSK.TNQ
ENSONIP00000006911  ..............YDG..............ENs...SSRLL.GN...FTR.........EDMMgr...VINST.SNH
ENSONIP00000003931  ..............TP-..............--....TWKRE.SR...LCG.........SVLPq....PFIST.RGR
ENSONIP00000009059  ..............WDG..............PPe...NEMSL.KE...VSG.........SLLPe....GIHST.LNI
ENSONIP00000003482  ..............YDG..............KDn...TAHVL.GA...FTG.........SSMLgl...TLIST.SNH
ENSONIP00000005907  ..............WDG..............PQe...TARKL.GV...FTD.........GEPNd....PPSST.SNQ
ENSONIP00000013251  ..............LDG..............Y-....TNQVV.AR...FDW.........RSPPre...LVNIT.GDF
ENSONIP00000006405  ..............EDQ..............SEt...STIIW.GR...WCG.........QKAPp....SLNSK.TNK
ENSONIP00000009059  ..............YDG..............KDg...AAPLL.GT...YTS.........TLMQgl...SLTST.SNY
ENSONIP00000019303  ..............YDG..............LEe...NPRRL.LR...VLTafd......SRAPv....AVVSS.SGQ
ENSONIP00000009059  ..............EG-..............--....SEPPT.IW...LTG.........MNIPa....PIISN.KNW
ENSONIP00000005907  ..............TEN..............GS....FSQPL.WR...LTG.........STLPppls.AGLFG.NYT
ENSONIP00000009059  ..............TEN..............GS....FAQPL.AR...LTG.........SERPapin.AGLYG.NFK
ENSONIP00000006911  ..............TED..............GN....FQVPV.AR...LTG.........SVLPpsvk.AGLYG.NFS
ENSONIP00000014407  ..............YDG..............DSy...QSPLL.AS...LSG.........NTVPq....PIEAK.SGK
ENSONIP00000003485  ..............YDS..............LSpd..DSQAI.TK...KCG.........QRPPsnpl.EVVSS.NNI
ENSONIP00000005130  ..............NG-..............--....-----.KK...WCG.........EKPDgsv..TETSS.TNN
ENSONIP00000003482  ..............TEN..............GS....FLQPL.AR...LTG.........NELPsnin.AGLYG.NFK
ENSONIP00000017799  ..............GG-..............--....-----.VK...LCN.........PVSDss...KKRVQ.SSP
ENSONIP00000019007  ..............RLG..............DS....NGELL.GR...FCG.........QTAFvl...PIVVF.TPE
ENSONIP00000018792  ..............FDG..............RDl...TSHVI.GQ...YLG.........SKERf....QVVSG.GSE
ENSONIP00000007669  ..............RKS..............SLp...NSVTT.YE...TCQ.........TYERpi...AFTSR.SKR
ENSONIP00000013820  ..............SIG..............--....SHRPV.GI...FCG.........SVLPgp...ILLNN.SHN
ENSONIP00000009059  ..............YDG..............SSa...DSALL.SS...IYG.........SHSGet...LPLSS.GNK
ENSONIP00000016272  ..............TV-..............--....RDEQP.IK...LCG.........RTSPg....VIVTN.SNM
ENSONIP00000014378  ..............TDG..............DEv...TTRIL.GR...YVG.........GSSPf....KLSST.TPD
ENSONIP00000001495  ..............EDP..............T-....EKTIL.GR...WCG.........SQSLpg...SHISK.GSQ
ENSONIP00000005907  ..............YDG..............ATq...HSRVL.SS...LSG.........AHTGes...LPLAT.SNQ
ENSONIP00000015104  ..............RKS..............AHp...TSITT.YE...TCQ.........TYERpi...AFTSR.SRK
ENSONIP00000006911  ..............FDG..............PNd...NARLL.SS...LAG.........SHSGet...LPLAT.SNQ
ENSONIP00000015493  ..............YDG..............DSi...YAPLL.AA...FSGlivperygnETVP.....EVVSQ.SGY
ENSONIP00000019007  ..............WSG..............HSqi..SEALL.ST...GCG.........SVAPg....SIVAP.NNI
ENSONIP00000005907  ..............FDG..............PSr...QSPLL.IT...LSG.........NYSSpl...SITSS.SNK
ENSONIP00000002442  ..............KNG..............NNi...DSPPV.YD...SYEv........EYLPne...GVLST.GRY
ENSONIP00000010465  ..............YDG..............DDl...TAKLL.GQ...YGG.........SKSRf....KLYTS.TAD
ENSONIP00000003482  ..............YDG..............PTq...QNTLL.SS...LSG.........SHSGes...LPLSS.GNQ
ENSONIP00000002442  ..............YDG..............DDl...TANIL.GQ...YSG.........TRPHf....KLYTS.MAD
ENSONIP00000021992  ..............SDK..............Y-....--STL.GT...HCG.........YILPp....VVVSA.SDT
ENSONIP00000005130  ..............YDS..............LVpi..ESLLM.EE...LCG.........KYLPnkrl.SFLSS.GNV
ENSONIP00000021427  ..............RKN..............SQgsa.TSITT.YE...TCQt........YERPi....AFTAR.SRR
ENSONIP00000018445  ..............YDS..............LVpi..EKRAM.TE...QCG.........YPHQsl...SFISS.GNV
ENSONIP00000022432  ..............YEG..............VGp...NKVLT.GE...SHS.........STSPg....NVWLL.TNQ
ENSONIP00000010465  ..............KNG..............NSi...NAAVL.YD...SYEv........EYLPne...GLLST.SRQ
ENSONIP00000020660  ..............YDG..............DSi...YAPLV.AV...FSGlivpeirgnETVP.....EVETT.SGY
ENSONIP00000019007  ..............KDW..............PMg...DYGQS.HK...FCPsd.......GHLP.....DFYSY.DRT
ENSONIP00000001940  ..............YDG..............DSi...YAPLI.AV...FSGlvvpetrgnETIP.....EVVTT.SGY
ENSONIP00000018753  ..............YDG..............SNa...IEDLK.AK...FCS.........TVAN.....DIMLD.TGV
ENSONIP00000003936  ..............YDG..............SSa...IENLK.AK...FCS.........TVAN.....DVMLN.NDM
ENSONIP00000018033  ..............YDG..............GSs...VEDLK.SK...FCS.........TVAN.....DIMLV.STL
ENSONIP00000011349  ..............YDG..............SSs...VEHLK.NK...FCS.........TVAN.....DVMLV.TSV
ENSONIP00000014378  ..............WSG..............LDag..SVVLF.DS...GRG.........GQIPfe...GVISE.GPA
ENSONIP00000018792  ..............RSG..............NSs...LAPTL.FD...SDM.........DDVPer...GLLSE.SST
ENSONIP00000017391  ..............QN-..............--....-----.RR...LCG.........TRALqpyseRLFLL.SMT
ENSONIP00000003931  ..............YDG..............LLq...RAEHL.LQvlsYHN.........NRRPa....LLESS.RGQ
ENSONIP00000018792  ..............MGY..............GGs...GPELL.AN...ETL.........MKQGq....VIRST.TNQ
ENSONIP00000015672  ..............DEP..............VGdl..AGHKV.LQ...KC-.........W--Qea...KYTTS.SNI
ENSONIP00000000681  ..............YDG..............SSt...GSRLL.GQ...ICN.........NNNNn....TFYSTvGYT
ENSONIP00000014378  ..............TGV..............DE....HGSLL.VL...ANH.........TLLVegq..VIRSP.TNT
ENSONIP00000013744  ..............RDM..............DVl...K---T.NV...FKG.........NQLF.....QWHSS.GNM
ENSONIP00000017806  ..............YDA..............LLpm..RGRIL.HS...LCE.........PVSSav...SIVAT.SNF
ENSONIP00000017799  ..............YDF..............LLpl..QNKII.AR...WCGlpis.....GSSPvm...KLTSS.GNV
ENSONIP00000017391  ..............YNS..............LTpa..DNHLI.TS...VYGcs.......R--Hehvv.RVLSS.GEW
ENSONIP00000018178  ..............FDGwvlkgekfpsnqdhPLp...LYERY.TD...YCS.........STAPga...TSRSS.QNV
ENSONIP00000022615  ..............YNR..............EEgke.NPSVF.SQ...ITS.........SSNSksv..QVESN.TGV
ENSONIP00000005842  ..............YDG..............RDr...SSPPL.GPp..LCG.........KSPPr....PVLST.GNY
ENSONIP00000002442  ..............EDT..............GG....QEPFI.LA...NES.........VLMTgl...VLRSW.SNQ
ENSONIP00000019441  ..............FDGwvmkgekfpsthdhPLp...LFERY.VD...YCD.........SGSLrk...SVRSS.QNV
ENSONIP00000017806  ..............NE-..............--....-----.VI...YCG.........SYVGhnt..VFRIA.DYN
ENSONIP00000008581  kqslpgqlcddsvtIDV..............AEe...NGAPI.GT...FCR.........----.....-----.---
ENSONIP00000022615  ..............NSS..............AG....GDPI-.-I...LCG.........SKLPq....PIELP.GGN
ENSONIP00000014407  ..............FDGlprflgngvv....HS....DHNLI.GA...FCG.........TTRTqpi..TVEAT.SGV


                       90           100       110                       
                        |             |         |                       
d1sppb_               MTIKYNRISGNS....SSPFLIYFY--....--gssp.............
ENSONIP00000019007  LWIRFKSDSSVS....RAGFRAVYT--....--.................
ENSONIP00000019007  LTLLFVSDSSLN....TEGFSASYIS-....--i................
ENSONIP00000020995  MTVVFVADEGVA....DSGFNATYQAV....--.................
ENSONIP00000017189  MTLKFLSDASVT....AGGFQLQYIA-....--f................
ENSONIP00000004411  MFLRFFSDNSVQ....KRGFEASYRA-....--.................
ENSONIP00000014730  LWMKFVSDGSVN....KAGFAANF---....--.................
ENSONIP00000007433  MLLQMVSDANTA....GSGFLAVFSA-....--.................
ENSONIP00000012734  MYLRFISDASVQ....RKGFQASHS--....--t................
ENSONIP00000023367  MSIIFHSDRHVA....YRGFTVGY---....--r................
ENSONIP00000012734  MWIEFRSSSNWV....GKGFAAIYEAI....C-.................
ENSONIP00000023367  LLVVFKSDFNIG....GRGFKAYYYS-....--.................
ENSONIP00000019007  LTVRFKSDAYVS....GRGFNASWTE-....--v................
ENSONIP00000012734  LWMKFVSDGTVN....KAGFAANF---....--.................
ENSONIP00000019007  AWIHFHSDFSVS....DRGFHITYTT-....--.................
ENSONIP00000019007  LYVKLRTDSSVN....AGGFLASYTS-....--.................
ENSONIP00000004411  LWLKFASDGSVN....KAGFAANF---....--.................
ENSONIP00000014730  LFIRFFSDNSVQ....KKGFEASHT--....--a................
ENSONIP00000019007  MWLRFRTDASIT....HQGFKAKYSI-....--a................
ENSONIP00000019007  LAIVFLADHSVS....KGGFLASWS--....--s................
ENSONIP00000012734  MRIEFKSDNTVS....KKGFKAHF---....--f................
ENSONIP00000019007  LWVRFKSDTSVT....RPGFMAHW---....--.................
ENSONIP00000014730  LWIEFRSSSNWV....GKGFSAVYEAI....C-.................
ENSONIP00000014730  MRIEFKSDNTVS....KKGFKAQF---....--f................
ENSONIP00000004411  LWIEFRSSSSWV....GKGFSAIYEAI....C-.................
ENSONIP00000019007  IYVRFRSDTSSS....HRGFSARFS--....--e................
ENSONIP00000004411  MRIEFKSDNTVS....KRGFKAHF---....--f................
ENSONIP00000002284  LLVQFVSDLSVT....SDGFLARFTS-....--i................
ENSONIP00000003482  MLLAFRSDGSVS....YTGFHLEYK--....--a................
ENSONIP00000005534  LSLSFHTDMAVA....KDGFSARY---....--n................
ENSONIP00000011626  LLLQFVSDLSVT....SDGFMAYYSS-....--v................
ENSONIP00000019007  MWVKFVSDASVS....GAGFRATFS--....--.................
ENSONIP00000019007  LTVHFVTDGSVQ....RRGFNATYREVpli.C-g................
ENSONIP00000005907  LFLAFRSDASLS....SNGFVLQYT--....--e................
ENSONIP00000018753  MWIRFFSDEELE....GTGFQVQYSF-....--.................
ENSONIP00000015351  LSLSFHTDMAVA....KDGFSARY---....--n................
ENSONIP00000011626  MMLEMVTDEATG....GRGFLASF---....--n................
ENSONIP00000004631  LFIKFVSDYETH....GAGFSIRYEI-....--f................
ENSONIP00000018847  LLIKFVSDYETH....GAGFSVRYEV-....--f................
ENSONIP00000009059  MYLAFRSDGSVS....YTGFHLEYK--....--a................
ENSONIP00000020995  VWVTFHSDGSIA....GNGFTAQYRA-....--.................
ENSONIP00000002284  MMLEMVTDDETQ....SRGFLAYFTA-....--v................
ENSONIP00000007433  LLIQFLSDLSLT....ADGFIGHYK--....--f................
ENSONIP00000019007  LYLRFKSDFSYS....RDGFDATWT--....--s................
ENSONIP00000002907  MSVVFRSDYSNEgr..FTGFQAFYT--....--s................
ENSONIP00000019007  VTVQFKSDTVLG....GKGFLLEWTA-....--i................
ENSONIP00000003482  LRLEFQADHSMS....GRGFNITYSTF....--.................
ENSONIP00000019007  MYIKFTTDSSVS....NHGFEAAY---....--.................
ENSONIP00000019007  MAVEFRTDASVS....SGGFLATYS--....--s................
ENSONIP00000023367  LLVVLSTDRNEA....HRGFTASYH--....--.................
ENSONIP00000003482  LYLLFTTDNSRS....NAGFKILYES-....--v................
ENSONIP00000006911  TIIHFYSDHSEN....RPGFKLTYQA-....--.................
ENSONIP00000006911  LFLAFRSDASLG....MSGFAIEYR--....--.................
ENSONIP00000019007  LVVKFISDQFDS....RKGFRATYS--....--.................
ENSONIP00000005907  LYLLFTTDKSHS....DIGFRIRYE--....--t................
ENSONIP00000009059  LQLEFQADHSMS....GRGFNITYSTF....--.................
ENSONIP00000003936  MWVKFTSDEELE....GLGFRIEYTF-....--i................
ENSONIP00000006911  LFLLFTTDNSRS....AAGFSIRYES-....--v................
ENSONIP00000005534  LHIKFVSDYAHQ....GAGFSLRYEI-....--f................
ENSONIP00000018033  LWIKFVTDGELE....AVGFSANYN--....--f................
ENSONIP00000015351  LQIRFVSDYAHQ....GAGFSLRYEI-....--f................
ENSONIP00000005907  LYLHFFSDISVS....AAGFRLEYKTVsltnC-.................
ENSONIP00000006911  LLLHFQSDISVV....AAGFHLEYKT-....--v................
ENSONIP00000009059  LYLLFTTDNSRS....NSGFKIFYEV-....--v................
ENSONIP00000018343  LHVLFVSDGYKN....FDGFFATFQEN....--sac..............
ENSONIP00000003482  LYLSFSSDISVS....AAGFHLEYTA-....--i................
ENSONIP00000000681  MTVVFRTDGAMV....GRGFNAEFS--....--s................
ENSONIP00000006911  MRLEFQSDHSNT....GKGFNISYTTF....--.................
ENSONIP00000007446  LHILFTSDGYNN....FDGFVLTFQEI....--sgrqc............
ENSONIP00000003482  LRLHFVTDGNHR....YRGFSAHYQV-....--f................
ENSONIP00000019007  LFIVFSTDNTVN....GIGWRATYS--....--.................
ENSONIP00000009059  TTLFFHSDYSQN....KPGFHIVYQA-....--.................
ENSONIP00000019007  MYIHFSSDSSIS....GQGFNASYS--....--.................
ENSONIP00000005907  TTIYFHSDHSQN....KPGFRFEYQA-....--y................
ENSONIP00000021992  LTVYFDTNDRKT....DRGFKAHYKA-....--v................
ENSONIP00000009059  LYLTFQSDISVS....AAGFHLEYTAIgldsC-.................
ENSONIP00000003482  TSFFFHSDYSQN....KPGFHITYQA-....--.................
ENSONIP00000003482  ILIKFHSDFSGA....GF-FVLSYHAY....--qlrvc............
ENSONIP00000005907  LTLWLLSDYAVS....GQGFKAAYE--....--a................
ENSONIP00000019007  LNIVFRTDSSVS....TSGFQMMWY--....--q................
ENSONIP00000005907  LRLHFTSDGNHK....LRGFSAQYQ--....--.................
ENSONIP00000022432  VTVWFYTDSSVS....GKGFRANFT--....--s................
ENSONIP00000011349  LYIKFVADSELE....AIGFSARYN--....--f................
ENSONIP00000016272  LTLIFQSDSNNPeahqNLGFSAQYQA-....--i................
ENSONIP00000019303  LWIHFHSDDSLT....GKGFRLSY---....--i................
ENSONIP00000021764  LSLLFSSDFSDEer..FSGFVAHYNA-....--v................
ENSONIP00000009059  FSLRLTSDFAVS....AHGFKAAY---....--e................
ENSONIP00000005907  ARLEFLTDHTYT....DRGFNITFTTF....--.................
ENSONIP00000005907  MWLNFKTDDTSG....SLGFKVSYE--....--e................
ENSONIP00000006911  VRIHFTSDSNHR....RKGFSAQYQ--....--.................
ENSONIP00000003482  FSLRLTSDFAVS....AHGFKLNY---....--e................
ENSONIP00000023649  MVLSFTSDFSVQ....KKGFRVSFQ--....--h................
ENSONIP00000004631  LALTINTDSAIA....KEGFSANFT--....--v................
ENSONIP00000018847  LSMTITTDNAIA....REGFSANYT--....--i................
ENSONIP00000021992  LHISFSSNDKVV....DSGFTATWRA-....--v................
ENSONIP00000014730  IVIKFHSDDTIN....KKGFHVRYTS-....--.................
ENSONIP00000004411  IVLKFHSDDSIN....KKGFHVRYTS-....--.................
ENSONIP00000019007  LYFWFRSDHSVS....AGGFTVAWQ--....--s................
ENSONIP00000019007  VYVVFQGQYSTL....PSGFRLTWTS-....--.................
ENSONIP00000009059  VLIKFHSDFSTS....GF-FELHYFAY....--qlrtc............
ENSONIP00000012734  MLIRFHSDDTIS....KKGFHILYTS-....--.................
ENSONIP00000021992  LLIRFHTDLLTE....AKGFRAYWTT-....--.................
ENSONIP00000006911  VLIRFHSDFSTG....GF-FILNFHAY....--rlkkc............
ENSONIP00000019007  LFIHFVSDASNE....ASGFKLVFEA-....--h................
ENSONIP00000013820  MVLQFTSDSSIT....HRGFRATL---....--tf...............
ENSONIP00000021992  VVIRFLSNGASQ....EKGFRGYWTT-....--.................
ENSONIP00000019007  AYVRFVSDTSGN....AAGFRLFFE--....--a................
ENSONIP00000003485  LVVNFHSDQSHT....DKGFSAVYSS-....--y................
ENSONIP00000003482  VTVQFETDFYIS....KSGFAIQFSS-....--s................
ENSONIP00000009059  MWLHLQSDESVG....SIGFKINYKE-....--i................
ENSONIP00000019007  MLLHFYSDSVIT....DTGFMAEYTA-....--i................
ENSONIP00000005907  ISLQFTTDFFTS....KQGFALQF---....--s................
ENSONIP00000021992  MVVRFKSDNSLT....SKGFSATYT--....--.................
ENSONIP00000002907  VHVEFRSDSSGK....NKGWKIKYTS-....--.................
ENSONIP00000006911  MWLHLQSDDTIG....SAGFKAVYE--....--e................
ENSONIP00000021764  ASVVFRSDNSGE....NLGWRLSYTA-....--.................
ENSONIP00000003482  FLVRWSSDHGTN....KKGFKIRYVA-....--l................
ENSONIP00000006911  LTLQFDSDYFIS....KQGFSIQFS--....--t................
ENSONIP00000005907  MWLEFISNADNT....SKGFELHFTS-....--f................
ENSONIP00000003482  MWLHLQSDESVG....SIGFKINYKE-....--i................
ENSONIP00000009059  LLLRWSSDHGTN....RRGFHIRYVA-....--m................
ENSONIP00000018445  MTITFKSDSSYV....DQGFTAEYEA-....--f................
ENSONIP00000008477  VIIMFKSGPHRS....GRGFLLSY---....--a................
ENSONIP00000008443  ATVQFMSGTHHT....GRGFYLSYST-....--.................
ENSONIP00000006911  LYLRWSTDHATN....KRGFKIRYSA-....--a................
ENSONIP00000006911  LWLEFNSNASGT....NQGFHLTYTSF....--d................
ENSONIP00000003931  VWLFFHSQANSSgq..AQGFRLSY---....--.................
ENSONIP00000009059  VTIQFETDFYIT....KSGFAIDFSS-....--s................
ENSONIP00000003482  LWLEFYSDAENT....GEGFKLVYSS-....--f................
ENSONIP00000005907  VLIRFRSNTEKG....G-LFRISYQ--....--a................
ENSONIP00000013251  VILYFYSDRTNQ....AQGFALLYQ--....--.................
ENSONIP00000006405  LKVTFKSDDYFVa...RPGFKIYYS--....--.................
ENSONIP00000009059  LWLEFYSDHEKT....AAGFRLIYHS-....--f................
ENSONIP00000019303  LRVHFYADKINA....ARGFNVTYQ--....--.................
ENSONIP00000009059  LRLHFVTESNHR....HKGFRAQYQ--....--.................
ENSONIP00000005907  AQIRFLSDFSVS....YEGFNITFS--....--e................
ENSONIP00000009059  AQLRFISDFSIS....LQGFNISFS--....--e................
ENSONIP00000006911  AQLRFISDFSMS....YEGFNITFSEY....--dlepc............
ENSONIP00000014407  MLLHLFSDANYH....LLGFNATYTFSl...C-p................
ENSONIP00000003485  MLINFIAETDAE....KPGFQASYRA-....--i................
ENSONIP00000005130  MTVVFYSDESRV....DHGFSAQYEA-....--i................
ENSONIP00000003482  AQLRFISDFSIS....YEGFNITFSA-....--.................
ENSONIP00000017799  LTLHFHSDESLT....NKGFYLLYRAF....--.................
ENSONIP00000019007  LWVHFQTDNSNG....DLGFKAKYL--....--f................
ENSONIP00000018792  VAIQFQSDLDDSsfilSQGFLIHYRE-....--v................
ENSONIP00000007669  LWIQFRSNEGNS....AKGFQVPYVT-....--y................
ENSONIP00000013820  ATLLFSSDISRA....GSGFVIRHH--....--a................
ENSONIP00000009059  IMLKFTTNGTET....AKGFHFVYQAV....--.................
ENSONIP00000016272  VKLEYHTDDEGQ....SNGWSLDYST-....--.................
ENSONIP00000014378  LTVTFHSDPAGLvfgkGEGFIINY---....--i................
ENSONIP00000001495  ITIRFISDEYFPs...EPGFCIRYS--....--l................
ENSONIP00000005907  ILIRFTSKGQSS....SRGFHLVYQAV....--.................
ENSONIP00000015104  LWIQFKSNEGNS....GKGFQVPYVT-....--y................
ENSONIP00000006911  IMLRFNAKSGQS....ARGFHFVYQAV....--.................
ENSONIP00000015493  ALLHFFSDAAYN....LTGFNISYR--....--.................
ENSONIP00000019007  ITSRFQSTG-AP....GKGFSASF---....--n................
ENSONIP00000005907  VYLHWSFDHTTS....HKGFRIRYSAAy...C-.................
ENSONIP00000002442  LFVEFTTDGTMT....STGAAIRYEA-....--f................
ENSONIP00000010465  VTIQFQSDPATNvygyGNGFVVHF---....--fe...............
ENSONIP00000003482  ITIKFTTVGPET....AKGFHFVYQAV....--.................
ENSONIP00000002442  VTIQFQSDPATNiygyNNGFVVHFF--....--ev...............
ENSONIP00000021992  ISVTFQSDSRLT....DRGFSAKWEA-....--v................
ENSONIP00000005130  MLVTMATH-DQS....FPG--------....--fiae.............
ENSONIP00000021427  LWINFKSNEANS....ARGFQIPYVT-....--y................
ENSONIP00000018445  MLLMLVTNEEKN....FPGFRANYS--....--p................
ENSONIP00000022432  STVEFTSDDINN....LSGFIATYSA-....--.................
ENSONIP00000010465  LFIELTTDATGT....STGIAIRYQAF....--.................
ENSONIP00000020660  ALLHFFSDAAYN....LTGFEIFYSINs...C-p................
ENSONIP00000019007  MHVQFKSDTFVT....GNGLSFTFQI-....--a................
ENSONIP00000001940  ALLHFFSDAAYN....LTGFSIAYSINs...C-.................
ENSONIP00000018753  GVVRMWADETSR....LSRFRMLFTSFadppC-.................
ENSONIP00000003936  GVVRMWADEKSR....LSRFRMLFTSFidppC-n................
ENSONIP00000018033  GVIRMWADEASR....KSRFRILFTTYqeppC-.................
ENSONIP00000011349  GVVRLWADEGSR....KSRFKILFTTFheppC-.................
ENSONIP00000014378  VRIQFITDQPNH....NTGFNIRYEAFerghC-.................
ENSONIP00000018792  LYLELTADSSSI....PLLLALRYEA-....--f................
ENSONIP00000017391  TTIFMTSEVSLT....GPGLQLQYSV-....--fn...............
ENSONIP00000003931  MSVLYMAQPHSP....GHGFNATYQV-....--k................
ENSONIP00000018792  VYIHYRSLRQTN....HGMFSLHYQAFlls.C-.................
ENSONIP00000015672  LYVVLLIGGWPNpl..YRGFYGRYQAF....--.................
ENSONIP00000000681  VCI---------....-----------....--qivlaaqfwsyvfmfyy
ENSONIP00000014378  LSVYYCSGLEGS....MGIFQLHYQIFrls.C-.................
ENSONIP00000013744  AEVEFHGDYLHS....EGSFRARY---....--.................
ENSONIP00000017806  MLLSFRM--T--....-----------....--dgkknfrgyf.......
ENSONIP00000017799  MLVTFSFSRQRD....GAIFKAYFQA-....--i................
ENSONIP00000017391  MTVVWKQGLYNY....KESFSLSVQAW....--ehhdc............
ENSONIP00000018178  AMIFFR--IHSP....DSGF-------....--tl...............
ENSONIP00000022615  MSVVYKGVLGTE....NSNFNATFHVK....--gyc..............
ENSONIP00000005842  LTLRLVTRGTQP....RVDFVGDFTS-....--f................
ENSONIP00000002442  ISISFRSEKRRN....SAYLLLHYQAFvls.C-.................
ENSONIP00000019441  AMVFFRI--HSA....GSSFT------....--ltv..............
ENSONIP00000017806  PEVEFRCSSRTS....AQPFQASYS--....--s................
ENSONIP00000008581  ------------....-----------....--dgaiqtvhihtn.....
ENSONIP00000022615  ITVTHHF-----....-----------....--lphlfpvssfllny...
ENSONIP00000014407  ISVYFEANVTSDr...PQGFNASF---....--w................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0043701 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Manihot esculenta v147 - Cassava
NoYes   Actinidia chinensis Hongyang
NoYes   Amborella trichopoda 22
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Bathycoccus prasinos
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   [Ruminococcus] obeum
NoYes   Saprospira grandis str. Lewin
NoYes   Flexibacter litoralis DSM 6794
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella ruminicola 23
NoYes   Fluviicola taffensis DSM 16823
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurovum sp. NBC37-1
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]