SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Spermadhesin, CUB domain alignments in Dipodomys ordii 76_1

These alignments are sequences aligned to the 0043586 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                              10           20                            30         
                                               |            |                             |         
d1sfpa_               ...........lpr---NTNCGG..IL.K.EES.GVIATY.........YG.....PK......TNCVWTIQMP..PE
ENSDORP00000010499  ..............-----GCDH..KV.T.STS.GTITSPnwpdk....YP.....SK......KECTWAISST..PG
ENSDORP00000007010  .............e------CEQ..KI.H.SPS.GLITSPnwpdk....YP.....SR......KECTWEISTI..PG
ENSDORP00000007010  ............rk---------..--.-.-NE.GQIQSPnypdd....YR.....PM......KECVWKIAVS..EG
ENSDORP00000007555  ..............------CGG..DI.T.KDS.GQIQSPnypdd....YR.....PS......KECVWRITVS..DG
ENSDORP00000010499  .............d---------..--.-.--N.GHIQSPnypdd....YR.....PS......KVCIWRIQVS..EG
ENSDORP00000010499  ..............------CGG..FL.T.KLN.GSITSPgwpke....YP.....PN......KNCIWQLVAP..TQ
ENSDORP00000000799  ..............------CGG..RL.E.KAQ.GTLTTPnwpesd...YP.....PG......ISCSWHIIAP..PN
ENSDORP00000015304  ..............-----DCGG..IQ.I.GES.GVVTSPnypgt....YS.....NS......SHCAWLLEAP..PG
ENSDORP00000010499  ..............------CGE..TL.Q.DST.GNFSSPeypng....YS.....AH......MHCVWRISVT..PG
ENSDORP00000007010  ..............------CGG..LL.T.KLN.GTITTPgwpke....YP.....PN......KNCVWQVVAP..IQ
ENSDORP00000007555  .............s---------..--.-.SAE.GTLATPnwpdk....YP.....SR......RECTWNISST..AG
ENSDORP00000013761  ..............-----GCGG..NL.T.GLQ.GTFSTPnslqq....YP.....VQ......QLCTWHISVP..VG
ENSDORP00000002147  ..............------CGG..VL.T.GLS.GVLTSPeypnn....YP.....NN......VECHWVIHAS..GP
ENSDORP00000000799  ..............------CGG..DV.T.GES.GYVASEgfpnl....YP.....PN......KECIWTITVP..DG
ENSDORP00000015304  ..............------CGG..IL.N.GTY.GSIKSPgypgn....YP.....PG......RDCVWRILTS..PG
ENSDORP00000015304  .............l---------..--.S.GAS.GTFSSPgypqn....YP.....HN......KECLWYLTTE..PG
ENSDORP00000006981  ..............-----PCGG..DL.T.GPS.GVILSPnypep....YP.....PG......KECDWKVTVS..AD
ENSDORP00000011611  ..............-----DCSK..NF.T.SPN.GTIESPgfpek....YP.....HN......LDCTFTILAT..PK
ENSDORP00000013122  ..............------CGG..RL.E.KPS.GSFKTPnwpdrd...YP.....AG......VTCVWHILAP..KN
ENSDORP00000010377  ..............-----QCGI..WVrT.SNG.GHFASPnypns....YP.....PN......KECIYILEAA..PR
ENSDORP00000011252  ..............PLCIATCGG..TL.T.KLG.GVILSPgfpga....YP.....NN......LDCTWRISLP..AG
ENSDORP00000002147  .............t---------..--.-.AVR.GNFSSPqypgs....YP.....NN......IRCHWTIRLP..PG
ENSDORP00000011611  .............d---------..--.-.--A.GYITSPgypqd....YP.....SH......QNCEWVVYAPe.PN
ENSDORP00000015304  ..............---------..-I.T.DSS.GTISSPlypnk....YA.....ND......ENCSWILQAQp.PF
ENSDORP00000015304  ..............-----GCGG..NF.T.TST.GVFTSPnypmp....YY.....HS......SECYWLLKAS..HG
ENSDORP00000002285  .............k------CGG..TIkI.ESP.GYLTSPgyphs....YH.....PS......EKCEWLIQAPd.QY
ENSDORP00000011252  ..............------CGG..NL.T.GPA.GVILSPnypqp....YP.....PG......KECDWRIKVN..AD
ENSDORP00000011252  ..............---------..-F.T.ASS.GIILSPnypee....YG.....NN......MNCVWLIISE..PG
ENSDORP00000015304  .............k----HGCGG..YV.S.GSQ.GSLVSPdsdsngr..YD.....KG......LNCIWFITAP..DN
ENSDORP00000011592  ..............PICIFPCLS..NF.T.APM.GTVLSPdypeg....YG.....NN......LNCIWTIISD..PG
ENSDORP00000015304  ..............------CGG..NL.H.MGE.GIFDSPgypdv....YP.....PN......VECVWNIVSS..PG
ENSDORP00000015304  ..............-----DCNR..EY.N.QAF.GTLKSPgwpnn....YN.....GD......MDCTVILNAP..QD
ENSDORP00000006981  ..............PTCVVPCGG..NL.T.ERR.GTILSPgfpet....YL.....NS......LNCVWKIMVP..EG
ENSDORP00000006981  ..............-----QCGG..AV.E.EME.GVILSPgfpgn....YP.....SN......MDCSWKIALP..VG
ENSDORP00000011592  ..............-----PCGG..VL.T.KRK.GTILSPgypep....YD.....NN......LNCIWKITVP..EG
ENSDORP00000015304  ..............-----GCGG..IF.Q.APN.GEIHSPnypny....YR.....SN......TDCSWVIQVE..QH
ENSDORP00000012274  ........cgetpe---------..QI.R.APS.GIITSPgwpse....YP.....SK......INCSWLIRAN..PG
ENSDORP00000006981  ..............PVCVFSCFF..NF.T.SPS.GIVLSPnyped....YG.....NH......LHCVWLILAR..PE
ENSDORP00000015304  .............d---------..--.-.-SE.GYVTSPsypan....YP.....QN......VDCIWILEAL..PG
ENSDORP00000011592  .............lPRCEALCGG..NI.T.AMN.GTIYSPgypde....YP.....NF......QDCFWLVRVP..PG
ENSDORP00000014291  .........cthvv---------..EL.N.DMF.GQIQSPgypds....YP.....SD......SEVTWNITVP..EG
ENSDORP00000014291  .............e------CSD..NLfT.QMT.GMITSPdypnp....YP.....KS......SECLYTIGLE..EG
ENSDORP00000015010  ..............---------..--.-.--E.GVFNSPkypsk....YP.....PE......RECVYIIEAA..PR
ENSDORP00000015304  ..............------CEE..VL.T.GST.GTIVSPgspv.....YP.....NG......VNCTWNILVQ..PG
ENSDORP00000015625  ............lg---------..--.-.SES.GTLSSKnypqt....YP.....NS......SVCEWEIRVK..LT
ENSDORP00000015304  .......cdnvvia---------..--.N.QTY.GILESInypnp....YS.....PN......QRCNWTIQAT..KG
ENSDORP00000012348  ..............-----SCRL..VL.S.NPS.GTFTSPcypsd....YP.....NI......QACMWTLRAP..TG
ENSDORP00000015304  ..............-----SCGG..DL.R.VPM.GTFTSPnypfp....NP.....HG......RLCEWRITAE..EG
ENSDORP00000006248  .............d------CGGpfEL.W.EPN.TTFSSPnfpnn....YP.....NQ......AFCVWNLNAQ..KG
ENSDORP00000007006  ..............------CSGq.VF.T.ARS.GELSSPeypep....YP.....KL......SSCTYSIRLE..ES
ENSDORP00000004721  .............e------CSR..ELhT.EPS.GFISSLeyprp....YP.....PD......LRCNYSIRVD..RG
ENSDORP00000011252  .............fPRCDAPCGY..NV.T.AHN.GTIYSPgfpde....YP.....VL......KDCLWLITVS..PG
ENSDORP00000007555  ............nn---------..--.-.---.------.........YP.....SQ......ARCDWVIVAE..DG
ENSDORP00000015304  .............v---------..--.-.GSH.GRIASPfwpgn....YP.....DN......SNYKWTVTVN..TS
ENSDORP00000002177  .......csgkleq---------..-H.T.ERR.GVIYSPawpln....YP.....PG......TNCSWYIQGD..RG
ENSDORP00000011592  .............e---------..--.-.-SS.GRILSPgypfp....YD.....NN......LRCMWMIEVD..PG
ENSDORP00000015304  ..............-----QCGG..SY.T.NPE.GEILLSdfsgp....LA.....HG......GQCIYIITLP..PG
ENSDORP00000013761  ..............------CGG..LL.P.GPS.GFFSSPnypdp....YP.....PN......AHCVWQIQVA..KD
ENSDORP00000006981  .............lPTCVAECGG..IL.RgELS.GQVLSPgypap....YE.....HN......LNCIWTIEAD..AG
ENSDORP00000015304  ..............-----GCGG..TL.Y.GDA.GLLTSPgfpst....YP.....NN......THCEWTVFAP..SG
ENSDORP00000011592  ..............------CGC..NL.Q.GPS.GTFTSPnfpfq....YD.....SN......AQCVWVITAVn.TN
ENSDORP00000011252  ..............-----ECGA..RV.R.GNE.GTLLSPnfpsn....YD.....NN......HECIYKIETE..AG
ENSDORP00000011252  ..............---------..--.T.ESS.GIILSPg........YP.....GNyfns..QTCSWSIKVE..PN
ENSDORP00000006981  ..............---------..-L.T.DST.GVILSQsypgs....YP.....QF......QTCSWLVRVE..PD
ENSDORP00000015304  ..............-----QCGG..TV.A.GQS.GVIESIgypslp...YP.....HN......SLCQWHLQGL..QG
ENSDORP00000011592  .............d---------..--.-.-ST.GVILSPgypds....YP.....NL......QMCAWSISVE..KG
ENSDORP00000012274  ..............------CGQ..WL.K.YFY.GTFNSPnypdf....YP.....PG......SNCTWLIDTG..DH
ENSDORP00000015304  .............f---------..--.-.---.--LFSPgwpdt....YS.....DF......LDCTWIIHAD..--
ENSDORP00000006981  ..............-----PCGG..NI.S.SPN.GTVYSPgypsp....YS.....SS......QDCVWLITVP..IG
ENSDORP00000015304  ..............---------..--.-.--E.GTIRSPfypnv....YP.....GE......RTCRWTIYQP..QG
ENSDORP00000011592  ..............-----ECGA..SA.T.NNE.GILLSPnypln....YE.....NN......HECIYSIQVQ..AG
ENSDORP00000013166  .............n---------..--.-.---.GHVQSPrfpss....YP.....RN......LLLTWRLHSQ..EK
ENSDORP00000006875  ..............------CGG..EL.T.AVA.GVVLSPnwpep....YA.....EG......EDCVWRIHVG..EE
ENSDORP00000015304  .............f---FSRCGR..NF.T.NSM.GYILSPnfpkq....YD.....NN......MNCTYIIEAD..AQ
ENSDORP00000008928  ...........rcq---------..VL.R.ASK.GQIMLEs........YT.....LN......AHWKWTIHDK..AW
ENSDORP00000007455  ...........vlr---------..--.-.EAP.GFVTDGagn......YS.....VN......GNCEWLIEAPs.PQ
ENSDORP00000015304  ..............------CGG..TL.S.NVLgGNFTSPgysrltk..YS.....KN......LNCEWTISNPkhEN
ENSDORP00000006981  .............l---------..--.Q.GPN.GTVESPgfpyg....YP.....NY......ANCTWTITAE..DQ
ENSDORP00000006981  .............rPLCTAPCGG..QY.V.GSD.GVVLSPnypqn....YT.....SG......QSCLYFVTVP..KD
ENSDORP00000005467  .............q---CQHCGGrfRL.T.GSS.GFVTDGpgn......YK.....YK......TKCTWLIEGQ..PN
ENSDORP00000002953  ............lg---------..--.-.EFT.GYIESPnypgn....YP.....AG......VECIWNINPP..PK
ENSDORP00000015304  ..............-----GCGG..IF.H.SDS.GTIQSPywpqn....FP.....PN......SQCSWTAITH..ES
ENSDORP00000007555  ..............-TCEVACGG..FI.T.KLN.GTITSPgwpg.....YP.....NK......NXXXXXXXXX..--
ENSDORP00000001143  .............e------CPG..VI.RnATT.GRIVSPgfpgn....YS.....NN......LTCHWLLEAP..ES
ENSDORP00000011592  ..............------CGG..TL.R.GSS.GIISSPsfpne....YH.....NN......ADCTWTIVAE..PG
ENSDORP00000007555  ..............------CGE..TL.Q.DTT.GNFSAPgfpng....YP.....SY......SHCVWRVSVT..PG
ENSDORP00000013122  ..............---------..--.-.---.------.........--.....--......--------VP..EG
ENSDORP00000011592  ..............------CGG..TL.K.GLN.GTIESPgfpyg....YP.....NG......ANCTWVIIAE..ER
ENSDORP00000007698  ..............------CGG..EL.S.EPA.GVVLSPdwpqs....YS.....PS......QDCMWILHVQ..EE
ENSDORP00000004244  csfalharggeltr---------..--.F.ATP.GFPDSP.........YP.....AH......ARCQWALRGD..AN
ENSDORP00000006624  .............y----SDCGG..LI.R.ESE.GRLVNY.........IG.....PR......TYCVWVIEMK..HD
ENSDORP00000006632  .............a---------..--.-.---.------.........--.....-N......ENCVWTIQKP..EN
ENSDORP00000015304  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000010377  .............i----PDCQF..EL.S.GAD.GIVRSSqveqedktkPG.....QA......VDCIWTIKAT..PK
ENSDORP00000006981  ............rm------CDA..HL.R.GPX.XXXXXXxxxxx....XX.....XX......XHCVWIITALn.PA
ENSDORP00000004606  ..............-----PCNL..TL.E.DFY.GVFSSPgyshlas..VS.....HP......QSCLWLLDPH..DG
ENSDORP00000004244  ..............------CGG..NL.R.EAQ.GTFSPY.........YP.....XXxxxx..XXXXXXXXVP..NN
ENSDORP00000015304  ...........pqs---------..--.-.---.--LSSPhlstp....SF.....PF......SMCTWVIQAP..PQ
ENSDORP00000006248  ..............------CDGrfLL.T.GSS.GSFQAVh........YPplatsSS......IICQWIIRVK..QG
ENSDORP00000004721  .............l---------..--.-.--F.GTVTSPrypkp....YP.....NN......VETTTVIEVP..RG
ENSDORP00000007698  ............ts---PVLCNN..NI.S.EGE.GYVESPdlgs.....T-.....-GsrtlglLDCTYSIHVY..PG
ENSDORP00000007698  ..............PSCVASCGG..II.HnATL.GRIVSPepgga....AG.....PN......LTCRWVIEAD..EG
ENSDORP00000011592  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000011252  ..............------CGG..YI.H.GKS.GTVLSPgfpdf....YP.....NS......LNCTWTIEVS..HG
ENSDORP00000006632  ..........evdd---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000006875  ..............PVCSAPCGG..AV.RnATI.GRVLSPsaqg.....HN.....GT......QLCVWTVEAP..EG
ENSDORP00000006629  ..............-----SCGG..VI.S.SLS.GLFSSPqypen....YP.....TD......IQCVWEIHVD..KK
ENSDORP00000011592  ..............-----PCGG..HF.S.APS.GVILSPgwpgy....YK.....DS......LNCEWVIEAE..PG
ENSDORP00000011592  ..............PTCDALCGG..DV.R.GPS.GTILSPgypef....YP.....NS......LNCTWTVDVT..HG
ENSDORP00000002177  ............dl-----ACGR..RL.G.SFY.GSFASPdlfgaar..GP.....SD......LHCTWLVDTQ..DP
ENSDORP00000002906  ..............---------..--.-.---.------.........--.....--......----------..PN
ENSDORP00000013885  ............ld---------..--.-.-LQ.GVLSTPyfpsy....YS.....PS......THCSWHLTVPs.LD
ENSDORP00000006981  ..............-----ECGN..SV.T.GTQ.GTLLSPnfpvn....YN.....NN......HECIYSIQTQ..PG
ENSDORP00000001143  ..............------CSG..EI.T.DSA.GVVLSPnwpep....YG.....RG......QDCIWGVHVE..ED
ENSDORP00000010573  .....centvsvke---------..-T.T.GFE.GKILSPyypsy....YP.....PK......CKCVWKFQSPl.PT
ENSDORP00000010573  ..............---------..--.-.---.------.........--.....--......-MCHFKLVAI..MG
ENSDORP00000014842  ..............-----GCGH..IV.TsQDS.GTMTSKnypgt....YP.....NH......TVCEKTITVP..KG
ENSDORP00000011252  ..............-----PCGG..HL.T.ASS.GVILPPgwpgy....YK.....DS......LSCEWIIEAK..PG
ENSDORP00000007006  .............f---------..--.-.---.GRLASPdfpgp....YP.....HD......RHYRWNMAAP..PG
ENSDORP00000015304  .............d---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000011592  ..............-----QCGG..SM.S.DFS.GVILSPgfpgn....YP.....SS......LDCTWTIKLP..IG
ENSDORP00000015010  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000002065  ..pyrralrcldml---------..--.-.SLP.GQFTFTa........DQ.....PQ......LHCAAFFIGE..PQ
ENSDORP00000009716  .............s---------..--.-.-SN.GSIHSPrfpht....YP.....RN......MVLVWRLVTA..EN
ENSDORP00000006981  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000002285  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000015304  ..............---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000011592  ..............-----PCGS..RS.T.GSE.GTVLSPn........YP.....KNysvg..HNCVYSIAVP..KE
ENSDORP00000011252  ...........vfg---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000004606  .............v---------..-L.L.EVQ.GTLQRPlsres....RS.....SP......ANCTWLILGS..KE
ENSDORP00000007010  .............x---------..--.-.---.------.........--.....--......----------..--
ENSDORP00000001143  ............qp---PGPCSW..NF.S.GPE.GSLDSPt........LP.....NSpsdvg.LDCFYYISVY..PG
ENSDORP00000010499  .............p---------..--.-.---.------.........--.....--......----------..--

                       40         50                                                                
                        |          |                                                                
d1sfpa_               YHVRVSIQ.YLQLN.................C.N............................................
ENSDORP00000010499  HRVKLTFM.EMDIEsqpe.............C.A............................................
ENSDORP00000007010  HRIKLVFS.EFEVEqhqe.............C.A............................................
ENSDORP00000007010  YHVGLNFQ.AFEIErhdn.............C.A............................................
ENSDORP00000007555  FHVGLTFQ.AFEIErhds.............C.A............................................
ENSDORP00000010499  FHVGLTFQ.SFEIErhds.............C.A............................................
ENSDORP00000010499  YRISLQFD.FFETEgndv.............C.K............................................
ENSDORP00000000799  QVIALTFG.KFDVEpdty.............C.R............................................
ENSDORP00000015304  HTITLTFR.DIDIEnhvt.............C.S............................................
ENSDORP00000010499  EKIILNFT.SMDLYrsrl.............C.W............................................
ENSDORP00000007010  YRISVKFE.FFELEgnev.............C.K............................................
ENSDORP00000007555  HRVKLTFN.EFEIEqhqe.............C.A............................................
ENSDORP00000013761  HGIELQFH.NFSLEehde.............C.Q............................................
ENSDORP00000002147  AAVKLVFM.DFQVEgseq.............C.T............................................
ENSDORP00000000799  QTVSLSFR.VFDLElhps.............C.R............................................
ENSDORP00000015304  LLITFTFG.TLSLEshed.............C.N............................................
ENSDORP00000015304  SSIQLTIH.DIDMEfyrd.............C.L............................................
ENSDORP00000006981  YVIALVFN.IFNLE.................P.G............................................
ENSDORP00000011611  MEIILQFL.TFDLEhdplqvgegd.......C.K............................................
ENSDORP00000013122  KLIELKFE.KFDLErdny.............C.R............................................
ENSDORP00000010377  QRIELTFDeHYYIEpsfe.............C.R............................................
ENSDORP00000011252  YGVHIQFL.NFSTE.................A.N............................................
ENSDORP00000002147  YRVKVFFL.DVDLEepnsltrt.........C.D............................................
ENSDORP00000011611  QKIVLNFNpHFEIEkhd..............C.K............................................
ENSDORP00000015304  NHITLSFI.HFGLEsssn.............C.T............................................
ENSDORP00000015304  SPFQLNFT.EFHLEyhpn.............C.S............................................
ENSDORP00000002285  QRIMINFNpHFDLEdrd..............C.K............................................
ENSDORP00000011252  FVIALIFK.SFNME.................P.S............................................
ENSDORP00000011252  SRIHLIFN.DFDVE.................P.Q............................................
ENSDORP00000015304  KLINLTFN.TFVLEhssslgr..........C.A............................................
ENSDORP00000011592  SRIHLSFN.DFDLE.................S.Q............................................
ENSDORP00000015304  NQLQLSFI.SFQLEdspn.............C.S............................................
ENSDORP00000015304  HNISLFFQ.SFALEdsne.............C.S............................................
ENSDORP00000006981  AGIQIQVI.SFVTE.................Q.N............................................
ENSDORP00000006981  FGAHIQFL.NFSTE.................P.N............................................
ENSDORP00000011592  AGIQVQVV.SFATE.................H.N............................................
ENSDORP00000015304  HRVLLNFT.DIDLE.................P.P............................................
ENSDORP00000012274  EIITISFQ.DFDIQgsrr.............C.S............................................
ENSDORP00000006981  SRIHLAFN.DIDVE.................P.Q............................................
ENSDORP00000015304  RSILLTFEdQFNIEatpn.............C.T............................................
ENSDORP00000011592  NGIYINFT.VLQTE.................P.I............................................
ENSDORP00000014291  FRIKLYFM.HFNLEssyl.............C.E............................................
ENSDORP00000014291  FVISLQFEdTFDIEdhpevp...........C.P............................................
ENSDORP00000015010  QCIELYFDeKYSIEpswe.............C.K............................................
ENSDORP00000015304  HLIRFEFK.KFHLEfhsn.............C.T............................................
ENSDORP00000015625  ERIRIKFG.DFDIEdsds.............C.H............................................
ENSDORP00000015304  NTVNYTFL.GFEMEhspn.............C.S............................................
ENSDORP00000012348  YIIQITFN.DFDIEeapg.............C.I............................................
ENSDORP00000015304  RKITLTFD.DLKLGirps.............C.E............................................
ENSDORP00000006248  KNIQVHFQ.EFDLE.................N.V............................................
ENSDORP00000007006  FRLSLDFVgSFDVEthpeaq...........C.P............................................
ENSDORP00000004721  FSLHLKFLePFDIDdhqqvh...........C.P............................................
ENSDORP00000011252  HGVYINFT.LLQTE.................A.V............................................
ENSDORP00000007555  YGVELIFR.TFEVEeeae.............C.G............................................
ENSDORP00000015304  QVIHGRIL.ELDIElttn.............C.Y............................................
ENSDORP00000002177  DMITISFR.NFDVEeshq.............C.S............................................
ENSDORP00000011592  NIVSLQFL.AFDTE.................A.S............................................
ENSDORP00000015304  EQIDLNFT.HVELEgqng.............C.S............................................
ENSDORP00000013761  QAIQLKIE.ALGIEgvas.............C.L............................................
ENSDORP00000006981  CTIGLHFL.VFDTE.................E.V............................................
ENSDORP00000015304  RPLTISFD.PVIIDdpgn.............C.I............................................
ENSDORP00000011592  KVIQINFE.EFDLE.................I.G............................................
ENSDORP00000011252  QGIRLSAH.GFQLS.................-.E............................................
ENSDORP00000011252  FNITIFVD.TFQSE.................K.Q............................................
ENSDORP00000006981  YNISLTVE.YFLSE.................K.Q............................................
ENSDORP00000015304  HYLTIFED.ILQDSpg...............C.G............................................
ENSDORP00000011592  YNISMFIE.FFQTE.................K.E............................................
ENSDORP00000012274  RKVILRFT.DFKLDgt...............G.Y............................................
ENSDORP00000015304  STVEFNLL.SVDIEshqt.............C.Q............................................
ENSDORP00000006981  HGVHLNLS.LLQTE.................P.S............................................
ENSDORP00000015304  QIIHLNFT.GFHVGtstn.............C.D............................................
ENSDORP00000011592  KGINISAR.TFHLA.................-.Q............................................
ENSDORP00000013166  TRIQLTFDhQFGLEeaenei...........C.R............................................
ENSDORP00000006875  KRIFLDVQ.FLNLS.................-.H............................................
ENSDORP00000015304  SVVSLTFV.NFRLEarsaitgr.........C.D............................................
ENSDORP00000008928  FIIQIRFS.MLSLEfdym.............C.Q............................................
ENSDORP00000007455  HRILLDFL.FLDTE.................C.T............................................
ENSDORP00000015304  SSIYIQFN.HFFLEshqd.............C.Q............................................
ENSDORP00000006981  HRVQLVFQ.SFALE.................E.Dfdvlsvfdgppqpenlrtxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000006981  YVVFGQFA.FFHTA.................-.L............................................
ENSDORP00000005467  RIMRLRFN.HFATE.................C.S............................................
ENSDORP00000002953  RKILIVVP.EIFLPsed..............E.C............................................
ENSDORP00000015304  EHLEIHFDrNFRIPsadaq............C.Q............................................
ENSDORP00000007555  --------.----XxxxxxxxxxxxxxxxxvC.K............................................
ENSDORP00000001143  QRLHLHFE.KVSLA.................E.D............................................
ENSDORP00000011592  DTISLIFT.DFQME.................E.K............................................
ENSDORP00000007555  EKIILNFT.SMDLFksrl.............C.W............................................
ENSDORP00000013122  KVVVLNFR.FIDLEsdnl.............C.R............................................
ENSDORP00000011592  NRIQIVFQ.SFALE.................E.E............................................
ENSDORP00000007698  RRILLQVE.ILNVR.................-.E............................................
ENSDORP00000004244  SVLSLTFR.SFDVApctg.............Q.N............................................
ENSDORP00000006624  QHIAMAIP.SLKPHslt..............C.E............................................
ENSDORP00000006632  KNLRIIFS.HIQLDpegt.............C.D............................................
ENSDORP00000015304  ------FS.DFDVDpsaf.............C.S............................................
ENSDORP00000010377  AKIYLRFL.DYQMEhsne.............C.K............................................
ENSDORP00000006981  KVIKLAFE.EFDLE.................R.G............................................
ENSDORP00000004606  RRLAVRFT.ALDLG.................-.Y............................................
ENSDORP00000004244  QNVKVRFK.LFYLLdhdmqpgt.........C.S............................................
ENSDORP00000015304  QQVKITVD.ALKLLspd..............C.E............................................
ENSDORP00000006248  LSIQLSFD.SFNTY.................-.Y............................................
ENSDORP00000004721  YRVKLVFR.MFDVEpsea.............C.F............................................
ENSDORP00000007698  YGIEIQVQ.TLNLS.................Q.E............................................
ENSDORP00000007698  RRLHLHFE.RVSLD.................E.D............................................
ENSDORP00000011592  --------.-FSIE.................P.N............................................
ENSDORP00000011252  K-VQMVFH.TFHLE.................S.S............................................
ENSDORP00000006632  --------.----K.................C.R............................................
ENSDORP00000006875  QKLHLHLE.KLALH.................-.G............................................
ENSDORP00000006629  FHIELMIP.SLNV-.................-.-............................................
ENSDORP00000011592  HSIKITFE.-----.................-.-............................................
ENSDORP00000011592  KXXXXXXX.XXXXX.................X.X............................................
ENSDORP00000002177  RRVLLQLE.L---Rl................G.Y............................................
ENSDORP00000002906  AVLRLRFN.HFATE.................C.S............................................
ENSDORP00000013885  YGLALWFD.AYALRrqkydlp..........C.T............................................
ENSDORP00000006981  KGIQLRAK.AFELS.................-.-............................................
ENSDORP00000001143  KRIMLDVR.VLRIP.................-.-............................................
ENSDORP00000010573  FGIALKFH.NYSITkkttkg...........C.E............................................
ENSDORP00000010573  YLIRLSIE.SIQLEadn..............C.V............................................
ENSDORP00000014842  KSLILRLG.DVNIEsqs..............C.A............................................
ENSDORP00000011252  HSIKITFD.-----.................-.-............................................
ENSDORP00000007006  HRLLFYST.NYQLElsyl.............C.E............................................
ENSDORP00000015304  --------.-----.................-.-............................................
ENSDORP00000011592  --------.-----.................-.-............................................
ENSDORP00000015010  --IYLRFL.DYEMQnsne.............C.K............................................
ENSDORP00000002065  EFITIHYD.LVSID.................CqG............................................
ENSDORP00000009716  MWIQLTFDeRF---.................-.-............................................
ENSDORP00000006981  --VFFTFH.TFHLE.................S.G............................................
ENSDORP00000002285  --------.-----.................-.-............................................
ENSDORP00000015304  --------.-----.................-.-............................................
ENSDORP00000011592  --------.-----.................-.-............................................
ENSDORP00000011252  -----QFA.YFQTA.................-.L............................................
ENSDORP00000004606  QTVTI-FQ.KLHLA.................C.S............................................
ENSDORP00000007010  --IVLNFT.TMDLYkssl.............C.W............................................
ENSDORP00000001143  YGVEI---.-----.................-.-............................................
ENSDORP00000010499  --------.-----.................-.-............................................

d1sfpa_               ..............................................................................
ENSDORP00000010499  ..............................................................................
ENSDORP00000007010  ..............................................................................
ENSDORP00000007010  ..............................................................................
ENSDORP00000007555  ..............................................................................
ENSDORP00000010499  ..............................................................................
ENSDORP00000010499  ..............................................................................
ENSDORP00000000799  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000010499  ..............................................................................
ENSDORP00000007010  ..............................................................................
ENSDORP00000007555  ..............................................................................
ENSDORP00000013761  ..............................................................................
ENSDORP00000002147  ..............................................................................
ENSDORP00000000799  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013122  ..............................................................................
ENSDORP00000010377  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000002147  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000012274  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000014291  ..............................................................................
ENSDORP00000014291  ..............................................................................
ENSDORP00000015010  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000015625  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000007006  ..............................................................................
ENSDORP00000004721  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000007555  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000002177  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000013761  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000012274  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000013166  ..............................................................................
ENSDORP00000006875  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000008928  ..............................................................................
ENSDORP00000007455  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006981  xxxxxxxxxxxxxlpshtcgnpgrlpngiqqgstfnlgdkvryscnpgffleghavltchagfensamwdfplpscrx
ENSDORP00000006981  ..............................................................................
ENSDORP00000005467  ..............................................................................
ENSDORP00000002953  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000007555  ..............................................................................
ENSDORP00000001143  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000007555  ..............................................................................
ENSDORP00000013122  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000007698  ..............................................................................
ENSDORP00000004244  ..............................................................................
ENSDORP00000006624  ..............................................................................
ENSDORP00000006632  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000010377  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000004606  ..............................................................................
ENSDORP00000004244  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000004721  ..............................................................................
ENSDORP00000007698  ..............................................................................
ENSDORP00000007698  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000006632  ..............................................................................
ENSDORP00000006875  ..............................................................................
ENSDORP00000006629  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000002177  ..............................................................................
ENSDORP00000002906  ..............................................................................
ENSDORP00000013885  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000001143  ..............................................................................
ENSDORP00000010573  ..............................................................................
ENSDORP00000010573  ..............................................................................
ENSDORP00000014842  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000007006  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000015010  ..............................................................................
ENSDORP00000002065  ..............................................................................
ENSDORP00000009716  ..............................................................................
ENSDORP00000006981  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000015304  ..............................................................................
ENSDORP00000011592  ..............................................................................
ENSDORP00000011252  ..............................................................................
ENSDORP00000004606  ..............................................................................
ENSDORP00000007010  ..............................................................................
ENSDORP00000001143  ..............................................................................
ENSDORP00000010499  ..............................................................................

d1sfpa_               ...........................................................KESLEIID...........
ENSDORP00000010499  ...........................................................YDHLEVFD...........
ENSDORP00000007010  ...........................................................YDHLEVFD...........
ENSDORP00000007010  ...........................................................YDYLEVRD...........
ENSDORP00000007555  ...........................................................YDYLEIRD...........
ENSDORP00000010499  ...........................................................YDYLEVRD...........
ENSDORP00000010499  ...........................................................YDFVEVRS...........
ENSDORP00000000799  ...........................................................YDSVSVFN...........
ENSDORP00000015304  ...........................................................WDSVTVRN...........
ENSDORP00000010499  ...........................................................YDYVEVRD...........
ENSDORP00000007010  ...........................................................YDFVEIWS...........
ENSDORP00000007555  ...........................................................YDHLEMYD...........
ENSDORP00000013761  ...........................................................FDYVEVYE...........
ENSDORP00000002147  ...........................................................YDYVAVLG...........
ENSDORP00000000799  ...........................................................YDALEVFA...........
ENSDORP00000015304  ...........................................................KDYLEIRD...........
ENSDORP00000015304  ...........................................................YDALEIYG...........
ENSDORP00000006981  ...........................................................YDFLHIYD...........
ENSDORP00000011611  ...........................................................YDWLDIWD...........
ENSDORP00000013122  ...........................................................YDYVAVFN...........
ENSDORP00000010377  ...........................................................FDHLEVRD...........
ENSDORP00000011252  ...........................................................HDYLEIQN...........
ENSDORP00000002147  ...........................................................FDHLAAFD...........
ENSDORP00000011611  ...........................................................YDFIEIRD...........
ENSDORP00000015304  ...........................................................RDFVEILD...........
ENSDORP00000015304  ...........................................................LDYLAVYD...........
ENSDORP00000002285  ...........................................................YDYVEVID...........
ENSDORP00000011252  ...........................................................YDFLHIYE...........
ENSDORP00000011252  ...........................................................FDFLAVKD...........
ENSDORP00000015304  ...........................................................YDYVKIFD...........
ENSDORP00000011592  ...........................................................FDFLAVKD...........
ENSDORP00000015304  ...........................................................KDFLEIRE...........
ENSDORP00000015304  ...........................................................HDFLEIRN...........
ENSDORP00000006981  ...........................................................WDSLEVFD...........
ENSDORP00000006981  ...........................................................HDFIEIRN...........
ENSDORP00000011592  ...........................................................WDSLDFYD...........
ENSDORP00000015304  ...........................................................DSCIMTYD...........
ENSDORP00000012274  ...........................................................LDWLTIET...........
ENSDORP00000006981  ...........................................................FDFLVIKD...........
ENSDORP00000015304  ...........................................................SSYLEVRD...........
ENSDORP00000011592  ...........................................................YDFITVWD...........
ENSDORP00000014291  ...........................................................YDYVKV--...........
ENSDORP00000014291  ...........................................................YDYIKIKA...........
ENSDORP00000015010  ...........................................................FDHIEVRD...........
ENSDORP00000015304  ...........................................................KDYLEVYD...........
ENSDORP00000015625  ...........................................................FNYLRIYN...........
ENSDORP00000015304  ...........................................................LEYLELYD...........
ENSDORP00000012348  ...........................................................YDSLSLD-...........
ENSDORP00000015304  ...........................................................NERVIVYN...........
ENSDORP00000006248  ...........................................................VDVVEIRD...........
ENSDORP00000007006  ...........................................................YDFLKIRT...........
ENSDORP00000004721  ...........................................................YDQLQIYA...........
ENSDORP00000011252  ...........................................................NDYIAVWD...........
ENSDORP00000007555  ...........................................................YDYMEAYD...........
ENSDORP00000015304  ...........................................................YDKLMLYD...........
ENSDORP00000002177  ...........................................................LDWLLLGP...........
ENSDORP00000011592  ...........................................................HDILRVWD...........
ENSDORP00000015304  ...........................................................HSYIEVRD...........
ENSDORP00000013761  ...........................................................FDRLEIFT...........
ENSDORP00000006981  ...........................................................HDVLRIWD...........
ENSDORP00000015304  ...........................................................QNYLILYN...........
ENSDORP00000011592  ...........................................................YDTLTIGD...........
ENSDORP00000011252  ...........................................................GDVLKVYD...........
ENSDORP00000011252  ...........................................................FDALEVFD...........
ENSDORP00000006981  ...........................................................YDEFEIFD...........
ENSDORP00000015304  ...........................................................KDFVEIWE...........
ENSDORP00000011592  ...........................................................FDVLQVYD...........
ENSDORP00000012274  ...........................................................GDYVKIYD...........
ENSDORP00000015304  ...........................................................FDKLVIRD...........
ENSDORP00000006981  ...........................................................GDFITVWD...........
ENSDORP00000015304  ...........................................................TDYVEIGT...........
ENSDORP00000011592  ...........................................................GDVLKIYD...........
ENSDORP00000013166  ...........................................................YDFVEVED...........
ENSDORP00000006875  ...........................................................SDVLTVYD...........
ENSDORP00000015304  ...........................................................HDGLHIIK...........
ENSDORP00000008928  ...........................................................YDYVEIRD...........
ENSDORP00000007455  ...........................................................YDYLFVYD...........
ENSDORP00000015304  ...........................................................SDALEFRL...........
ENSDORP00000006981  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX-------...........
ENSDORP00000006981  ...........................................................NDVVEVHD...........
ENSDORP00000005467  ...........................................................WDHLYVYD...........
ENSDORP00000002953  ...........................................................GDVLVMRK...........
ENSDORP00000015304  ...........................................................NSFVKVWS...........
ENSDORP00000007555  ...........................................................YDFVEVRS...........
ENSDORP00000001143  ...........................................................DDRLIIRN...........
ENSDORP00000011592  ...........................................................YDYLEIE-...........
ENSDORP00000007555  ...........................................................YDYVEVRD...........
ENSDORP00000013122  ...........................................................YDFVDVYN...........
ENSDORP00000011592  ...........................................................YDYLSLYD...........
ENSDORP00000007698  ...........................................................GDMLTLFD...........
ENSDORP00000004244  ...........................................................SDLVMVYD...........
ENSDORP00000006624  ...........................................................NEEVEILD...........
ENSDORP00000006632  ...........................................................NENIKVFD...........
ENSDORP00000015304  ...........................................................QDYLGIYD...........
ENSDORP00000010377  ...........................................................RNFVAVYD...........
ENSDORP00000006981  ...........................................................YDTLTVGD...........
ENSDORP00000004606  ...........................................................GDAVHVYD...........
ENSDORP00000004244  ...........................................................KDYVEING...........
ENSDORP00000015304  ...........................................................QNYLQLQD...........
ENSDORP00000006248  ...........................................................SDVLNIYE...........
ENSDORP00000004721  ...........................................................YDYV----...........
ENSDORP00000007698  ...........................................................EELLVLAG...........
ENSDORP00000007698  ...........................................................NDRLMVRS...........
ENSDORP00000011592  ...........................................................YDFLYIYD...........
ENSDORP00000011252  ...........................................................HDYLLITE...........
ENSDORP00000006632  ...........................................................FDFVAIYD...........
ENSDORP00000006875  ...........................................................RDRMAVYS...........
ENSDORP00000006629  ...........................................................--------...........
ENSDORP00000011592  ...........................................................--------...........
ENSDORP00000011592  ...........................................................XXXXXXXX...........
ENSDORP00000002177  ...........................................................DDYVQVYE...........
ENSDORP00000002906  ...........................................................WDHMYVYD...........
ENSDORP00000013885  ...........................................................QGQWIIQD...........
ENSDORP00000006981  ...........................................................--------...........
ENSDORP00000001143  ...........................................................GDVLTFYD...........
ENSDORP00000010573  ...........................................................HGWWEINE...........
ENSDORP00000010573  ...........................................................TDSLTIYD...........
ENSDORP00000014842  ...........................................................SNYLLFT-...........
ENSDORP00000011252  ...........................................................--------...........
ENSDORP00000007006  ...........................................................YNFI----...........
ENSDORP00000015304  ...........................................................--------...........
ENSDORP00000011592  ...........................................................--------...........
ENSDORP00000015010  ...........................................................RNFVAVYD...........
ENSDORP00000002065  ...........................................................GDFLKVFDgwilkgekfps
ENSDORP00000009716  ...........................................................--------...........
ENSDORP00000006981  ...........................................................HDYLLITE...........
ENSDORP00000002285  ...........................................................--------...........
ENSDORP00000015304  ...........................................................--------...........
ENSDORP00000011592  ...........................................................--------...........
ENSDORP00000011252  ...........................................................SDLAELFD...........
ENSDORP00000004606  ...........................................................SERLILHS...........
ENSDORP00000007010  ...........................................................YDYIEVRD...........
ENSDORP00000001143  ...........................................................--------...........
ENSDORP00000010499  ...........................................................--------...........

                                      70                       80        90            100          
                                       |                        |         |              |          
d1sfpa_               ...GLP...GSPVL..GKICE.........GSLM......DYRSSGSIMTVKYIR.EPEHP....ASFYEVLYFQ-..
ENSDORP00000015304  ...GP-...--NRI..GRYCG.........TQNPp.....AGSTTTSRLHVLFHT.DRYNHq...EKGFQMQW---..
ENSDORP00000012348  ...---...NGERE..TKFCG.........ATAKgl....SFNSSANEMHVSFSS.DFSIQ....KKGFSASY---..
ENSDORP00000013761  ...E--...PEGPL..LRVCG.........RVPPp.....TLNTNASRLRATFVS.DSSV-....-----------..
ENSDORP00000006981  ...GPQq..TSPQL..GVFTR.........SLAKk.....TAHSSTNQVLLKFHQ.DAATG....GI-F-------..
ENSDORP00000011592  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000007555  ...GYWr..KAPLL..-----.........----......---------------.-----....-----------..
ENSDORP00000011592  ...GHP...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000004244  ...---...-----..EKFCG.........ERSPf.....VVSSNSNKMTVRFHS.DHSYT....DTGFLAEYL--..
ENSDORP00000004721  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000011252  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000006629  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000011592  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000013885  ...---...-----..RRLCG.........LRTLqpyaerIPVAASTGITINFTS.QISLT....GPGVQVHYS--..
ENSDORP00000006981  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000001143  ...GDD...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000010573  ...---...-----..HMYCG.........SYIDhqt...IFRVPSPLVHIQLQC.SSRLS....DKPLVVEY---..
ENSDORP00000014842  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000011252  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000007006  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000011592  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000002065  sqdHPLp..TMERY..IDFCE.........SGLIrr....SIRSSQNVAMIFFRV.HEP--....GNGF-------..
ENSDORP00000009716  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000002285  ...---...-GPHI..GRYCG.........QKTPg.....RIRSSSGILSMVFYT.DSAIA....KEGFSANY---..
ENSDORP00000015304  ...---...-----..GRFCG.........NHPSs.....TVFTSDNQMFVQFIS.DRTQG....GQGFKIRYEA-..
ENSDORP00000011592  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000007010  ...GYWr..KSPLL..-----.........----......---------------.-----....-----------..
ENSDORP00000001143  ...---...-----..-----.........----......---------------.-----....-----------..
ENSDORP00000010499  ...---...-----..-----.........---Pe.....EVYSAGDSVLVKFHS.DDTIT....KKGFHLRYTS-..

d1sfpa_               ..---dpqa...
ENSDORP00000010499  ..---s......
ENSDORP00000007010  ..---s......
ENSDORP00000007010  ..---.......
ENSDORP00000007555  ..---.......
ENSDORP00000010499  ..---.......
ENSDORP00000010499  ..---f......
ENSDORP00000000799  ..---m......
ENSDORP00000015304  ..---n......
ENSDORP00000010499  ..---.......
ENSDORP00000007010  ..---f......
ENSDORP00000007555  ..---t......
ENSDORP00000013761  ..---.......
ENSDORP00000002147  ..---f......
ENSDORP00000000799  ..---.......
ENSDORP00000015304  ..---t......
ENSDORP00000015304  ..---p......
ENSDORP00000006981  ..---e......
ENSDORP00000011611  ..---l......
ENSDORP00000013122  ..---f......
ENSDORP00000010377  ..---i......
ENSDORP00000011252  qnC--p......
ENSDORP00000002147  ..---.......
ENSDORP00000011611  ..---f......
ENSDORP00000015304  ..---a......
ENSDORP00000015304  ..---q......
ENSDORP00000002285  ..---f......
ENSDORP00000011252  ..---k......
ENSDORP00000011252  ..---.......
ENSDORP00000015304  .pC--g......
ENSDORP00000011592  ..---ghnec..
ENSDORP00000015304  ..---f......
ENSDORP00000015304  ..---.......
ENSDORP00000006981  ..---glssc..
ENSDORP00000006981  ..---.......
ENSDORP00000011592  ..---.......
ENSDORP00000015304  ..---q......
ENSDORP00000012274  ..---f......
ENSDORP00000006981  ..---rhnec..
ENSDORP00000015304  ..---a......
ENSDORP00000011592  ..---qlrvc..
ENSDORP00000014291  ..---v......
ENSDORP00000014291  ..---.......
ENSDORP00000015010  ..---f......
ENSDORP00000015304  ..---i......
ENSDORP00000015625  ..---i......
ENSDORP00000015304  ..---f......
ENSDORP00000012348  ..---i......
ENSDORP00000015304  ..---.......
ENSDORP00000006248  ..---.......
ENSDORP00000007006  ..---.......
ENSDORP00000004721  ..---.......
ENSDORP00000011252  ..---qlkrc..
ENSDORP00000007555  ..---.......
ENSDORP00000015304  ..---d......
ENSDORP00000002177  ..---.......
ENSDORP00000011592  ..---s......
ENSDORP00000015304  ..---.......
ENSDORP00000013761  ..---e......
ENSDORP00000006981  ..---statsc.
ENSDORP00000015304  ..---.......
ENSDORP00000011592  ..---e......
ENSDORP00000011252  ..---.......
ENSDORP00000011252  ..---a......
ENSDORP00000006981  ..---s......
ENSDORP00000015304  ..---s......
ENSDORP00000011592  ..---y......
ENSDORP00000012274  ..---.......
ENSDORP00000015304  ..---h......
ENSDORP00000006981  ..---aiafsa.
ENSDORP00000015304  ..---t......
ENSDORP00000011592  ..---.......
ENSDORP00000013166  ..---.......
ENSDORP00000006875  ..---e......
ENSDORP00000015304  ..C--.......
ENSDORP00000008928  ..---tac....
ENSDORP00000007455  ..---lc.....
ENSDORP00000015304  ..---.......
ENSDORP00000006981  ..---v......
ENSDORP00000006981  ..---.......
ENSDORP00000005467  ..---mc.....
ENSDORP00000002953  ..---y......
ENSDORP00000015304  ..---f......
ENSDORP00000007555  ..---kdec...
ENSDORP00000001143  ..---.......
ENSDORP00000011592  ..---gsepp..
ENSDORP00000007555  ..---.......
ENSDORP00000013122  ..---.......
ENSDORP00000011592  ..---hpanf..
ENSDORP00000007698  ..---ke.....
ENSDORP00000004244  ..---f......
ENSDORP00000006624  ..---.......
ENSDORP00000006632  ..---d......
ENSDORP00000015304  ..---.......
ENSDORP00000010377  ..---ieppc..
ENSDORP00000006981  gsC--g......
ENSDORP00000004606  ..---.......
ENSDORP00000004244  ..---s......
ENSDORP00000015304  ..---lad....
ENSDORP00000006248  ..---.......
ENSDORP00000004721  ..---k......
ENSDORP00000007698  .sCG-.......
ENSDORP00000007698  ..---f......
ENSDORP00000011592  ..---a......
ENSDORP00000011252  ..---x......
ENSDORP00000006632  ..---v......
ENSDORP00000006875  ..---ekghc..
ENSDORP00000006629  ..---ipkdrcv
ENSDORP00000011592  ..---x......
ENSDORP00000011592  ..---nlepc..
ENSDORP00000002177  ..---kgyc...
ENSDORP00000002906  ..---sc.....
ENSDORP00000013885  ..---l......
ENSDORP00000006981  ..---dgdvl..
ENSDORP00000001143  ..---ltq....
ENSDORP00000010573  ..---.......
ENSDORP00000010573  ..---peqkc..
ENSDORP00000014842  ..---ss.....
ENSDORP00000011252  ..---x......
ENSDORP00000007006  ..---k......
ENSDORP00000015304  ..---.......
ENSDORP00000011592  ..---f......
ENSDORP00000015010  ..---.......
ENSDORP00000002065  ..---tlti...
ENSDORP00000009716  ..---gledped
ENSDORP00000006981  ..---dlepc..
ENSDORP00000002285  ..---.......
ENSDORP00000015304  ..---kylac..
ENSDORP00000011592  ..---f......
ENSDORP00000011252  ..---.......
ENSDORP00000004606  ..---d......
ENSDORP00000007010  ..---x......
ENSDORP00000001143  ..---k......
ENSDORP00000010499  ..---.......

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0043586 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Manihot esculenta v147 - Cassava
NoYes   Actinidia chinensis Hongyang
NoYes   Amborella trichopoda 22
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Bathycoccus prasinos
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   [Ruminococcus] obeum
NoYes   Saprospira grandis str. Lewin
NoYes   Flexibacter litoralis DSM 6794
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella ruminicola 23
NoYes   Fluviicola taffensis DSM 16823
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurovum sp. NBC37-1
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]