SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Spermadhesin, CUB domain alignments in Loxodonta africana 69_3

These alignments are sequences aligned to the 0043701 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                      10          20                        30          40         5
                                       |           |                         |           |          
d1sppb_               ...aring-----PDECGRVI..KDTSGSISNT.....DRQ.........K..NLCTWTILMK..PDQKVRMAIPY.L
ENSLAFP00000011535  ........--------CGGVL..SAPSGNFSSP.....NFPrlypy....N..IECNWLIVVA..EGSSVLLTFHA.F
ENSLAFP00000015430  .......g--------CDHKV..TSTSGTITSP.....NWPdkyps....K..KECTWAISST..PGHRVKLTFME.M
ENSLAFP00000001788  .......i-------------..HSPNGIITSP.....NWPdkyps....R..KECTWEISAT..PGHRVKLAFSE.F
ENSLAFP00000008208  .......e--------CGGVF..TDPKAIFKSP.....GFPneygd....N..QICYWHIRLK..YGQRIHLSFLD.F
ENSLAFP00000006852  ........--------CGGFI..SKLNGTITSP.....GWPkeypt....N..KNCVWQVVAP..VQYRISLQFEV.F
ENSLAFP00000006852  .......l-------------..SSAEGTLASP.....NWPdkyps....R..RECTWNISST..AGHRVKLTFNE.F
ENSLAFP00000015430  .......d-------------..---NGHIQSP.....NYPddyrp....S..KVCIWRIQVS..EGFHVGLTFQS.F
ENSLAFP00000006852  ........--------CGGDI..NKDAGQIQSP.....NYPddyrp....S..KECVWRITVS..EGFHVGLTFQA.F
ENSLAFP00000001788  ......rk-------------..--NEGQIQSP.....NYPddyr.....Pm.KECVWKITVS..EDYYVGLNFQA.F
ENSLAFP00000015430  ........--------CGGFL..TKLNGSITSP.....GWPkeypp....N..KNCIWQLVAP..TQYRISLQFDF.F
ENSLAFP00000001788  .......l-------------..QESNGNLSSP.....GFPngyp.....Sy.THCIWRVSVT..PGEKIVLNFTT.M
ENSLAFP00000015430  .......l-------------..QDSTGNFSSP.....EYPngysa....H..MHCVWRISVT..PGEKIILNFTS.M
ENSLAFP00000019561  ........--------CGGRM..EKAQGTLTTP.....NWPesdypp...G..ISCSWHIIAP..PDQVISLTFGK.F
ENSLAFP00000001788  ........--------CGGLL..TKLNGTITTP.....GWPkeypp....N..KNCIWQVVAP..TQYRISVKFEF.F
ENSLAFP00000006852  .......l-------------..QDTTGNFSAP.....GFPngyp.....Sy.SHCVWRISVT..PGEKIILNFTS.M
ENSLAFP00000001222  ........-------PCGGNL..TGSSGFILSP.....NFPhpyph....S..RDCDWTITVN..ADYVISLAFIS.F
ENSLAFP00000011535  ........--------CGGVL..TGLSGVLTSP.....EYPnkypn....N..VECHWVIRAT..GPATVKLVFMD.F
ENSLAFP00000011243  .......p-----QHGCGGYL..TGSNRTFATP.....DSDsngryds..N..LNCVWFISAP..INKLIKLTFNT.F
ENSLAFP00000002459  ........-------PCGGDL..TGPSGVILSP.....NYPepypp....G..KECDWKVTVS..PDYVIALVFNI.F
ENSLAFP00000003576  ........--------CGGRL..EGPSGSFKTP.....NWPdrdypa...G..VACVWHIVAP..ENQLIELMFEK.F
ENSLAFP00000011535  .......e--------CQEVY..TFMRGNFSSP.....QYPssypn....N..IRCHWIIRLP..PGYRVKVFFLD.L
ENSLAFP00000011243  ........-------GCGGEL..SGDIGSFSSP.....GYPnrypp....N..KECIWYIKTA..PGTSIQLTIHD.F
ENSLAFP00000006102  ........-------QCGIWVr.TSNGGHFASP.....NYPdsypp....N..KECIYILEAA..PRQRIELTFDEhY
ENSLAFP00000013784  .......d--------CSKNF..TSPNGTIESP.....GFPekyph....N..LDCTFTILAK..PKMEIVLQFLT.F
ENSLAFP00000001222  .......i--PKCGAPCGGHF..SAPSGVILSP.....GWPgyykd....S..LNCEWVIEAE..PGHSIKITFER.F
ENSLAFP00000009052  .......l-------------..NDMFGHIQSP.....GYPdsyps....D..SEVMWNITVP..EGFRIKLYFMH.F
ENSLAFP00000002138  .......v--PRCEAPCGGHL..TASSGVILPP.....GWPgyykd....S..LNCEWIIEAK..PGHSIKITFDR.F
ENSLAFP00000019561  ........--------CGGEV..TGESGYVASE.....GFPnlypp....N..KECIWTITVP..KAQTVSLSFRV.F
ENSLAFP00000024776  ........--------CGGLL..FGPKGFFSSP.....NYPdpypp....N..THCVWHIQVA..PGHAIQLKIDT.L
ENSLAFP00000013784  ......da-------------..----GYITSP.....GYPqdyps....H..QNCEWIVYAPe.PNQKIVLNFNPhF
ENSLAFP00000025560  .......s--------CGGFL..SQTSGQFSSP.....FYPgnypn....N..ARCIWDIEVR..SNHRVTVVFRD.V
ENSLAFP00000011243  .......l-------------..TNSFDTISSP.....FFPakyps....S..QNCSWIIQAQp.PFNHITLSFSH.F
ENSLAFP00000011243  .......e-------------..---SGTFTSP.....NFPsnypn....N..WECIYRITVG..TSKQIALHFTN.F
ENSLAFP00000002459  .......l---RCEAPCGGHL..TSPSGTILSP.....GWPgfykd....A..LSCAWVIEAQ..PGYPIKITFDR.F
ENSLAFP00000002520  .......e--------CSQNY..TTPSGVIKSP.....GFPekyp.....Ns.LECTYIIFAP..KMSEILLEFES.F
ENSLAFP00000002138  .......p---LCVATCGGTL..SSLSGVILSP.....GFPgaypn....N..LDCTWKITLP..IGYGAHIQFLN.F
ENSLAFP00000024776  ........-------GCGGNL..TGLQGTFSTP.....NQLqlyph....Q..QLCMWYVSVP..PGHHIELEFHN.F
ENSLAFP00000011243  ........------------L..TTPSGVFTSP.....NYPmpyyh....S..SECYWWLKSS..HGSPFELEFEN.F
ENSLAFP00000011243  ........--------CGGTF..HMAEGTFNSP.....GYPevyps....N..VECVWNIVSS..PGNQLQLSFIT.F
ENSLAFP00000002138  .......p---SCVVPCSGNF..TQRRGTVLSP.....GYPepygn....N..LNCVWKITVT..EGSGIQVQVIS.F
ENSLAFP00000002138  ........------------F..TAPSGIILSP.....NYPeeygn....N..MNCVWLIISE..PGSRIHLIFND.F
ENSLAFP00000002138  ........--------CGGNL..TGPAGVILSP.....NYPqpypp....G..KECDWRVKVN..PDFVIALIFKS.F
ENSLAFP00000001583  ........------------L..TNNSGSFSSP.....WYPkkypt....N..MVCAWDIQVD..TRAHVKLSFEV.L
ENSLAFP00000004942  ......ga-------------..--ESGTLTSI.....NYPqtyp.....Ns.TVCEWEIRVK..VGERVRIKFGD.F
ENSLAFP00000001222  ........------------F..TAPMGTVLSP.....DYPegygn....N..LNCIWTIISD..PGSRIHLSFND.F
ENSLAFP00000001222  ........-------PCGGIL..TKRKGTILSP.....GYPepydn....N..LNCVWKITVP..EGAGIQVQVVS.F
ENSLAFP00000002520  .......k--------CGGTIk.IENPGYLTSP.....GYPhsyhp....S..EKCEWLIQAPy.PYQRIMINFNPhF
ENSLAFP00000014838  ......gd-----CMRCGQVL..RVPKGQILLE.....SYPl........N..AHCEWTIHAK..PGFNIQLRFVM.L
ENSLAFP00000008183  ......dg-------------..----GVFTSP.....NYPskypp....D..RECIYIIEAA..PRQCIELYFDEkY
ENSLAFP00000011243  .......e--------CGGDL..QGPTGTFTSP.....NYPnpnph....S..RICEWKIAVQ..EGRRITLTFNN.L
ENSLAFP00000001222  .......p---ICLAQCGGAM..SDFSGVILSP.....GFPgnyps....S..LDCTWTIKLP..IGFGVHLQFVN.F
ENSLAFP00000009052  .......e--------CSDNLf.TQRTGIITSP.....DFPnpypk....S..SECFYTIELE..EGFRVSLQFEDlF
ENSLAFP00000002459  ........--PTCVVPCGGNL..TERRGTILSP.....GFPepyl.....Ns.LNCVWKIVVP..EGAGIQIQVIS.F
ENSLAFP00000004228  .......l-------------..SNPSGTFTSP.....CYPndyp.....Ns.QACMWTLRAP..TGYIIQITFND.F
ENSLAFP00000002459  ........-------QCGGAV..EEMEGVILSP.....GFPgnyps....N..MDCSWKIALP..VGFGAHIQFLN.F
ENSLAFP00000011243  .......d-------------..--SAGYVTSP.....NHPnnypq....H..ADCVWILSAP..PEKSVQLQFEDqF
ENSLAFP00000011243  .......d--------CGGIQ..IGESGAIASP.....NYPasyd.....Sl.THCSWVAGSP..TRHTITLTFSD.F
ENSLAFP00000011243  .......s--------CGGVF..NLSIGIIRSPaysysNYPn........N..MYCLYVITVR..DDRVIQIKFND.F
ENSLAFP00000001586  ......da-------------..--FEGSFTSP.....NYPkph......PelAYCVWHIHVE..KGYKIKLEFKE.I
ENSLAFP00000001583  .......s--------CGGVI..SSLSGSFSSP.....WYPtnypt....D..VECVWVIHVA..DTFHIELTIPS.L
ENSLAFP00000001222  .......l--PRCEALCGGNI..TAMNGTIYSP.....GYPdeyp.....Nf.QDCFWIVRVP..PGNGIYINFTV.L
ENSLAFP00000002459  ........------------F..TSPSGIVLSP.....NYPedyg.....Nh.LHCVWLILAR..PESRIHLAFND.I
ENSLAFP00000011243  .......g--------CNREY..NKAFGNLKSP.....GWPdsyn.....Nd.LDCTIILTAP..QNHTISLFFHS.F
ENSLAFP00000011243  ........--------CGGTV..TGQSGIIESI.....GYPtlpyrd...N..LFCEWHLQGL..SGHYFTIYFED.F
ENSLAFP00000006979  ..cgetpe-----------QI..RAPSGIITSP.....GWPseypa....K..INCSWFIRAN..PGEIITISFQD.F
ENSLAFP00000011243  ..cenvii------------V..NQTYGILESI.....DYPnpyya....N..QRCNWTIQAT..KGNTVNYTFSA.F
ENSLAFP00000012428  ......qk-------------..--LFGEVTSP.....LYPkpypn....N..LETTTVITVP..QGYRVKLVFWQ.F
ENSLAFP00000002138  .......l--PSCVAECGGRIh.VATSGRILSP.....GYPapydn....N..LHCTWIIEAD..PGKTISLHFIV.F
ENSLAFP00000011243  ........-------GCGGIF..KTPSGEIHSP.....NYPspyrs....N..TECSWVIQVE..RNYRVLLNFTD.I
ENSLAFP00000015430  .......n-------------..----------.....NYPg........G..VDCEWVIVAE..EGYGVGLVFQT.F
ENSLAFP00000006852  .......n-------------..----------.....NYPs........Q..ARCDWVIVAE..DGYGVELIFRT.F
ENSLAFP00000002138  .......f--PRCDAPCGYNV..TSQNGTIYSP.....GFPdey......PilKDCIWLITVP..QGHGVYINFTL.L
ENSLAFP00000001583  .......s--------CGGVI..SSLSGSFSSP.....QYPesypt....D..VQCVWEIHVD..KKFHIELMIPS.L
ENSLAFP00000002138  ........-------------..TESSGVILSP.....GYPgnyf.....Ns.QTCSWTIKVE..PNYNITIFVDL.F
ENSLAFP00000005330  ......cs---------GQVF..TERSGELSSP.....EYPkpy......PklSSCTYRIHLE..EGFSVILDFVEsF
ENSLAFP00000010601  cdslvvlf-------------..--EESLIQSL.....HYPenys.....Nm.ANCNWIFQAP..KHYLIKLSFQS.L
ENSLAFP00000012428  .......d--------CSSELy.TEPSGYIASM.....EYPrpyps....D..LRCNYSIRVE..RGLTVHLKFLEpF
ENSLAFP00000007640  .......s--------CGGYL..RQAQGTFSSP.....YYPghypp....N..IDCTWNIEVP..NKQYVKVRFKL.F
ENSLAFP00000001222  .......l--PSCIAECGGRFk.GESSGRILSP.....GYPfpydn....N..LRCMWMIEVD..PGNIVSLQFLA.F
ENSLAFP00000011243  ......sf-----VSRCGSNF..TDPSGYIISP.....NYPkhydn....N..MNCTYIIEAD..SHSVVLLTFVT.F
ENSLAFP00000001222  ........--------CGSNL..QGPSGTFTSP.....NFPfqyds....N..AQCVWVITAVn.TNKVIQINFEE.F
ENSLAFP00000011243  ........-------GCGGTL..YGDSGSFTSP.....GYPdtypn....N..THCEWAITSP..TGRPVTVSFDF.I
ENSLAFP00000011243  .......v-------------..-GTHGKIASPlwpg.NYPh........N..SNYQWIVNVN..ASQVIHGRILE.M
ENSLAFP00000005330  .......f-------------..----GRLASP.....GFPgeya.....Ne.REHHWTLTAP..PGYRLRLYFTH.F
ENSLAFP00000001788  .......n-------------..----------.....NYPg........Q..VDCEWLLVSE..QGSRLELSFQT.F
ENSLAFP00000002459  .......e--------CGGTVk.GEVSGQVLSP.....GYPapyeh....N..LNCIWTIEAD..AGCTIGLHFLV.F
ENSLAFP00000012733  .......l-------------..WEPNTTFSSM.....NFPndyp.....Nq.AFCIWNLNAQ..TGKNIQLHFQE.F
ENSLAFP00000002552  .......g--------CGRVAv.LVEEGIIHSA.....SYPdlypr....N..VTCHWFIHAP..EKHIIKLAFEE.F
ENSLAFP00000001222  .......d-------------..--STGVILSP.....GYPdsyp.....Nl.QMCAWSISVE..KGYNISMFVEF.F
ENSLAFP00000006979  .......s--------CGQSL..KYFYGTFNSP.....NYPdfypp....G..SNCTWLIDTG..DHRKVILRFTD.F
ENSLAFP00000002138  ........--------CGGYI..QGKSGTVLSP.....GFPdfyp.....Ns.LNCTWTIEVS..HGKGVQLIFHT.F
ENSLAFP00000002459  ........------------L..TDSTGVILSQ.....SYPgsyp.....Qf.QTCSWLVRVE..PEYNISLTVEY.F
ENSLAFP00000002138  .......g-------------..--NEGTLLSP.....NFPsnydn....N..HECIYKIETE..AGKGIRLRARS.F
ENSLAFP00000002459  .......e--------CGNSV..TGTQGTLLSP.....NFPvnynn....N..HECIYSIQTQ..PGKGIQLKAKA.F
ENSLAFP00000011243  ........--------CGGLVrtGDTPVFLFSP.....GWPgsys.....Nw.ADCTWIIQAP..-DSTVEFNILS.L
ENSLAFP00000002459  .......p---SCEALCGGFI..QGSSGTILSP.....GFPdfypn....N..LNCTWIIETS..HGKGVFFTFHT.F
ENSLAFP00000001222  ........--------CGGDV..RGPSGTILSP.....GYPefyp.....Ns.LNCTWTVDVT..HGKGVQFNFHT.F
ENSLAFP00000007874  .......g--------CGHIVt.YQDSGTMTSK.....NYPgtyp.....Nh.TVCEKTITVP..KGKKLILRLGD.L
ENSLAFP00000001222  .......e--------CGASA..TNNEGILLSP.....NYPlnyen....N..HECIYSIQVQ..AGKGINISART.F
ENSLAFP00000017785  ......lg-------------..-DFTGYIESP.....NYPgnypa....N..TECTWTINPP..PKRRILIVVPE.I
ENSLAFP00000007414  ........--------CGGNY..SAMTAVVYSP.....DFPdtyat....G..RVCYWTIRVP..GASHIHFNFTL.F
ENSLAFP00000011243  .......s--------CGGYL..HADRGVITSP.....MYPeaypp....S..LNCSWHVLVQ..SGLTIAVHFEQpF
ENSLAFP00000001222  .......l--PSCHAPCGSRS..TGSEGTVLSP.....NYPknysv....G..HNCVYSIAVP..KEFVVFGQFVF.F
ENSLAFP00000003531  ........-------------..---NGHVQSP.....RFPnsypr....N..LLLTWRLHSQ..EKTRIQLAFDNqF
ENSLAFP00000018719  ........--------CGGEL..SAVAGVVLSP.....NWPepyve....G..EDCVWKIHVG..EEKRIFLDIQL.L
ENSLAFP00000006819  ......lg-------------..-DYTGYIESP.....NYPgdypa....N..AECVWYISPP..PKRRILIVVPE.I
ENSLAFP00000002459  .......l--PRCEVPCGGNI..TSSNGTVYSP.....GFPspyss....S..QDCVWLITVF..TGHGIRLNLSL.L
ENSLAFP00000011243  ........--------CGGSLt.NFAGGNFTSP.....GYNgvsnysr..N..LNCEWSLSNPnqGNSSIYIHFES.F
ENSLAFP00000002459  .......r--PVCTAPCGGQY..VGADGVVLSP.....NYPqnyts....G..QICLYFVTVP..KDYVVFGQFTF.F
ENSLAFP00000008097  .......q-----CQHCGGRFrlTGSSGFITDGpg...NYKy........K..TKCTWLIEGQ..PNRIMRLRFKH.F
ENSLAFP00000010601  ........----------GVV..SGPEGELHFP.....ESPhlyyes...N..QLCVWTLLVP..EKMHVLLSFSH.L
ENSLAFP00000006682  ......lg-------------..-EFTGYIESP.....NYPgnypa....S..VECVWNINPP..PKRKILIVVPE.I
ENSLAFP00000002138  .......l--PSCNAPCGGQY..TGSEGVLLSP.....NYPhnyta....G..QICLYSITVP..KEFVVFGQFAY.F
ENSLAFP00000010902  .......s-------------..--TNGSIHSP.....RFPhtypr....N..TVLIWRLVAVe.ENVWIQLTFDErF
ENSLAFP00000011243  ........-------GCGGIL..HSDNGTIRSP.....HWPqnfpe....N..SRCSWTVITH..ESKHLEISFDNnF
ENSLAFP00000022313  ........--------CGGVIr.NATTGRVVSP.....GFPgnysn....N..LTCHWLLEAP..EGQRLHLHFEK.V
ENSLAFP00000015950  ........--------CGGTL..RGTSSTISSP.....HFPseyen....N..ADCTWTILAE..PGDTIALVFTD.F
ENSLAFP00000003844  ........-----CQHCQGRFklTEPSGYLTDGpi...NYKy........K..TKCTWLIEGY..PNAVLRLRFNH.F
ENSLAFP00000018719  .......e--PICSAPCGGAVh.NATIGRVLSP.....SYPgstng....S..QVCVWTIEAP..EGQKLHLHFER.L
ENSLAFP00000003576  ........-------------..----------.....---.........-..--------VP..EGKVVVLNFRF.I
ENSLAFP00000022313  ........------------I..TDSAGVVLSP.....NWPepygr....G..QDCIWGVHVE..EDKRVMLDVRV.L
ENSLAFP00000007640  .......r-------------..------FATP.....GFPdspype...R..AHCQWALRGD..ANLVLSLTFRS.F
ENSLAFP00000020407  ........--------CGGEL..SEPAGVVLSP.....DWPqsysp....G..QDCVWGLHVQ..EEKRILLQVEI.L
ENSLAFP00000012733  ........--------CDGRFllTGSSGSFQAA.....HYPnsses....S..IVCQWIIRVN..QGLSIELSFDP.F
ENSLAFP00000008183  .......l------PACEFEM..GGPEGIVESV.....QIMkegkasaseA..VDCKWYIRAP..PRSKIYLRFLD.Y
ENSLAFP00000006102  .......i------PDCQFEL..SGADGIVRSS.....QVEqeektkpgqA..VDCIWTIKAT..PKAKIYLRFLD.Y
ENSLAFP00000025996  ........-------PCNRTL..EDFYGVFSSP.....GYShlasgsh..P..QSCLWLLDPH..DGRRLAVHFTA.L
ENSLAFP00000001586  .......n-------------..----------.....--P.........D..ENCTWTIERP..ENKSVRIIFSY.V
ENSLAFP00000020407  ......ts-----PVLCNNNI..SEGEGYVESP.....DLGstasrtl..Gl.LDCTYSIHVY..PGYGIEIQVQT.L
ENSLAFP00000011243  ......vp-------------..----QSISSP.....NSSdpdv.....Pf.YTCTWVIDAP..PHQQNKITVWA.L
ENSLAFP00000020407  .......p---SCMASCGGTIh.NATLGHIVSP.....EPGgaagp....N..LTCRWVIEAA..EGRRLHLHFER.V
ENSLAFP00000021631  .......t-------------..-ERRGVIYSP.....AWPlnypp....G..TNCSWYIQGD..RGDMITIRFPS.F
ENSLAFP00000018719  ........--------CSVSF..SDPEGYIDSS.....DYPplpln....Nf.LECMYNVTVY..TGYGVELQVKS.V
ENSLAFP00000002138  ........-------------..----------.....---.........-..----------..----IKLAFEE.F
ENSLAFP00000002552  ..fyyhly-------------..----------.....---.........-..-LCIWKIMVS..EDKIILIKFTS.L
ENSLAFP00000001222  .......k-------------..----------.....---.........-..----------..-----------.-
ENSLAFP00000022313  .......p-----PGPCSWNF..SGPEGSLDSPtas..NSPpdv......G..LDCFYYISVY..PGYGVEIKVQN.I
ENSLAFP00000010905  .....yrr------ALRCVDM..LSLQGQFTFTa....NQP.........Q..LHCAAFFIGE..PEEFITIHYDL.V
ENSLAFP00000025996  ......av------------L..LEAQGTLQRP.....LGResrsf....P..ANCTWLILGS..KEQTVTVRFQK.L
ENSLAFP00000020178  .......g-------------..----------.....---.........-..---------P..PGAALELTFRL.F


                      0                   60                                                        
                      |                    |                                                        
d1sppb_               NLA..........C.GKEYVEV........................................................
ENSLAFP00000011535  DLEyhdt......C.SFDFLEI........................................................
ENSLAFP00000015430  DIEsqpe......C.AYDHLEV........................................................
ENSLAFP00000001788  EIEqhqe......C.AYDHLEV........................................................
ENSLAFP00000008208  DLEddpa......C.LADYVEV........................................................
ENSLAFP00000006852  ELEgndv......C.KYDFVEV........................................................
ENSLAFP00000006852  EIEqhqe......C.AYDHLEM........................................................
ENSLAFP00000015430  EIErhds......C.AYDYLEV........................................................
ENSLAFP00000006852  EIErhds......C.AYDYLEI........................................................
ENSLAFP00000001788  EIErhdn......C.AYDYLEV........................................................
ENSLAFP00000015430  ETEgndv......C.KYDFVEV........................................................
ENSLAFP00000001788  DLYkssl......C.WYDYIEV........................................................
ENSLAFP00000015430  DLYrsrl......C.WYDYVEV........................................................
ENSLAFP00000019561  DLEpdty......C.RYDSVSV........................................................
ENSLAFP00000001788  ELEgnev......C.KYDYVEI........................................................
ENSLAFP00000006852  DLFksrl......C.WYDYVEV........................................................
ENSLAFP00000001222  SIE..........P.NYDFLYI........................................................
ENSLAFP00000011535  QVEgned......C.TYDYVAV........................................................
ENSLAFP00000011243  SLEaattlrr...C.SYDYVKL........................................................
ENSLAFP00000002459  NLE..........P.GYDFLHV........................................................
ENSLAFP00000003576  DVErdny......C.RYDFVAV........................................................
ENSLAFP00000011535  DLEepnsltrt..C.DFDHLVA........................................................
ENSLAFP00000011243  DVEyhas......C.NYDSLEV........................................................
ENSLAFP00000006102  YIEpsfe......C.RFDHLEV........................................................
ENSLAFP00000013784  DLEhdplqvgegdC.KYDWLDI........................................................
ENSLAFP00000001222  QTE..........L.NYDVLEV........................................................
ENSLAFP00000009052  DLEssyl......C.EYDYVKV........................................................
ENSLAFP00000002138  QTE..........V.NYDTLEV........................................................
ENSLAFP00000019561  DLElhpa......C.RYDALEV........................................................
ENSLAFP00000024776  SMEsvas......C.LFDRLEI........................................................
ENSLAFP00000013784  EIEkhd.......C.KYDFIEI........................................................
ENSLAFP00000025560  QLEsg........C.NYDYIEV........................................................
ENSLAFP00000011243  ELEssta......C.SRDFLEI........................................................
ENSLAFP00000011243  SLEeaig......Q.CVDLVEI........................................................
ENSLAFP00000002459  KTE..........V.NYDTLEV........................................................
ENSLAFP00000002520  DLEpdsnppggifC.RYDRLEI........................................................
ENSLAFP00000002138  STE..........A.NHDYLEI........................................................
ENSLAFP00000024776  SLEvqde......C.KLDYVEV........................................................
ENSLAFP00000011243  HLEqhpn......C.TLDYLAV........................................................
ENSLAFP00000011243  QLEdsqd......C.SRDFVEI........................................................
ENSLAFP00000002138  ATE..........Q.NWDSLEI........................................................
ENSLAFP00000002138  DVE..........P.QFDFLAV........................................................
ENSLAFP00000002138  NME..........P.SYDFLHI........................................................
ENSLAFP00000001583  KMEnfyg......C.PYDFIEV........................................................
ENSLAFP00000004942  DIEdsds......C.HFNYLRI........................................................
ENSLAFP00000001222  DLE..........S.QFDFLAV........................................................
ENSLAFP00000001222  ATE..........H.NWDSLDF........................................................
ENSLAFP00000002520  DLEdrd.......C.KYDYVEV........................................................
ENSLAFP00000014838  SLEfdym......C.QYDYVEV........................................................
ENSLAFP00000008183  SIEpswe......C.KFDHIEV........................................................
ENSLAFP00000011243  RLEahps......C.SNEHVTV........................................................
ENSLAFP00000001222  STE..........T.IHDYLEV........................................................
ENSLAFP00000009052  DIEdhpdvs....C.PYDYIKI........................................................
ENSLAFP00000002459  VTE..........Q.NWDSLEV........................................................
ENSLAFP00000004228  DIEeapn......C.IYDSLSL........................................................
ENSLAFP00000002459  STE..........P.NHDFIEI........................................................
ENSLAFP00000011243  YIEatpn......C.TSNYLEL........................................................
ENSLAFP00000011243  DIEphst......C.AWDSVTV........................................................
ENSLAFP00000011243  DVVpsaf......C.SQDYLAI........................................................
ENSLAFP00000001586  FLEtday......C.RFDFIAV........................................................
ENSLAFP00000001583  KLEdiyg......C.PYDYVEV........................................................
ENSLAFP00000001222  QTE..........P.IYDFITV........................................................
ENSLAFP00000002459  DVE..........P.QFDFLVI........................................................
ENSLAFP00000011243  GIEesse......C.THDFLEV........................................................
ENSLAFP00000011243  NLQnssn......C.EKDFVEI........................................................
ENSLAFP00000006979  DIQgsrr......C.SLDWLTI........................................................
ENSLAFP00000011243  ELEdhin......C.STDYLEL........................................................
ENSLAFP00000012428  DLEpseg......C.FYDYVKI........................................................
ENSLAFP00000002138  DTE..........T.AHDILKV........................................................
ENSLAFP00000011243  DLE..........P.QDSCITA........................................................
ENSLAFP00000015430  EVEeetd......C.GYDYMEL........................................................
ENSLAFP00000006852  EVEeead......C.GYDYMEA........................................................
ENSLAFP00000002138  QTE..........A.VNDYIAV........................................................
ENSLAFP00000001583  KLEdilg......C.PYDSVEI........................................................
ENSLAFP00000002138  QSE..........K.QFDTLEV........................................................
ENSLAFP00000005330  DVEthpetq....C.PYDSLQI........................................................
ENSLAFP00000010601  EIEesgd......C.TSDYVTV........................................................
ENSLAFP00000012428  EIDdhqqvh....C.PYDQLQI........................................................
ENSLAFP00000007640  YLVepnvspvt..C.SKDYVEV........................................................
ENSLAFP00000001222  DTE..........A.SHDILRV........................................................
ENSLAFP00000011243  HLEarsaiags..C.ANDGLHI........................................................
ENSLAFP00000001222  DLE..........I.GYDTLTI........................................................
ENSLAFP00000011243  SIDdpgd......C.VQNYLIL........................................................
ENSLAFP00000011243  NIEatyn......C.YYDKLRV........................................................
ENSLAFP00000005330  DLElsyl......C.EYDFVKL........................................................
ENSLAFP00000001788  EVEeead......C.GYDYVEL........................................................
ENSLAFP00000002459  DTE..........E.VHDVLRI........................................................
ENSLAFP00000012733  DLE..........D.IADVVEI........................................................
ENSLAFP00000002552  TIGfnqn......S.THDAVVI........................................................
ENSLAFP00000001222  QTE..........K.EFDVLQV........................................................
ENSLAFP00000006979  KLDgt........G.YGDYVKI........................................................
ENSLAFP00000002138  HLE..........S.SHDYLLI........................................................
ENSLAFP00000002459  LSE..........K.QYDEFEI........................................................
ENSLAFP00000002138  QLF..........-.EGDILKV........................................................
ENSLAFP00000002459  ELS..........-.EGDVLKV........................................................
ENSLAFP00000011243  DIEshqt......C.DFDKLVI........................................................
ENSLAFP00000002459  HLE..........S.GHDYLLI........................................................
ENSLAFP00000001222  HLE..........D.HHDYLLI........................................................
ENSLAFP00000007874  NIEsqt.......C.ASDYLLF........................................................
ENSLAFP00000001222  HLA..........-.QGDVLKI........................................................
ENSLAFP00000017785  FLPied.......D.CGDYLVM........................................................
ENSLAFP00000007414  DIR..........D.SADMVEL........................................................
ENSLAFP00000011243  QIPngdssc....N.QGDYLVL........................................................
ENSLAFP00000001222  QTS..........-.LHDVVEV........................................................
ENSLAFP00000003531  GLEeaendi....C.RYDFVEV........................................................
ENSLAFP00000018719  NLS..........-.NSDILTI........................................................
ENSLAFP00000006819  FLPied.......E.CGDVLVM........................................................
ENSLAFP00000002459  QAE..........T.SGDFITV........................................................
ENSLAFP00000011243  YLEshqd......C.QFDVLEF........................................................
ENSLAFP00000002459  HTA..........-.LNDVVEV........................................................
ENSLAFP00000008097  ATE..........C.SWDHLYV........................................................
ENSLAFP00000010601  DVEs.........C.HHNYLSI........................................................
ENSLAFP00000006682  FLPsed.......E.CGDVLVM........................................................
ENSLAFP00000002138  QTA..........-.LNDLAEL........................................................
ENSLAFP00000010902  GLEdpeddi....C.KYDFVEI........................................................
ENSLAFP00000011243  LIPsgdeq.....C.QNSFVKV........................................................
ENSLAFP00000022313  SLA..........E.DDDRLII........................................................
ENSLAFP00000015950  QLE..........E.GYDFLEI........................................................
ENSLAFP00000003844  ATE..........C.SWDHMYV........................................................
ENSLAFP00000018719  SLN..........-.EKDRMMV........................................................
ENSLAFP00000003576  DLEsdnl......C.RYDFVDV........................................................
ENSLAFP00000022313  RIG..........-.PGDVLTF........................................................
ENSLAFP00000007640  DLApcdq......R.GSDLVTV........................................................
ENSLAFP00000020407  NVR..........-.EGDMLTL........................................................
ENSLAFP00000012733  NMY..........-.YTDVLNI........................................................
ENSLAFP00000008183  EMQnsne......C.KRNFVAV........................................................
ENSLAFP00000006102  QMEhsne......C.KRNFVAV........................................................
ENSLAFP00000025996  DLG..........-.YGDAVHV........................................................
ENSLAFP00000001586  QLDpdgs......C.ESENIKV........................................................
ENSLAFP00000020407  NLS..........R.EEELLVL........................................................
ENSLAFP00000011243  QLHsrd.......C.SQNYLEF........................................................
ENSLAFP00000020407  SLD..........E.DNDRLMV........................................................
ENSLAFP00000021631  RETpthqsprgsaG.------Aprqpaprywraattrlcwsadpldvlhslcpgwvwlggglwvlgrekgwshgkmgp
ENSLAFP00000018719  NLS..........-.EGELLSI........................................................
ENSLAFP00000002138  ELE..........R.GYDTLTV........................................................
ENSLAFP00000002552  DRKss........F.--HR-PV........................................................
ENSLAFP00000001222  ---..........-.-YDYLEI........................................................
ENSLAFP00000022313  SLL..........-.EGEMVTV........................................................
ENSLAFP00000010905  SID..........CqGGDFLKV........................................................
ENSLAFP00000025996  HLA..........C.GSEHLIL........................................................
ENSLAFP00000020178  ELA..........D.PRDRLEL........................................................


                                                                                                    
                                                                                                    
d1sppb_               ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000008208  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000019561  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000003576  ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000006102  ..............................................................................
ENSLAFP00000013784  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000009052  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000019561  ..............................................................................
ENSLAFP00000024776  ..............................................................................
ENSLAFP00000013784  ..............................................................................
ENSLAFP00000025560  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000002520  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000024776  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000004942  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000002520  ..............................................................................
ENSLAFP00000014838  ..............................................................................
ENSLAFP00000008183  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000009052  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000004228  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001586  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000006979  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000012428  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000005330  ..............................................................................
ENSLAFP00000010601  ..............................................................................
ENSLAFP00000012428  ..............................................................................
ENSLAFP00000007640  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000005330  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000012733  ..............................................................................
ENSLAFP00000002552  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000006979  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000007874  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000017785  ..............................................................................
ENSLAFP00000007414  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000003531  ..............................................................................
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000006819  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000008097  ..............................................................................
ENSLAFP00000010601  ..............................................................................
ENSLAFP00000006682  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000010902  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000015950  ..............................................................................
ENSLAFP00000003844  ..............................................................................
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000003576  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000007640  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000012733  ..............................................................................
ENSLAFP00000008183  ..............................................................................
ENSLAFP00000006102  ..............................................................................
ENSLAFP00000025996  ..............................................................................
ENSLAFP00000001586  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000021631  sagpgahtstlrshfclllplhfgdlrihsrgrgshrahlqaqrppgdsslltqgtevghwvrddlweekqcqgvsev
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002552  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000010905  ..............................................................................
ENSLAFP00000025996  ..............................................................................
ENSLAFP00000020178  ..............................................................................


                                                                                                    
                                                                                                    
d1sppb_               ....................................................................FDG.......
ENSLAFP00000011535  ....................................................................YNG.......
ENSLAFP00000015430  ....................................................................YDG.......
ENSLAFP00000001788  ....................................................................FDG.......
ENSLAFP00000008208  ....................................................................YDS.......
ENSLAFP00000006852  ....................................................................RSG.......
ENSLAFP00000006852  ....................................................................YDG.......
ENSLAFP00000015430  ....................................................................RDG.......
ENSLAFP00000006852  ....................................................................RDG.......
ENSLAFP00000001788  ....................................................................RDG.......
ENSLAFP00000015430  ....................................................................RSG.......
ENSLAFP00000001788  ....................................................................RDG.......
ENSLAFP00000015430  ....................................................................RDG.......
ENSLAFP00000019561  ....................................................................FNG.......
ENSLAFP00000001788  ....................................................................WSG.......
ENSLAFP00000006852  ....................................................................RDG.......
ENSLAFP00000001222  ....................................................................YDG.......
ENSLAFP00000011535  ....................................................................FRG.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000002459  ....................................................................YDG.......
ENSLAFP00000003576  ....................................................................FNG.......
ENSLAFP00000011535  ....................................................................FDG.......
ENSLAFP00000011243  ....................................................................YGG.......
ENSLAFP00000006102  ....................................................................RDG.......
ENSLAFP00000013784  ....................................................................WDG.......
ENSLAFP00000001222  ....................................................................HDG.......
ENSLAFP00000009052  ....................................................................ET-.......
ENSLAFP00000002138  ....................................................................RDG.......
ENSLAFP00000019561  ....................................................................FAG.......
ENSLAFP00000024776  ....................................................................SPE.......
ENSLAFP00000013784  ....................................................................RDG.......
ENSLAFP00000025560  ....................................................................FDG.......
ENSLAFP00000011243  ....................................................................LDG.......
ENSLAFP00000011243  ....................................................................RDG.......
ENSLAFP00000002459  ....................................................................RDG.......
ENSLAFP00000002520  ....................................................................WDG.......
ENSLAFP00000002138  ....................................................................QNG.......
ENSLAFP00000024776  ....................................................................YET.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000011243  ....................................................................REG.......
ENSLAFP00000002138  ....................................................................YDG.......
ENSLAFP00000002138  ....................................................................KDD.......
ENSLAFP00000002138  ....................................................................YEG.......
ENSLAFP00000001583  ....................................................................FDG.......
ENSLAFP00000004942  ....................................................................YNG.......
ENSLAFP00000001222  ....................................................................KDG.......
ENSLAFP00000001222  ....................................................................YDG.......
ENSLAFP00000002520  ....................................................................IDG.......
ENSLAFP00000014838  ....................................................................RDG.......
ENSLAFP00000008183  ....................................................................RDG.......
ENSLAFP00000011243  ....................................................................FNG.......
ENSLAFP00000001222  ....................................................................RSG.......
ENSLAFP00000009052  ....................................................................KAG.......
ENSLAFP00000002459  ....................................................................FDG.......
ENSLAFP00000004228  ....................................................................DNG.......
ENSLAFP00000002459  ....................................................................RNG.......
ENSLAFP00000011243  ....................................................................RGG.......
ENSLAFP00000011243  ....................................................................RNG.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000001586  ....................................................................YDG.......
ENSLAFP00000001583  ....................................................................FDG.......
ENSLAFP00000001222  ....................................................................WDG.......
ENSLAFP00000002459  ....................................................................KDG.......
ENSLAFP00000011243  ....................................................................RNG.......
ENSLAFP00000011243  ....................................................................WEN.......
ENSLAFP00000006979  ....................................................................ETY.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000012428  ....................................................................SA-.......
ENSLAFP00000002138  ....................................................................WDG.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000015430  ....................................................................FDG.......
ENSLAFP00000006852  ....................................................................YDG.......
ENSLAFP00000002138  ....................................................................WDG.......
ENSLAFP00000001583  ....................................................................FNG.......
ENSLAFP00000002138  ....................................................................FDG.......
ENSLAFP00000005330  ....................................................................QT-.......
ENSLAFP00000010601  ....................................................................HRD.......
ENSLAFP00000012428  ....................................................................YA-.......
ENSLAFP00000007640  ....................................................................NGE.......
ENSLAFP00000001222  ....................................................................WDG.......
ENSLAFP00000011243  ....................................................................IRG.......
ENSLAFP00000001222  ....................................................................GDG.......
ENSLAFP00000011243  ....................................................................YDG.......
ENSLAFP00000011243  ....................................................................FDG.......
ENSLAFP00000005330  ....................................................................SSG.......
ENSLAFP00000001788  ....................................................................FDG.......
ENSLAFP00000002459  ....................................................................WDG.......
ENSLAFP00000012733  ....................................................................RDG.......
ENSLAFP00000002552  ....................................................................YGD.......
ENSLAFP00000001222  ....................................................................YDG.......
ENSLAFP00000006979  ....................................................................YDG.......
ENSLAFP00000002138  ....................................................................TED.......
ENSLAFP00000002459  ....................................................................FDG.......
ENSLAFP00000002138  ....................................................................YDG.......
ENSLAFP00000002459  ....................................................................YDG.......
ENSLAFP00000011243  ....................................................................RDV.......
ENSLAFP00000002459  ....................................................................TEN.......
ENSLAFP00000001222  ....................................................................TEN.......
ENSLAFP00000007874  ....................................................................TS-.......
ENSLAFP00000001222  ....................................................................YDG.......
ENSLAFP00000017785  ....................................................................RKT.......
ENSLAFP00000007414  ....................................................................LDG.......
ENSLAFP00000011243  ....................................................................KNG.......
ENSLAFP00000001222  ....................................................................YDG.......
ENSLAFP00000003531  ....................................................................EDI.......
ENSLAFP00000018719  ....................................................................YDG.......
ENSLAFP00000006819  ....................................................................RKS.......
ENSLAFP00000002459  ....................................................................WDG.......
ENSLAFP00000011243  ....................................................................RVG.......
ENSLAFP00000002459  ....................................................................HDG.......
ENSLAFP00000008097  ....................................................................YDG.......
ENSLAFP00000010601  ....................................................................HSL.......
ENSLAFP00000006682  ....................................................................RKN.......
ENSLAFP00000002138  ....................................................................FDG.......
ENSLAFP00000010902  ....................................................................EEP.......
ENSLAFP00000011243  ....................................................................WAG.......
ENSLAFP00000022313  ....................................................................RNG.......
ENSLAFP00000015950  ....................................................................S--.......
ENSLAFP00000003844  ....................................................................YDG.......
ENSLAFP00000018719  ....................................................................YSG.......
ENSLAFP00000003576  ....................................................................YNG.......
ENSLAFP00000022313  ....................................................................YDG.......
ENSLAFP00000007640  ....................................................................YDS.......
ENSLAFP00000020407  ....................................................................FDG.......
ENSLAFP00000012733  ....................................................................YEG.......
ENSLAFP00000008183  ....................................................................YDG.......
ENSLAFP00000006102  ....................................................................YDG.......
ENSLAFP00000025996  ....................................................................YDG.......
ENSLAFP00000001586  ....................................................................FDR.......
ENSLAFP00000020407  ....................................................................AGG.......
ENSLAFP00000011243  ....................................................................QDS.......
ENSLAFP00000020407  ....................................................................RSG.......
ENSLAFP00000021631  gigeglegrslpppgrpggrrrdtklgprvpwtlgqtngswvlgrtwnmlgdqxprrvllqaeaatdvYEG.......
ENSLAFP00000018719  ....................................................................RGV.......
ENSLAFP00000002138  ....................................................................GDA.......
ENSLAFP00000002552  ....................................................................LGM.......
ENSLAFP00000001222  ....................................................................EG-.......
ENSLAFP00000022313  ....................................................................EGL.......
ENSLAFP00000010905  ....................................................................FDGwilkgek
ENSLAFP00000025996  ....................................................................HSP.......
ENSLAFP00000020178  ....................................................................RDA.......


                                     70                             80        90              100   
                                      |                              |         |                |   
d1sppb_               .......LL...SGPSY......GK..LCA.........GAAI....VFLSTANTMTIKYNRISGNS.......SSP.
ENSLAFP00000011535  .......ASgd.KGNLL......GR..FCG.........QVPPp...PFSSSWHVMLVVFHSDKHVA.......SHG.
ENSLAFP00000015430  .......RDa..KAPVL......GR..FCG.........SKKPe...AVLATSNRMFLRFFSDNSVQ.......RKG.
ENSLAFP00000001788  .......ETe..KSPIL......GR..LCG.........NKIPe...PLVATGNKMFVRFVSDASVQ.......RKG.
ENSLAFP00000008208  .......YDd..VHGFV......GR..FCG.........DELPe...DIISTGNVMTLKFLSDASVT.......AGG.
ENSLAFP00000006852  .......LSq..DARLH......GK..FCG.........SETPd...VITSQSNNMRVEFKSDNTVS.......KRG.
ENSLAFP00000006852  .......PDs..LAPIL......GR..FCG.........SKKPa...PVVASSSSLFLRFHSDASVQ.......RKG.
ENSLAFP00000015430  .......HSe..SSTLI......GR..YCG.........YEKPd...DIKSTSSRLWLKFVSDGSIN.......KAG.
ENSLAFP00000006852  .......LTe..ESTLI......GH..FCG.........YEKPe...DVKSSSNRMWMKFVSDGSIN.......KAG.
ENSLAFP00000001788  .......TSe..NSPLI......GR..FCG.........YDKPe...DIRSTANTLWMKFVSDGTVN.......KAG.
ENSLAFP00000015430  .......LTa..DSKLH......GK..FCG.........SEKPe...VITSQYNNMRVEFKSDNTVS.......KKG.
ENSLAFP00000001788  .......YWr..KSPLL......GR..FCG.........DKLPd...VLTSTDSRLWVEFRSSSNWV.......GKG.
ENSLAFP00000015430  .......FWr..KAPLR......GR..FCG.........GKLPe...PIVSTDSRLWVEFRSSSNWV.......GKG.
ENSLAFP00000019561  .......AVtd.DAKRL......GK..FCG.........DKVPg...PISSDGNELLVQFVSDLSVT.......ADG.
ENSLAFP00000001788  .......LSs..ESKLH......GK..FCG.........AEVPe...VITSQFNNMRIEFKSDNTVS.......KKG.
ENSLAFP00000006852  .......YWr..KAPLL......GR..FCG.........DKVPe...PLISTDSRLWVEFRSSSNIL.......GKG.
ENSLAFP00000001222  .......PDs..NSPLI......GS..FQD.........SKLPe...RIESSSNTMHLAFRSDGSVS.......YTG.
ENSLAFP00000011535  .......PG...-PAHR......HH..YCG.........SAKPp...TLVSLDHELQVIFKSDFNIG.......GRG.
ENSLAFP00000011243  .......DSe..NANLA......GT..FCG.........STVPa...PFVSSGNFLTVQFVSDIILE.......REG.
ENSLAFP00000002459  .......RDs..LSPLI......GS..FYG.........SQLPg...RIESSSNSLFLAFRSDASVS.......NAG.
ENSLAFP00000003576  .......GEin.DAKRI......GR..YCG.........DSPPa...PIVSESNELLIQFLSDLSLT.......ADG.
ENSLAFP00000011535  .......ASe..EAPLL......GS..WCG.........HHLPp...PITSSQNQLLLLLHTDRSTT.......RRG.
ENSLAFP00000011243  .......PDf..HSPRI......AQ..LCAqrs......SENPm...QVSSTGNELAIRFKTDSSIN.......GRD.
ENSLAFP00000006102  .......PFg..FSPLI......DR..YCG.........MKSPp...LIRSTGRFMWIKFSSDEELE.......GLG.
ENSLAFP00000013784  .......IQh..VGPLI......GK..YCG.........TKTPs...ELRSSTGILSLTFHTDMAVA.......KDG.
ENSLAFP00000001222  .......PNl..LSPLL......GS..YNG.........TQVPq...FLFSSSNFIYLLFTTDNSRS.......NNG.
ENSLAFP00000009052  .......--...EDQVL......AN..FCGrettdt...EQTPgqe.AILSPGSFMSITFRSDFSNEer.....YTG.
ENSLAFP00000002138  .......SAn..SSPLI......GE..YHG.........TQAPq...FLISTGNFMYLLFTTDNSRS.......NVG.
ENSLAFP00000019561  .......AGt..SGQRL......GR..FCG.........TFRPa...PVVVPGNQATLRMTADEGTG.......GRG.
ENSLAFP00000024776  .......P-...-EGPL......LR..VCG.........KLPPp...TLNTNASRLRVAFASDSSVE.......GLG.
ENSLAFP00000013784  .......DSe..SADLL......GK..HCG.........NIAPp...TIISSGSVLYIKFTSDYARQ.......GAG.
ENSLAFP00000025560  .......PYh..SSPLI......AR..VCN.........GVSG....SFTSSSNFMSVRFISDGSVT.......RKG.
ENSLAFP00000011243  .......SDy..DAPLR......GR..YCG.........ISMPh...PITSFSNALTLRFVSDSRVN.......SVG.
ENSLAFP00000011243  .......GYe..NSPSL......GI..YCG.........SNPPp...RIISHSNKLWIRFKSDLFDS.......RSG.
ENSLAFP00000002459  .......RTy..SAPLI......GV..YHG.........TQVPq...FLISTSNYLYLLFSTDKSHS.......DIG.
ENSLAFP00000002520  .......FPe..VGPHI......GR..YCG.........QKTPg...RIRSSSGILSMVFYTDSAIA.......KEG.
ENSLAFP00000002138  .......PYh..TSPMI......GQ..FSG.........SDLPs...ALLSTTHETLIHFYSDHSQN.......RQG.
ENSLAFP00000024776  .......SNsg.ALSLL......GR..FCG.........AEPPp...RLVSSHHELAVLFRTDHGIS.......SGS.
ENSLAFP00000011243  .......PSt..SSHLR......TQ..LCG.........DQKPp...LIRSSGDSMSLKMRTDEGQQ.......GGG.
ENSLAFP00000011243  .......NA...TGHLV......GR..YCG.........HVLPln..YSSIVGHILWVRFVSDGSGS.......DTG.
ENSLAFP00000002138  .......GDm..TAPRL......GS..FSG.........TTVPa...LLNSTSNQLYLHFQSDISVA.......AAG.
ENSLAFP00000002138  .......GIs..DITVL......GT..FSG.........NEVPs...QLASSGHIVRLEFQSDHSTT.......GRG.
ENSLAFP00000002138  .......EDs..NSPLI......GS..FQG.........SQAPe...RIESSGNSLFLAFRSDASVG.......LSG.
ENSLAFP00000001583  .......PQs..EPLSL......GR..FCA.........STTP....IFTSSSNRMTVVFHSDAIIT.......NIG.
ENSLAFP00000004942  .......IGv..GRTEI......GK..YCG.........LGLQmnh.TIESKSNEITVLFMSGIHVS.......GRG.
ENSLAFP00000001222  .......DSp..DSPIL......GT..FTG.........AEVPs...HLTSNSHILRLEFQADHSMS.......GRG.
ENSLAFP00000001222  .......GDn..NAPRL......GS..YSG.........TTIPh...LLNSTSNNLYLNFQSDISVS.......AAG.
ENSLAFP00000002520  .......DNp..NGRLW......GK..FCG.........KIAPs...PVVSLGPFLFIRFVSDYETH.......GAG.
ENSLAFP00000014838  .......DNs..DGQII......KR..FCG.........NERPa...PIRSTGPALHILFHSDGSKN.......FDG.
ENSLAFP00000008183  .......PFg..FSPII......GR..FCG.........QQNPp...VIKSSGRFLWIKFFADGELE.......SMG.
ENSLAFP00000011243  .......IRs..NSPQL......EE..LCS.........SVNVsd..QIKSSGNTMKVVFFTDGSRP.......YGG.
ENSLAFP00000001222  .......SSe..TSTVI......GR..LSG.........PQIPs...SIFSTTHETSLYFHSDYSQN.......KQG.
ENSLAFP00000009052  .......L-...--KSL......GP..FCG.........EKAPg...PINTQSHSVQILFHSDNSGE.......NRG.
ENSLAFP00000002459  .......ADn..TVTML......GS..FSG.........TTVPa...LLNSTSNQLYLHFYSDISVS.......AAG.
ENSLAFP00000004228  .......E-...---SQ......TK..FCG.........ATAKgl..SFNSSANEMHVSFSSDFSIQ.......KKG.
ENSLAFP00000002459  .......PYe..TSRMM......GR..FSG.........SELPs...SLLSTSHETTVYFHSDHSQN.......RPG.
ENSLAFP00000011243  .......ADs..NAPVL......SK..FCG.........TSLPs...SQLSSEEVMYLRFRSDNSPT.......HVG.
ENSLAFP00000011243  .......GSp..GSPII......GQ..YCG.........SSNPr...IIQSGSNQLVVIFNSDHSVQ.......HGG.
ENSLAFP00000011243  .......SNv..SDPLL......GK..FCG.........SNLPp...NVKSSNNSLLLVFKTDSFQT.......ARG.
ENSLAFP00000001586  .......SSt..DSGLI......AQ..VCG.........LTKP....TFESSSDSLTVVLSTDYANS.......YRG.
ENSLAFP00000001583  .......RQv..ASLSV......GR..FCA.........GAEL....TFLSSSNIMTAVFRSDAMIT.......NTG.
ENSLAFP00000001222  .......PDq..NSPQI......GQ..FSG.........NTALe...SVYSTSNQILIKFHSDFTTS.......GF-.
ENSLAFP00000002459  .......ATa..EAPVL......GT..FSG.........NQLPs...SITSSGHVARLEFQTDHSTG.......KRG.
ENSLAFP00000011243  .......SDs..SYPLL......GK..YCG.........ALLPn...PVFSQNNVLYLRFKSNSGIS.......SHG.
ENSLAFP00000011243  .......HI...SGHVL......GR..FCG.........NTIPd...SIDTSGNVALVKFVTDGSLT.......ASG.
ENSLAFP00000006979  .......--...KNIES......YR..ACG.........STIPp...PYISSQDHVWIRFHSDDNIS.......RKG.
ENSLAFP00000011243  .......--...-SRRM......GR..YCG.........TDIPp...PGSTTGSKLRVLFYTDGVGNr......EKG.
ENSLAFP00000012428  .......--...DKKNL......GR..FCGqlgspl...GNPPgkk.EFLSQGNKMLLTFHTDFSNEengaimfYKG.
ENSLAFP00000002138  .......PVd..SNILL......KE..WSG.........SALPe...DIHSTFNSLTLQFDSDFFIS.......KSG.
ENSLAFP00000011243  .......LNt..ATTRL......AS..VCG.........RQQLtn..PITSSGNALFVRFQSGASSQ.......SRG.
ENSLAFP00000015430  .......YDs..TAPRL......GR..YCG.........SGPPe...EVYSAGDSVLVKFHSDDTIT.......KKG.
ENSLAFP00000006852  .......YDs..TAPRL......GR..FCG.........SWPLe...EIYSAGDSLMIRFHTDDTIN.......KKG.
ENSLAFP00000002138  .......PDq..NSPQL......GV..FSG.........NTALe...TAYSSTNQVLLKFHSDFSNG.......GF-.
ENSLAFP00000001583  .......PRi..ASLSM......GK..FCA.........PVTV....IFFSSSNIMTVVFRSDSMIT.......NIG.
ENSLAFP00000002138  .......SSg..QSPLL......VV..LSG.........NHTEqs..NFTSKSNQLYLRWSTDHATS.......KKG.
ENSLAFP00000005330  .......--...DKGEY......GP..FCG.........TTLPp...RIETKSNSVTITFVSDQSGD.......HTG.
ENSLAFP00000010601  .......VE...RKKEI......AR..LCG.........FAVPa...PVLSSSSVMFISFQSDENMS.......FRG.
ENSLAFP00000012428  .......--...NGKSI......GE..FCG.........TQRPp...DLDSSSNAVDLLFFTDESGD.......SRG.
ENSLAFP00000007640  .......--...-----......-K..HCG.........EKSQf...VVTSNSSKMTVRFHSDQSYT.......DTG.
ENSLAFP00000001222  .......PPe..NEMLL......KE..ISG.........SLIPe...GIHSTLNIVTIQFDTDFYIS.......KSG.
ENSLAFP00000011243  .......YSl..SSSPI......AT..LCG.........EETL....APISTSGPMLLNFYSNAHIT.......DFG.
ENSLAFP00000001222  .......GEvgdPRTVL......QV..LTG.........SFVPd...LIVSMSNQMWLHLQTDESVG.......SVG.
ENSLAFP00000011243  .......PDa..DSPST......GP..YCG.........ADIAia..PFVGSSHQVFIRFHAVYAVQ.......PSA.
ENSLAFP00000011243  .......LGi..HSRQI......GT..YCG.........TQSA....SFSSSRNSLTFQFSSDSSIS.......GKG.
ENSLAFP00000005330  .......AKv..LATLC......GR..ESTdt.......EQAPgntiFYSPPGSSLEVTFHSDYSNEkp.....FTG.
ENSLAFP00000001788  .......LDs..TAVGL......GH..FCG.........SGPPe...EIYSTGDAVLIRFHTDDTIN.......KKG.
ENSLAFP00000002459  .......PVe..SGVLL......KE..LSG.........PALPk...DLHSTFSSVVLQFSTDFFTS.......KQG.
ENSLAFP00000012733  .......REd..DSLLL......GAavYTG.........SGPVk...DVFSTTNRMTVLFITDDLVT.......SRG.
ENSLAFP00000002552  .......PE...EEHEL......AK..LCG.........VLNPt...PICSPSNMTVIRFKSDGEND.......FQG.
ENSLAFP00000001222  .......PNi..QSPVL......IS..LSG.........DYSSaf..NITSNGHEVFLQWSADHGNN.......KKG.
ENSLAFP00000006979  .......LEe..NPHKL......LR..VLTafd......SHAPl...TVVSSSGQIRVHFCADKVNA.......ARG.
ENSLAFP00000002138  .......GS...FTEPV......AR..LTG.........SVLPhtikAGLFGNFTAQLRFISDFSIS.......YEG.
ENSLAFP00000002459  .......PSg..QSPLL......KA..LSG.........NYSApl..IVTSSSNSVYLRWSSDHAYN.......RKG.
ENSLAFP00000002138  .......KDs..SSRPL......GA..FTK.........NEMMgl..ILNSTSNHLWLEFNTNGSDT.......DQG.
ENSLAFP00000002459  .......NNn..SARLL......GV..FSR.........SEMMgm..TLNSTSSSLWLDFITDAENT.......SKG.
ENSLAFP00000011243  .......IGdsnLAQEL......AV..LCG.........REIPg...PIRSTGEYMLIRFTSDFSVT.......GAG.
ENSLAFP00000002459  .......GS...FTQPL......KQ..LTG.........SRLPapisAGLYGNFTAQVRFISDFSMS.......YEG.
ENSLAFP00000001222  .......GS...FTQPL......AR..LTG.........SELPstinAGLYGNFRAQLRFISDFSIS.......YEG.
ENSLAFP00000007874  .......--...SSDQY......GP..YCG.........SMTVpk..ELLLNTSEVTIRFKSGSHIS.......GRG.
ENSLAFP00000001222  .......KDk..TTHLL......GA..FTG.........ASMRgl..TLSSTSNQLWLEFNSDAEGT.......DEG.
ENSLAFP00000017785  .......SSs..NSVTT......YE..TCQ.........TYERpi..AFTSRSKKLWIQFKSNEGNS.......ARG.
ENSLAFP00000007414  .......Y-...THRVL......VR..FNG.........RNRPpl..SFNVSLDFVILYFFSDRVNQ.......AQG.
ENSLAFP00000011243  .......PDi..YSPPLgphggnGH..FCG.........SHPSs...TMFTSDNEMFAQFISDNSNG.......GQG.
ENSLAFP00000001222  .......PTq..QSSLL......SS..LSG.........SHSGes..LPLSSGNQITIRFTSVGPIT.......AKG.
ENSLAFP00000003531  .......SEt..STVIR......GR..WCGh........KEVPp...RITSRTNQIKITFKSDDYFVa......KPG.
ENSLAFP00000018719  .......DEv..MPHIL......GQ..YLG.........NSGPq...KLYSSTPDLTIQFHSDPAGLifgk...GQG.
ENSLAFP00000006819  .......ASp..TSITT......YE..TCQ.........TYERpi..AFTSRSRKLWIQFKSNEGNS.......GKG.
ENSLAFP00000002459  .......PQq..TAPQL......GV..FTR.........SLVKk...TLHSSSNQVLLKFHRNAATG.......GI-.
ENSLAFP00000011243  .......NA...DGPLI......WR..LCG.........HSRPtm..PLVIPHPQVWIHFVTNRQVE.......HIG.
ENSLAFP00000002459  .......HSq..QSRLL......SS..LSG.........SHTGes..LPLATSNQVLIKFSAKGQAP.......ARG.
ENSLAFP00000008097  .......DSi..YAPLV......AA..FSGlivperdgnETVP....EVVATSGYALLHFFSDAAYN.......LTG.
ENSLAFP00000010601  .......--...GDRLI......GK..LCE.........EGLFs...SVHIGSNSIRLKFISDATDY.......AAG.
ENSLAFP00000006682  .......SSp..SSITT......YE..TCQ.........TYERpi..AFTARSRKLWINFKTSEANS.......ARG.
ENSLAFP00000002138  .......THp..QARLL......SS..LSG.........SHSGet..LPLATSNQILLRFSAKSGAS.......ARG.
ENSLAFP00000010902  .......S-...DGTIL......GR..WCG.........SGAVpg..KQISKGNQIRIRFVSDEYFPs......QPG.
ENSLAFP00000011243  .......TEea.DKALL......AT..GCG.........NVAPd...PIITPKNTFTAVFQAQG-AP.......AQG.
ENSLAFP00000022313  .......DNve.APPVY......DS..YEV.........EYLPie..GLLSSGRHFFVELSTDSNGA.......AAG.
ENSLAFP00000015950  .......--...-----......--..---.........----....--------------------.......---.
ENSLAFP00000003844  .......DSi..YAPLI......AV..LSGlivpevrgnETVP....EVVTTSGYALLHFFSDAAYN.......LTG.
ENSLAFP00000018719  .......RTnk.SALLY......DS..FQT.........ESVPfe..GLLSDSNTISIEFMSDQARV.......ASA.
ENSLAFP00000003576  .......HA...NGQRI......GR..FCG.........TFRPg...ALVSSSNKMMVQMISDANTA.......GNG.
ENSLAFP00000022313  .......DDl..TARVL......GQ..YSG.........PRGHf...KLFTSMADVTIQFQSDPGASvlgy...QQG.
ENSLAFP00000007640  .......LSpi.EPSAV......VQ..LCG.........TYPPsynlTFLSSQNVFLVTLITNTERR.......HPG.
ENSLAFP00000020407  .......DGp..SARVL......AQ..LRG.........PQPRr...RLLSSGPDLTLQFQAPPGPPnpgl...GQG.
ENSLAFP00000012733  .......IG...PSKIL......RA..FIW.........ETNPg...IIRIFSNQVTVTFLIESDESv......YAG.
ENSLAFP00000008183  .......SSs..VEDLK......AK..FCS.........TVAN....DVMLRTGLGVIRMWADEGSR.......NSR.
ENSLAFP00000006102  .......SSs..IENLK......AK..FCS.........TVAN....DVMLKTGVGVIRMWADEGSR.......LSR.
ENSLAFP00000025996  .......TGppeTTRLL......RS..LTY.........FSNGkav.TVETLSGQAVVAYHTVAWSS.......GRG.
ENSLAFP00000001586  .......TSt..AGPLL......GE..VCS.........KNDFvp..VFESSSNTLTFQIITDSTVI.......QRS.
ENSLAFP00000020407  .......GSpg.LAPRL......LA..NSS.........MLGEgq..VLRSPTNRLLLHFQSPRSPR.......GSG.
ENSLAFP00000011243  .......PAs..NRNPG......IR..FCG.........GNISavp.AFYSSVRTAIVVFKAEVFNR.......NSR.
ENSLAFP00000020407  .......GGp..LSPVI......YD..SDM.........DDVPer..GLISDAQSLYVELLSETPAN.......PLL.
ENSLAFP00000021631  .......LGer.GDRLL......QTlsYRS.........NHRPv...SLEAAQGRLTVAYHARARSA.......GHG.
ENSLAFP00000018719  .......DGp..TLTVL......AN..QTL.........LVEGq...VIRSPTNTISIYFRTFQEDG.......LST.
ENSLAFP00000002138  .......GKvgdTRTVL......YV..LTG.........SSVPd...LIVSMTNQMWLHLQSDDSIG.......SPG.
ENSLAFP00000002552  .......LQa..AYLPR......GK..VCG.........DMLPp...PLLTDTNEIAVTLVSDTESG.......GSA.
ENSLAFP00000001222  .......--...SEPPT......IW..LSG.........MNIPp...PIISNKNWLRLHFVTDSSHR.......YRG.
ENSLAFP00000022313  .......GGs..DPLPL......AN..ESF.........LLRGq...VIRSPTHQAALRFQSLPPPA.......GPGt
ENSLAFP00000010905  fpssqdhPLp..MTERY......ID..YCE.........NGLSrr..SVRSSQNVAMIFFR--VQEP.......GNG.
ENSLAFP00000025996  .......L-...--QPL......IS..LCQ.........APAG....PLQLPGGNVTITYTYVGGRApm.....GQG.
ENSLAFP00000020178  .......A-...SGRLL......RT..FDG.........NRPPpsg.PLRLRPAALLLTFRSDARGN.......AQG.


                           110            
                             |            
d1sppb_               FLIYFY--....--gssp..
ENSLAFP00000011535  FSAAYQ--....--......
ENSLAFP00000015430  FQASH---....--s.....
ENSLAFP00000001788  FQATHS--....--t.....
ENSLAFP00000008208  FQIKYVA-....--v.....
ENSLAFP00000006852  FRAHF---....--f.....
ENSLAFP00000006852  FQAVHS--....--t.....
ENSLAFP00000015430  FAVNF---....--f.....
ENSLAFP00000006852  FAANF---....--......
ENSLAFP00000001788  FAATF---....--f.....
ENSLAFP00000015430  FKAHF---....--f.....
ENSLAFP00000001788  FAAVYEAI....C-......
ENSLAFP00000015430  FFAVYEAI....C-......
ENSLAFP00000019561  FSASYRA-....--......
ENSLAFP00000001788  FKAHF---....--f.....
ENSLAFP00000006852  FFAEYEAT....C-......
ENSLAFP00000001222  FHLEYK--....--a.....
ENSLAFP00000011535  FKAYY---....--f.....
ENSLAFP00000011243  FNATYTIVdrp.CG......
ENSLAFP00000002459  FVIDYT--....--e.....
ENSLAFP00000003576  FIGHYK--....--f.....
ENSLAFP00000011535  FSVAY---....--......
ENSLAFP00000011243  FNISWK--....--a.....
ENSLAFP00000006102  FRAKYSF-....--i.....
ENSLAFP00000013784  FSARYY--....--l.....
ENSLAFP00000001222  FKIHYES-....--v.....
ENSLAFP00000009052  FDAHYMA-....--m.....
ENSLAFP00000002138  FLIHYES-....--v.....
ENSLAFP00000019561  FLLWYS--....--......
ENSLAFP00000024776  FHAWYQAV....--......
ENSLAFP00000013784  FSLRYEI-....--f.....
ENSLAFP00000025560  FQAEYYS-....--......
ENSLAFP00000011243  FHASYA--....--a.....
ENSLAFP00000011243  FSAYW---....--......
ENSLAFP00000002459  FQLRYET-....--i.....
ENSLAFP00000002520  FSANYS--....--......
ENSLAFP00000002138  FKLAYQAYelqnC-......
ENSLAFP00000024776  FSATYQA-....--......
ENSLAFP00000011243  FLASYRQI....C-......
ENSLAFP00000011243  FQATF---....--v.....
ENSLAFP00000002138  FHLEYKTVglaaC-......
ENSLAFP00000002138  FNITYTTF....--......
ENSLAFP00000002138  FAIEF---....--k.....
ENSLAFP00000001583  FYASYE--....--s.....
ENSLAFP00000004942  FLASYSV-....--i.....
ENSLAFP00000001222  FNITYNT-....--f.....
ENSLAFP00000001222  FHLEYTA-....--i.....
ENSLAFP00000002520  FSIRYEI-....--f.....
ENSLAFP00000014838  FHAIFEEIta..C-......
ENSLAFP00000008183  FSARYN--....--f.....
ENSLAFP00000011243  FIASYTS-....--......
ENSLAFP00000001222  FHIIYQAYqlqsC-p.....
ENSLAFP00000009052  WKLSYSA-....--......
ENSLAFP00000002459  FHLEYKTVglssC-......
ENSLAFP00000004228  FNASYT--....--r.....
ENSLAFP00000002459  FKLEYQA-....--y.....
ENSLAFP00000011243  FKAKYS--....--i.....
ENSLAFP00000011243  FYATW---....--i.....
ENSLAFP00000011243  WRVSF---....--r.....
ENSLAFP00000001586  FSASYTS-....--v.....
ENSLAFP00000001583  FYALYQAV....--......
ENSLAFP00000001222  FVLSYHAY....--qlrvc.
ENSLAFP00000002459  FNITFTTF....--......
ENSLAFP00000011243  YEIIWT--....--s.....
ENSLAFP00000011243  FRLRFE--....--s.....
ENSLAFP00000006979  FRLAY---....--f.....
ENSLAFP00000011243  FQMQW---....--f.....
ENSLAFP00000012428  FLAYYQA-....--v.....
ENSLAFP00000002138  FSIQFSTT....--iastc.
ENSLAFP00000011243  FRARFS--....--......
ENSLAFP00000015430  FHLRYTS-....--......
ENSLAFP00000006852  FHARYTS-....--......
ENSLAFP00000002138  FVLNFHAF....--qlkkc.
ENSLAFP00000001583  FTTHW---....--......
ENSLAFP00000002138  FKIRYA--....--a.....
ENSLAFP00000005330  WKIHYM--....--s.....
ENSLAFP00000010601  FQATVS--....--f.....
ENSLAFP00000012428  WKLHYTT-....--......
ENSLAFP00000007640  FLAEYL--....--s.....
ENSLAFP00000001222  FAIQFSS-....--s.....
ENSLAFP00000011243  FKFSYRITs...C-......
ENSLAFP00000001222  FKVNYK--....--e.....
ENSLAFP00000011243  FRLMW---....--......
ENSLAFP00000011243  FLLEWFA-....--v.....
ENSLAFP00000005330  FEAFYA--....--a.....
ENSLAFP00000001788  FHIRYK--....--s.....
ENSLAFP00000002459  FAIQF---....--s.....
ENSLAFP00000012733  FKANFTT-....--......
ENSLAFP00000002552  FRQRFTF-....--......
ENSLAFP00000001222  FRIRYIA-....--fy....
ENSLAFP00000006979  FNATYQ--....--......
ENSLAFP00000002138  FNITFS--....--e.....
ENSLAFP00000002459  FKIRYSA-....--......
ENSLAFP00000002138  FQLTYTSF....--d.....
ENSLAFP00000002459  FELQFSS-....--f.....
ENSLAFP00000011243  FNASF---....--......
ENSLAFP00000002459  FNITFSEY....--dlepc.
ENSLAFP00000001222  FNITFS--....--e.....
ENSLAFP00000007874  FLLTYA--....--s.....
ENSLAFP00000001222  FQLVYTSF....--......
ENSLAFP00000017785  FQVPYVT-....--y.....
ENSLAFP00000007414  FAVLYQA-....--i.....
ENSLAFP00000011243  FKIKYE--....--a.....
ENSLAFP00000001222  FHFVYQAV....--......
ENSLAFP00000003531  FKIYYSFV....--......
ENSLAFP00000018719  FIMNYI--....--e.....
ENSLAFP00000006819  FQVPYVT-....--y.....
ENSLAFP00000002459  FA------....--iafsay
ENSLAFP00000011243  FHAEYSF-....--......
ENSLAFP00000002459  FHFVYQAV....--......
ENSLAFP00000008097  FNITYNFDm...C-......
ENSLAFP00000010601  FNLTYK--....--a.....
ENSLAFP00000006682  FQIPYVT-....--y.....
ENSLAFP00000002138  FHFVYQAV....--......
ENSLAFP00000010902  FCIHYS--....--i.....
ENSLAFP00000011243  FSASF---....--v.....
ENSLAFP00000022313  MALRYEA-....--f.....
ENSLAFP00000015950  --------....--gt....
ENSLAFP00000003844  FNIFYSINs...C-p.....
ENSLAFP00000018719  FNIRFEAFekghC-......
ENSLAFP00000003576  FMAMFSA-....--......
ENSLAFP00000022313  FVIHFF--....--ev....
ENSLAFP00000007640  FEATF---....--f.....
ENSLAFP00000020407  FVLHF---....--ke....
ENSLAFP00000012733  FNAKYNA-....--f.....
ENSLAFP00000008183  FQMLFTSFqeppC-e.....
ENSLAFP00000006102  FRMLFTSFveppC-......
ENSLAFP00000025996  FNATYH--....--......
ENSLAFP00000001586  VFLFYYFF....--......
ENSLAFP00000020407  FRIHYQAYlls.CG......
ENSLAFP00000011243  VGFTY---....--q.....
ENSLAFP00000020407  LSLRFE--....--af....
ENSLAFP00000021631  FNATYQ--....--v.....
ENSLAFP00000018719  FQLHYQA-....--......
ENSLAFP00000002138  FKAVYQEI....--ekggc.
ENSLAFP00000002552  FELTFTA-....--......
ENSLAFP00000001222  FSAPYQ--....--......
ENSLAFP00000022313  FHFHYRAYlls.C-......
ENSLAFP00000010905  FTLTI---....--ktd...
ENSLAFP00000025996  FLLSYSQD....--wlmc..
ENSLAFP00000020178  FALTYR--....--......


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0043701 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Manihot esculenta v147 - Cassava
NoYes   Actinidia chinensis Hongyang
NoYes   Amborella trichopoda 22
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Bathycoccus prasinos
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   [Ruminococcus] obeum
NoYes   Saprospira grandis str. Lewin
NoYes   Flexibacter litoralis DSM 6794
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella ruminicola 23
NoYes   Fluviicola taffensis DSM 16823
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurovum sp. NBC37-1
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]