SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Spermadhesin, CUB domain alignments in Loxodonta africana 69_3

These alignments are sequences aligned to the 0043807 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                       10        20            30          40       
                                                        |         |             |           |       
d1szba1               ..............lgpkwpep------...--VFGRLASPGFPG....EYANDQERRWTLTAP..PGYRLRLYFTH.
ENSLAFP00000011535  ......................-CGGVL...SAPSGNFSSPNFPR....LYPYNIECNWLIVVA..EGSSVLLTFHA.
ENSLAFP00000015430  ......................GCDHKV...TSTSGTITSPNWPD....KYPSKKECTWAISST..PGHRVKLTFME.
ENSLAFP00000001788  .....................i------...HSPNGIITSPNWPD....KYPSRKECTWEISAT..PGHRVKLAFSE.
ENSLAFP00000008208  ......................ECGGVF...TDPKAIFKSPGFPN....EYGDNQICYWHIRLK..YGQRIHLSFLD.
ENSLAFP00000006852  ......................-CGGFI...SKLNGTITSPGWPK....EYPTNKNCVWQVVAP..VQYRISLQFEV.
ENSLAFP00000006852  .....................l------...SSAEGTLASPNWPD....KYPSRRECTWNISST..AGHRVKLTFNE.
ENSLAFP00000015430  .....................d------...---NGHIQSPNYPD....DYRPSKVCIWRIQVS..EGFHVGLTFQS.
ENSLAFP00000006852  ......................-CGGDI...NKDAGQIQSPNYPD....DYRPSKECVWRITVS..EGFHVGLTFQA.
ENSLAFP00000001788  ....................rk------...--NEGQIQSPNYPD....DYRPMKECVWKITVS..EDYYVGLNFQA.
ENSLAFP00000015430  ......................-CGGFL...TKLNGSITSPGWPK....EYPPNKNCIWQLVAP..TQYRISLQFDF.
ENSLAFP00000001788  .....................l------...QESNGNLSSPGFPN....GYPSYTHCIWRVSVT..PGEKIVLNFTT.
ENSLAFP00000015430  .....................l------...QDSTGNFSSPEYPN....GYSAHMHCVWRISVT..PGEKIILNFTS.
ENSLAFP00000019561  ......................-CGGRM...EKAQGTLTTPNWPEs...DYPPGISCSWHIIAP..PDQVISLTFGK.
ENSLAFP00000001788  ......................-CGGLL...TKLNGTITTPGWPK....EYPPNKNCIWQVVAP..TQYRISVKFEF.
ENSLAFP00000006852  .....................l------...QDTTGNFSAPGFPN....GYPSYSHCVWRISVT..PGEKIILNFTS.
ENSLAFP00000001222  ......................PCGGNL...TGSSGFILSPNFPH....PYPHSRDCDWTITVN..ADYVISLAFIS.
ENSLAFP00000011535  ......................-CGGVL...TGLSGVLTSPEYPN....KYPNNVECHWVIRAT..GPATVKLVFMD.
ENSLAFP00000011243  ...................pqhGCGGYL...TGSNRTFATPDSDSng..RYDSNLNCVWFISAP..INKLIKLTFNT.
ENSLAFP00000002459  ......................PCGGDL...TGPSGVILSPNYPE....PYPPGKECDWKVTVS..PDYVIALVFNI.
ENSLAFP00000003576  ......................-CGGRL...EGPSGSFKTPNWPDr...DYPAGVACVWHIVAP..ENQLIELMFEK.
ENSLAFP00000011535  ......................ECQEVY...TFMRGNFSSPQYPS....SYPNNIRCHWIIRLP..PGYRVKVFFLD.
ENSLAFP00000011243  ......................GCGGEL...SGDIGSFSSPGYPN....RYPPNKECIWYIKTA..PGTSIQLTIHD.
ENSLAFP00000006102  ......................QCGIWVr..TSNGGHFASPNYPD....SYPPNKECIYILEAA..PRQRIELTFDEh
ENSLAFP00000013784  ......................DCSKNF...TSPNGTIESPGFPE....KYPHNLDCTFTILAK..PKMEIVLQFLT.
ENSLAFP00000001222  ................ipkcgaPCGGHF...SAPSGVILSPGWPG....YYKDSLNCEWVIEAE..PGHSIKITFER.
ENSLAFP00000009052  .....................l------...NDMFGHIQSPGYPD....SYPSDSEVMWNITVP..EGFRIKLYFMH.
ENSLAFP00000002138  ................vprceaPCGGHL...TASSGVILPPGWPG....YYKDSLNCEWIIEAK..PGHSIKITFDR.
ENSLAFP00000019561  ......................-CGGEV...TGESGYVASEGFPN....LYPPNKECIWTITVP..KAQTVSLSFRV.
ENSLAFP00000024776  ......................-CGGLL...FGPKGFFSSPNYPD....PYPPNTHCVWHIQVA..PGHAIQLKIDT.
ENSLAFP00000013784  ....................da------...----GYITSPGYPQ....DYPSHQNCEWIVYAPe.PNQKIVLNFNPh
ENSLAFP00000025560  ......................SCGGFL...SQTSGQFSSPFYPG....NYPNNARCIWDIEVR..SNHRVTVVFRD.
ENSLAFP00000011243  .....................l------...TNSFDTISSPFFPA....KYPSSQNCSWIIQAQp.PFNHITLSFSH.
ENSLAFP00000011243  .....................e------...---SGTFTSPNFPS....NYPNNWECIYRITVG..TSKQIALHFTN.
ENSLAFP00000002459  .................lrceaPCGGHL...TSPSGTILSPGWPG....FYKDALSCAWVIEAQ..PGYPIKITFDR.
ENSLAFP00000002520  ......................ECSQNY...TTPSGVIKSPGFPE....KYPNSLECTYIIFAP..KMSEILLEFES.
ENSLAFP00000002138  ................plcvat-CGGTL...SSLSGVILSPGFPG....AYPNNLDCTWKITLP..IGYGAHIQFLN.
ENSLAFP00000024776  ......................GCGGNL...TGLQGTFSTPNQLQ....LYPHQQLCMWYVSVP..PGHHIELEFHN.
ENSLAFP00000011243  .....................l------...TTPSGVFTSPNYPM....PYYHSSECYWWLKSS..HGSPFELEFEN.
ENSLAFP00000011243  ......................-CGGTF...HMAEGTFNSPGYPE....VYPSNVECVWNIVSS..PGNQLQLSFIT.
ENSLAFP00000002138  .................pscvvPCSGNF...TQRRGTVLSPGYPE....PYGNNLNCVWKITVT..EGSGIQVQVIS.
ENSLAFP00000002138  .....................f------...TAPSGIILSPNYPE....EYGNNMNCVWLIISE..PGSRIHLIFND.
ENSLAFP00000002138  ......................-CGGNL...TGPAGVILSPNYPQ....PYPPGKECDWRVKVN..PDFVIALIFKS.
ENSLAFP00000001583  .....................l------...TNNSGSFSSPWYPK....KYPTNMVCAWDIQVD..TRAHVKLSFEV.
ENSLAFP00000004942  ....................ga------...--ESGTLTSINYPQ....TYPNSTVCEWEIRVK..VGERVRIKFGD.
ENSLAFP00000001222  .....................f------...TAPMGTVLSPDYPE....GYGNNLNCIWTIISD..PGSRIHLSFND.
ENSLAFP00000001222  ......................PCGGIL...TKRKGTILSPGYPE....PYDNNLNCVWKITVP..EGAGIQVQVVS.
ENSLAFP00000002520  .....................k-CGGTIk..IENPGYLTSPGYPH....SYHPSEKCEWLIQAPy.PYQRIMINFNPh
ENSLAFP00000014838  .................gdcmr-CGQVL...RVPKGQILL----E....SYPLNAHCEWTIHAK..PGFNIQLRFVM.
ENSLAFP00000008183  ....................dg------...----GVFTSPNYPS....KYPPDRECIYIIEAA..PRQCIELYFDEk
ENSLAFP00000011243  ......................ECGGDL...QGPTGTFTSPNYPN....PNPHSRICEWKIAVQ..EGRRITLTFNN.
ENSLAFP00000001222  .................piclaQCGGAM...SDFSGVILSPGFPG....NYPSSLDCTWTIKLP..IGFGVHLQFVN.
ENSLAFP00000009052  ......................ECSDNLf..TQRTGIITSPDFPN....PYPKSSECFYTIELE..EGFRVSLQFEDl
ENSLAFP00000002459  .................ptcvvPCGGNL...TERRGTILSPGFPE....PYLNSLNCVWKIVVP..EGAGIQIQVIS.
ENSLAFP00000004228  .....................l------...SNPSGTFTSPCYPN....DYPNSQACMWTLRAP..TGYIIQITFND.
ENSLAFP00000002459  ......................QCGGAV...EEMEGVILSPGFPG....NYPSNMDCSWKIALP..VGFGAHIQFLN.
ENSLAFP00000011243  .....................d------...--SAGYVTSPNHPN....NYPQHADCVWILSAP..PEKSVQLQFEDq
ENSLAFP00000011243  ......................DCGGIQ...IGESGAIASPNYPA....SYDSLTHCSWVAGSP..TRHTITLTFSD.
ENSLAFP00000011243  ......................SCGGVF...NLSIGIIRSPAYSYs...NYPNNMYCLYVITVR..DDRVIQIKFND.
ENSLAFP00000001586  ....................da------...--FEGSFTSPNYPK....PHPELAYCVWHIHVE..KGYKIKLEFKE.
ENSLAFP00000001583  ......................SCGGVI...SSLSGSFSSPWYPT....NYPTDVECVWVIHVA..DTFHIELTIPS.
ENSLAFP00000001222  ...............lprceal-CGGNI...TAMNGTIYSPGYPD....EYPNFQDCFWIVRVP..PGNGIYINFTV.
ENSLAFP00000002459  ......................-----F...TSPSGIVLSPNYPE....DYGNHLHCVWLILAR..PESRIHLAFND.
ENSLAFP00000011243  ......................GCNREY...NKAFGNLKSPGWPD....SYNNDLDCTIILTAP..QNHTISLFFHS.
ENSLAFP00000011243  ......................-CGGTV...TGQSGIIESIGYPTl...PYRDNLFCEWHLQGL..SGHYFTIYFED.
ENSLAFP00000006979  ..................cget-----PeqiRAPSGIITSPGWPS....EYPAKINCSWFIRAN..PGEIITISFQD.
ENSLAFP00000011243  ......................-CENVIiv.NQTYGILESIDYPN....PYYANQRCNWTIQAT..KGNTVNYTFSA.
ENSLAFP00000012428  ....................qk------...--LFGEVTSPLYPK....PYPNNLETTTVITVP..QGYRVKLVFWQ.
ENSLAFP00000002138  ................lpscvaECGGRIh..VATSGRILSPGYPA....PYDNNLHCTWIIEAD..PGKTISLHFIV.
ENSLAFP00000011243  ......................GCGGIF...KTPSGEIHSPNYPS....PYRSNTECSWVIQVE..RNYRVLLNFTD.
ENSLAFP00000015430  ......................------...-------------N....NYPGGVDCEWVIVAE..EGYGVGLVFQT.
ENSLAFP00000006852  ......................------...-------------N....NYPSQARCDWVIVAE..DGYGVELIFRT.
ENSLAFP00000002138  ................fprcdaPCGYNV...TSQNGTIYSPGFPD....EYPILKDCIWLITVP..QGHGVYINFTL.
ENSLAFP00000001583  ......................SCGGVI...SSLSGSFSSPQYPE....SYPTDVQCVWEIHVD..KKFHIELMIPS.
ENSLAFP00000002138  ......................------...TESSGVILSPGYPG....NYFNSQTCSWTIKVE..PNYNITIFVDL.
ENSLAFP00000005330  ......................-CSGQVf..TERSGELSSPEYPK....PYPKLSSCTYRIHLE..EGFSVILDFVEs
ENSLAFP00000010601  ..................cdsl-----Vv..LFEESLIQSLHYPE....NYSNMANCNWIFQAP..KHYLIKLSFQS.
ENSLAFP00000012428  ......................DCSSELy..TEPSGYIASMEYPR....PYPSDLRCNYSIRVE..RGLTVHLKFLEp
ENSLAFP00000007640  ......................SCGGYL...RQAQGTFSSPYYPG....HYPPNIDCTWNIEVP..NKQYVKVRFKL.
ENSLAFP00000001222  ................lpsciaECGGRFk..GESSGRILSPGYPF....PYDNNLRCMWMIEVD..PGNIVSLQFLA.
ENSLAFP00000011243  .................sfvsr-CGSNF...TDPSGYIISPNYPK....HYDNNMNCTYIIEAD..SHSVVLLTFVT.
ENSLAFP00000001222  ......................-CGSNL...QGPSGTFTSPNFPF....QYDSNAQCVWVITAVn.TNKVIQINFEE.
ENSLAFP00000011243  ......................GCGGTL...YGDSGSFTSPGYPD....TYPNNTHCEWAITSP..TGRPVTVSFDF.
ENSLAFP00000011243  .....................v------...-GTHGKIASPLWPG....NYPHNSNYQWIVNVN..ASQVIHGRILE.
ENSLAFP00000005330  .....................f------...----GRLASPGFPG....EYANEREHHWTLTAP..PGYRLRLYFTH.
ENSLAFP00000001788  ......................------...-------------N....NYPGQVDCEWLLVSE..QGSRLELSFQT.
ENSLAFP00000002459  ......................ECGGTVk..GEVSGQVLSPGYPA....PYEHNLNCIWTIEAD..AGCTIGLHFLV.
ENSLAFP00000012733  .....................l------...WEPNTTFSSMNFPN....DYPNQAFCIWNLNAQ..TGKNIQLHFQE.
ENSLAFP00000002552  ......................GCGRVAv..LVEEGIIHSASYPD....LYPRNVTCHWFIHAP..EKHIIKLAFEE.
ENSLAFP00000001222  .....................d------...--STGVILSPGYPD....SYPNLQMCAWSISVE..KGYNISMFVEF.
ENSLAFP00000006979  ......................SCGQSL...KYFYGTFNSPNYPD....FYPPGSNCTWLIDTG..DHRKVILRFTD.
ENSLAFP00000002138  ......................-CGGYI...QGKSGTVLSPGFPD....FYPNSLNCTWTIEVS..HGKGVQLIFHT.
ENSLAFP00000002459  .....................l------...TDSTGVILSQSYPG....SYPQFQTCSWLVRVE..PEYNISLTVEY.
ENSLAFP00000002138  .....................g------...--NEGTLLSPNFPS....NYDNNHECIYKIETE..AGKGIRLRARS.
ENSLAFP00000002459  ......................ECGNSV...TGTQGTLLSPNFPV....NYNNNHECIYSIQTQ..PGKGIQLKAKA.
ENSLAFP00000011243  ......................-CGGLVrt.GDTPVFLFSPGWPG....SYSNWADCTWIIQAP..DS-TVEFNILS.
ENSLAFP00000002459  ................psceal-CGGFI...QGSSGTILSPGFPD....FYPNNLNCTWIIETS..HGKGVFFTFHT.
ENSLAFP00000001222  ......................-CGGDV...RGPSGTILSPGYPE....FYPNSLNCTWTVDVT..HGKGVQFNFHT.
ENSLAFP00000007874  ......................GCGHIVt..YQDSGTMTSKNYPG....TYPNHTVCEKTITVP..KGKKLILRLGD.
ENSLAFP00000001222  ......................ECGASA...TNNEGILLSPNYPL....NYENNHECIYSIQVQ..AGKGINISART.
ENSLAFP00000017785  ....................lg------...-DFTGYIESPNYPG....NYPANTECTWTINPP..PKRRILIVVPE.
ENSLAFP00000007414  ......................-CGGNY...SAMTAVVYSPDFPD....TYATGRVCYWTIRVP..GASHIHFNFTL.
ENSLAFP00000011243  ......................SCGGYL...HADRGVITSPMYPE....AYPPSLNCSWHVLVQ..SGLTIAVHFEQp
ENSLAFP00000001222  ................lpschaPCGSRS...TGSEGTVLSPNYPK....NYSVGHNCVYSIAVP..KEFVVFGQFVF.
ENSLAFP00000003531  ......................------...---NGHVQSPRFPN....SYPRNLLLTWRLHSQ..EKTRIQLAFDNq
ENSLAFP00000018719  ......................-CGGEL...SAVAGVVLSPNWPE....PYVEGEDCVWKIHVG..EEKRIFLDIQL.
ENSLAFP00000006819  ....................lg------...-DYTGYIESPNYPG....DYPANAECVWYISPP..PKRRILIVVPE.
ENSLAFP00000002459  ................lprcevPCGGNI...TSSNGTVYSPGFPS....PYSSSQDCVWLITVF..TGHGIRLNLSL.
ENSLAFP00000011243  ......................-CGGSLt..NFAGGNFTSPGYNGvs..NYSRNLNCEWSLSNPnqGNSSIYIHFES.
ENSLAFP00000002459  ................rpvctaPCGGQY...VGADGVVLSPNYPQ....NYTSGQICLYFVTVP..KDYVVFGQFTF.
ENSLAFP00000008097  ..................qcqh-CGGRFrl.TGSSGFIT--DGPG....NYKYKTKCTWLIEGQ..PNRIMRLRFKH.
ENSLAFP00000010601  ......................---GVV...SGPEGELHFPESPHl...YYESNQLCVWTLLVP..EKMHVLLSFSH.
ENSLAFP00000006682  ....................lg------...-EFTGYIESPNYPG....NYPASVECVWNINPP..PKRKILIVVPE.
ENSLAFP00000002138  ................lpscnaPCGGQY...TGSEGVLLSPNYPH....NYTAGQICLYSITVP..KEFVVFGQFAY.
ENSLAFP00000010902  .....................s------...--TNGSIHSPRFPH....TYPRNTVLIWRLVAVe.ENVWIQLTFDEr
ENSLAFP00000011243  ......................GCGGIL...HSDNGTIRSPHWPQ....NFPENSRCSWTVITH..ESKHLEISFDNn
ENSLAFP00000022313  ......................-CGGVIr..NATTGRVVSPGFPG....NYSNNLTCHWLLEAP..EGQRLHLHFEK.
ENSLAFP00000015950  ......................-CGGTL...RGTSSTISSPHFPS....EYENNADCTWTILAE..PGDTIALVFTD.
ENSLAFP00000003844  ...................cqh-CQGRFkl.TEPSGYLT--DGPI....NYKYKTKCTWLIEGY..PNAVLRLRFNH.
ENSLAFP00000018719  ................epicsaPCGGAVh..NATIGRVLSPSYPG....STNGSQVCVWTIEAP..EGQKLHLHFER.
ENSLAFP00000003576  ......................------...--------------....-------------VP..EGKVVVLNFRF.
ENSLAFP00000022313  .....................i------...TDSAGVVLSPNWPE....PYGRGQDCIWGVHVE..EDKRVMLDVRV.
ENSLAFP00000007640  .....................r------...------FATPGFPDs...PYPERAHCQWALRGD..ANLVLSLTFRS.
ENSLAFP00000020407  ......................-CGGEL...SEPAGVVLSPDWPQ....SYSPGQDCVWGLHVQ..EEKRILLQVEI.
ENSLAFP00000012733  ......................-CDGRFll.TGSSGSFQAAHYPN....SSESSIVCQWIIRVN..QGLSIELSFDP.
ENSLAFP00000008183  ...................lpa-CEFEM...GGPEGIVESVQIMKegkaSASEAVDCKWYIRAP..PRSKIYLRFLD.
ENSLAFP00000006102  ....................ipDCQFEL...SGADGIVRSSQVEQeektKPGQAVDCIWTIKAT..PKAKIYLRFLD.
ENSLAFP00000025996  ......................PCNRTL...EDFYGVFSSPGYSHla..SGSHPQSCLWLLDPH..DGRRLAVHFTA.
ENSLAFP00000001586  .....................n------...--------------....---PDENCTWTIERP..ENKSVRIIFSY.
ENSLAFP00000020407  .................tspvl-CNNNI...SEGEGYVESPDLGStas.RTLGLLDCTYSIHVY..PGYGIEIQVQT.
ENSLAFP00000011243  ....................vp------...----QSISSPNSSD....PDVPFYTCTWVIDAP..PHQQNKITVWA.
ENSLAFP00000020407  .................pscmaSCGGTIh..NATLGHIVSPEPGG....AAGPNLTCRWVIEAA..EGRRLHLHFER.
ENSLAFP00000021631  .....................t------...-ERRGVIYSPAWPL....NYPPGTNCSWYIQGD..RGDMITIRFPS.
ENSLAFP00000018719  ......................-CSVSF...SDPEGYIDSSDYPPl...PLNNFLECMYNVTVY..TGYGVELQVKS.
ENSLAFP00000002138  ......................------...--------------....---------------..----IKLAFEE.
ENSLAFP00000002552  .....................f------...--------------....-YYHLYLCIWKIMVS..EDKIILIKFTS.
ENSLAFP00000001222  .....................k------...--------------....---------------..-----------.
ENSLAFP00000022313  ...................ppgPCSWNF...SGPEGSLDSPTASNs...PPDVGLDCFYYISVY..PGYGVEIKVQN.
ENSLAFP00000010905  yrralrcvdmlslqgqftftan------...--------------....--QPQLHCAAFFIGE..PEEFITIHYDL.
ENSLAFP00000025996  ....................av-----L...LEAQGTLQRPLGRE....SRSFPANCTWLILGS..KEQTVTVRFQK.
ENSLAFP00000020178  .....................g------...--------------....--------------P..PGAALELTFRL.


                        50                                                                          
                         |                                                                          
d1szba1               FDLEL......SHL......C.........................................................
ENSLAFP00000011535  FDLEY......HDT......C.........................................................
ENSLAFP00000015430  MDIES......QPE......C.........................................................
ENSLAFP00000001788  FEIEQ......HQE......C.........................................................
ENSLAFP00000008208  FDLED......DPA......C.........................................................
ENSLAFP00000006852  FELEG......NDV......C.........................................................
ENSLAFP00000006852  FEIEQ......HQE......C.........................................................
ENSLAFP00000015430  FEIER......HDS......C.........................................................
ENSLAFP00000006852  FEIER......HDS......C.........................................................
ENSLAFP00000001788  FEIER......HDN......C.........................................................
ENSLAFP00000015430  FETEG......NDV......C.........................................................
ENSLAFP00000001788  MDLYK......SSL......C.........................................................
ENSLAFP00000015430  MDLYR......SRL......C.........................................................
ENSLAFP00000019561  FDLEP......DTY......C.........................................................
ENSLAFP00000001788  FELEG......NEV......C.........................................................
ENSLAFP00000006852  MDLFK......SRL......C.........................................................
ENSLAFP00000001222  FSIEP......N--......-.........................................................
ENSLAFP00000011535  FQVEG......NED......C.........................................................
ENSLAFP00000011243  FSLEA......ATTlrr...C.........................................................
ENSLAFP00000002459  FNLEP......G--......-.........................................................
ENSLAFP00000003576  FDVER......DNY......C.........................................................
ENSLAFP00000011535  LDLEE......PNSltrt..C.........................................................
ENSLAFP00000011243  FDVEY......HAS......C.........................................................
ENSLAFP00000006102  YYIEP......SFE......C.........................................................
ENSLAFP00000013784  FDLEHdplqvgEGD......C.........................................................
ENSLAFP00000001222  FQTEL......N--......-.........................................................
ENSLAFP00000009052  FDLES......SYL......C.........................................................
ENSLAFP00000002138  FQTEV......N--......-.........................................................
ENSLAFP00000019561  FDLEL......HPA......C.........................................................
ENSLAFP00000024776  LSMES......VAS......C.........................................................
ENSLAFP00000013784  FEIEK......H-D......C.........................................................
ENSLAFP00000025560  VQLES......G--......C.........................................................
ENSLAFP00000011243  FELES......STA......C.........................................................
ENSLAFP00000011243  FSLEE......AIG......Q.........................................................
ENSLAFP00000002459  FKTEV......N--......-.........................................................
ENSLAFP00000002520  FDLEP......DSNppggifC.........................................................
ENSLAFP00000002138  FSTEA......N--......-.........................................................
ENSLAFP00000024776  FSLEV......QDE......C.........................................................
ENSLAFP00000011243  FHLEQ......HPN......C.........................................................
ENSLAFP00000011243  FQLED......SQD......C.........................................................
ENSLAFP00000002138  FATEQ......N--......-.........................................................
ENSLAFP00000002138  FDVEP......Q--......-.........................................................
ENSLAFP00000002138  FNMEP......S--......-.........................................................
ENSLAFP00000001583  LKMEN......FYG......C.........................................................
ENSLAFP00000004942  FDIED......SDS......C.........................................................
ENSLAFP00000001222  FDLES......Q--......-.........................................................
ENSLAFP00000001222  FATEH......N--......-.........................................................
ENSLAFP00000002520  FDLED......R-D......C.........................................................
ENSLAFP00000014838  LSLEF......DYM......C.........................................................
ENSLAFP00000008183  YSIEP......SWE......C.........................................................
ENSLAFP00000011243  LRLEA......HPS......C.........................................................
ENSLAFP00000001222  FSTET......I--......-.........................................................
ENSLAFP00000009052  FDIED......HPDvs....C.........................................................
ENSLAFP00000002459  FVTEQ......N--......-.........................................................
ENSLAFP00000004228  FDIEE......APN......C.........................................................
ENSLAFP00000002459  FSTEP......N--......-.........................................................
ENSLAFP00000011243  FYIEA......TPN......C.........................................................
ENSLAFP00000011243  FDIEP......HST......C.........................................................
ENSLAFP00000011243  FDVVP......SAF......C.........................................................
ENSLAFP00000001586  IFLET......DAY......C.........................................................
ENSLAFP00000001583  LKLED......IYG......C.........................................................
ENSLAFP00000001222  LQTEP......I--......-.........................................................
ENSLAFP00000002459  IDVEP......Q--......-.........................................................
ENSLAFP00000011243  FGIEE......SSE......C.........................................................
ENSLAFP00000011243  FNLQN......SSN......C.........................................................
ENSLAFP00000006979  FDIQG......SRR......C.........................................................
ENSLAFP00000011243  FELED......HIN......C.........................................................
ENSLAFP00000012428  FDLEP......SEG......C.........................................................
ENSLAFP00000002138  FDTET......A--......-.........................................................
ENSLAFP00000011243  IDLEP......Q--......-.........................................................
ENSLAFP00000015430  FEVEE......ETD......C.........................................................
ENSLAFP00000006852  FEVEE......EAD......C.........................................................
ENSLAFP00000002138  LQTEA......V--......-.........................................................
ENSLAFP00000001583  LKLED......ILG......C.........................................................
ENSLAFP00000002138  FQSEK......Q--......-.........................................................
ENSLAFP00000005330  FDVET......HPEtq....C.........................................................
ENSLAFP00000010601  LEIEE......SGD......C.........................................................
ENSLAFP00000012428  FEIDD......HQQvh....C.........................................................
ENSLAFP00000007640  FYLVE......PNVspvt..C.........................................................
ENSLAFP00000001222  FDTEA......S--......-.........................................................
ENSLAFP00000011243  FHLEA......RSAiags..C.........................................................
ENSLAFP00000001222  FDLEI......G--......-.........................................................
ENSLAFP00000011243  ISIDD......PGD......C.........................................................
ENSLAFP00000011243  MNIEA......TYN......C.........................................................
ENSLAFP00000005330  FDLEL......SYL......C.........................................................
ENSLAFP00000001788  FEVEE......EAD......C.........................................................
ENSLAFP00000002459  FDTEE......V--......-.........................................................
ENSLAFP00000012733  FDLED......I--......-.........................................................
ENSLAFP00000002552  FTIGF......NQN......S.........................................................
ENSLAFP00000001222  FQTEK......E--......-.........................................................
ENSLAFP00000006979  FKLDG......T--......G.........................................................
ENSLAFP00000002138  FHLES......S--......-.........................................................
ENSLAFP00000002459  FLSEK......Q--......-.........................................................
ENSLAFP00000002138  FQLFE......G--......-.........................................................
ENSLAFP00000002459  FELSE......G--......-.........................................................
ENSLAFP00000011243  LDIES......HQT......C.........................................................
ENSLAFP00000002459  FHLES......G--......-.........................................................
ENSLAFP00000001222  FHLED......H--......-.........................................................
ENSLAFP00000007874  LNIES......Q-T......C.........................................................
ENSLAFP00000001222  FHLAQ......G--......-.........................................................
ENSLAFP00000017785  IFLPI......EDD......C.........................................................
ENSLAFP00000007414  FDIRD......S--......-.........................................................
ENSLAFP00000011243  FQIPN......GDSs.....C.........................................................
ENSLAFP00000001222  FQTSL......H--......-.........................................................
ENSLAFP00000003531  FGLEE......AENdi....C.........................................................
ENSLAFP00000018719  LNLSN......S--......-.........................................................
ENSLAFP00000006819  IFLPI......EDE......C.........................................................
ENSLAFP00000002459  LQAET......S--......-.........................................................
ENSLAFP00000011243  FYLES......HQD......C.........................................................
ENSLAFP00000002459  FHTAL......N--......-.........................................................
ENSLAFP00000008097  FATEC......S--......-.........................................................
ENSLAFP00000010601  LDVES......---......C.........................................................
ENSLAFP00000006682  IFLPS......EDE......C.........................................................
ENSLAFP00000002138  FQTAL......N--......-.........................................................
ENSLAFP00000010902  FGLED......PEDdi....C.........................................................
ENSLAFP00000011243  FLIPS......GDEq.....C.........................................................
ENSLAFP00000022313  VSLAE......D--......-.........................................................
ENSLAFP00000015950  FQLEE......G--......-.........................................................
ENSLAFP00000003844  FATEC......S--......-.........................................................
ENSLAFP00000018719  LSLNE......K--......-.........................................................
ENSLAFP00000003576  IDLES......DNL......C.........................................................
ENSLAFP00000022313  LRIGP......G--......-.........................................................
ENSLAFP00000007640  FDLAP......CDQ......R.........................................................
ENSLAFP00000020407  LNVRE......G--......-.........................................................
ENSLAFP00000012733  FNMYY......T--......-.........................................................
ENSLAFP00000008183  YEMQN......SNE......C.........................................................
ENSLAFP00000006102  YQMEH......SNE......C.........................................................
ENSLAFP00000025996  LDLGY......G--......-.........................................................
ENSLAFP00000001586  VQLDP......DGS......C.........................................................
ENSLAFP00000020407  LNLSR......E--......-.........................................................
ENSLAFP00000011243  LQLHS......R-D......C.........................................................
ENSLAFP00000020407  VSLDE......D--......-.........................................................
ENSLAFP00000021631  FRETP......THQ......Sprgsagaprqpaprywraattrlcwsadpldvlhslcpgwvwlggglwvlgrekgws
ENSLAFP00000018719  VNLSE......G--......-.........................................................
ENSLAFP00000002138  FELER......G--......-.........................................................
ENSLAFP00000002552  LDRKS......S--......F.........................................................
ENSLAFP00000001222  -----......---......-.........................................................
ENSLAFP00000022313  ISLLE......G--......-.........................................................
ENSLAFP00000010905  VSIDC......QG-......-.........................................................
ENSLAFP00000025996  LHLAC......G--......-.........................................................
ENSLAFP00000020178  FELAD......P--......-.........................................................


                                                                                                    
                                                                                                    
d1szba1               ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000008208  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000019561  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000003576  ..............................................................................
ENSLAFP00000011535  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000006102  ..............................................................................
ENSLAFP00000013784  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000009052  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000019561  ..............................................................................
ENSLAFP00000024776  ..............................................................................
ENSLAFP00000013784  ..............................................................................
ENSLAFP00000025560  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000002520  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000024776  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000004942  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000002520  ..............................................................................
ENSLAFP00000014838  ..............................................................................
ENSLAFP00000008183  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000009052  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000004228  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001586  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000006979  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000012428  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000015430  ..............................................................................
ENSLAFP00000006852  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000001583  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000005330  ..............................................................................
ENSLAFP00000010601  ..............................................................................
ENSLAFP00000012428  ..............................................................................
ENSLAFP00000007640  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000005330  ..............................................................................
ENSLAFP00000001788  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000012733  ..............................................................................
ENSLAFP00000002552  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000006979  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000007874  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000017785  ..............................................................................
ENSLAFP00000007414  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000003531  ..............................................................................
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000006819  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000002459  ..............................................................................
ENSLAFP00000008097  ..............................................................................
ENSLAFP00000010601  ..............................................................................
ENSLAFP00000006682  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000010902  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000015950  ..............................................................................
ENSLAFP00000003844  ..............................................................................
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000003576  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000007640  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000012733  ..............................................................................
ENSLAFP00000008183  ..............................................................................
ENSLAFP00000006102  ..............................................................................
ENSLAFP00000025996  ..............................................................................
ENSLAFP00000001586  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000011243  ..............................................................................
ENSLAFP00000020407  ..............................................................................
ENSLAFP00000021631  hgkmgpsagpgahtstlrshfclllplhfgdlrihsrgrgshrahlqaqrppgdsslltqgtevghwvrddlweekqc
ENSLAFP00000018719  ..............................................................................
ENSLAFP00000002138  ..............................................................................
ENSLAFP00000002552  ..............................................................................
ENSLAFP00000001222  ..............................................................................
ENSLAFP00000022313  ..............................................................................
ENSLAFP00000010905  ..............................................................................
ENSLAFP00000025996  ..............................................................................
ENSLAFP00000020178  ..............................................................................


                                                                                             60     
                                                                                              |     
d1szba1               ...................................................................E.YDFVKLSSG
ENSLAFP00000011535  ...................................................................S.FDFLEIYNG
ENSLAFP00000015430  ...................................................................A.YDHLEVYDG
ENSLAFP00000001788  ...................................................................A.YDHLEVFDG
ENSLAFP00000008208  ...................................................................L.ADYVEVYDS
ENSLAFP00000006852  ...................................................................K.YDFVEVRSG
ENSLAFP00000006852  ...................................................................A.YDHLEMYDG
ENSLAFP00000015430  ...................................................................A.YDYLEVRDG
ENSLAFP00000006852  ...................................................................A.YDYLEIRDG
ENSLAFP00000001788  ...................................................................A.YDYLEVRDG
ENSLAFP00000015430  ...................................................................K.YDFVEVRSG
ENSLAFP00000001788  ...................................................................W.YDYIEVRDG
ENSLAFP00000015430  ...................................................................W.YDYVEVRDG
ENSLAFP00000019561  ...................................................................R.YDSVSVFNG
ENSLAFP00000001788  ...................................................................K.YDYVEIWSG
ENSLAFP00000006852  ...................................................................W.YDYVEVRDG
ENSLAFP00000001222  ...................................................................-.YDFLYIYDG
ENSLAFP00000011535  ...................................................................T.YDYVAVFRG
ENSLAFP00000011243  ...................................................................S.YDYVKLYDG
ENSLAFP00000002459  ...................................................................-.YDFLHVYDG
ENSLAFP00000003576  ...................................................................R.YDFVAVFNG
ENSLAFP00000011535  ...................................................................D.FDHLVAFDG
ENSLAFP00000011243  ...................................................................N.YDSLEVYGG
ENSLAFP00000006102  ...................................................................R.FDHLEVRDG
ENSLAFP00000013784  ...................................................................K.YDWLDIWDG
ENSLAFP00000001222  ...................................................................-.YDVLEVHDG
ENSLAFP00000009052  ...................................................................E.YDYVKVETE
ENSLAFP00000002138  ...................................................................-.YDTLEVRDG
ENSLAFP00000019561  ...................................................................R.YDALEVFAG
ENSLAFP00000024776  ...................................................................L.FDRLEISPE
ENSLAFP00000013784  ...................................................................K.YDFIEIRDG
ENSLAFP00000025560  ...................................................................N.YDYIEVFDG
ENSLAFP00000011243  ...................................................................S.RDFLEILDG
ENSLAFP00000011243  ...................................................................C.VDLVEIRDG
ENSLAFP00000002459  ...................................................................-.YDTLEVRDG
ENSLAFP00000002520  ...................................................................R.YDRLEIWDG
ENSLAFP00000002138  ...................................................................-.HDYLEIQNG
ENSLAFP00000024776  ...................................................................K.LDYVEVYET
ENSLAFP00000011243  ...................................................................T.LDYLAVYDG
ENSLAFP00000011243  ...................................................................S.RDFVEIREG
ENSLAFP00000002138  ...................................................................-.WDSLEIYDG
ENSLAFP00000002138  ...................................................................-.FDFLAVKDD
ENSLAFP00000002138  ...................................................................-.YDFLHIYEG
ENSLAFP00000001583  ...................................................................P.YDFIEVFDG
ENSLAFP00000004942  ...................................................................H.FNYLRIYNG
ENSLAFP00000001222  ...................................................................-.FDFLAVKDG
ENSLAFP00000001222  ...................................................................-.WDSLDFYDG
ENSLAFP00000002520  ...................................................................K.YDYVEVIDG
ENSLAFP00000014838  ...................................................................Q.YDYVEVRDG
ENSLAFP00000008183  ...................................................................K.FDHIEVRDG
ENSLAFP00000011243  ...................................................................S.NEHVTVFNG
ENSLAFP00000001222  ...................................................................-.HDYLEVRSG
ENSLAFP00000009052  ...................................................................P.YDYIKIKAG
ENSLAFP00000002459  ...................................................................-.WDSLEVFDG
ENSLAFP00000004228  ...................................................................I.YDSLSLDNG
ENSLAFP00000002459  ...................................................................-.HDFIEIRNG
ENSLAFP00000011243  ...................................................................T.SNYLELRGG
ENSLAFP00000011243  ...................................................................A.WDSVTVRNG
ENSLAFP00000011243  ...................................................................S.QDYLAIYDG
ENSLAFP00000001586  ...................................................................R.FDFIAVYDG
ENSLAFP00000001583  ...................................................................P.YDYVEVFDG
ENSLAFP00000001222  ...................................................................-.YDFITVWDG
ENSLAFP00000002459  ...................................................................-.FDFLVIKDG
ENSLAFP00000011243  ...................................................................T.HDFLEVRNG
ENSLAFP00000011243  ...................................................................E.KDFVEIWEN
ENSLAFP00000006979  ...................................................................S.LDWLTIETY
ENSLAFP00000011243  ...................................................................S.TDYLELYDG
ENSLAFP00000012428  ...................................................................F.YDYVKISAD
ENSLAFP00000002138  ...................................................................-.HDILKVWDG
ENSLAFP00000011243  ...................................................................-.DSCITAYDG
ENSLAFP00000015430  ...................................................................G.YDYMELFDG
ENSLAFP00000006852  ...................................................................G.YDYMEAYDG
ENSLAFP00000002138  ...................................................................-.NDYIAVWDG
ENSLAFP00000001583  ...................................................................P.YDSVEIFNG
ENSLAFP00000002138  ...................................................................-.FDTLEVFDG
ENSLAFP00000005330  ...................................................................P.YDSLQIQTD
ENSLAFP00000010601  ...................................................................T.SDYVTVHRD
ENSLAFP00000012428  ...................................................................P.YDQLQIYAN
ENSLAFP00000007640  ...................................................................S.KDYVEVNG-
ENSLAFP00000001222  ...................................................................-.HDILRVWDG
ENSLAFP00000011243  ...................................................................A.NDGLHIIRG
ENSLAFP00000001222  ...................................................................-.YDTLTIGDG
ENSLAFP00000011243  ...................................................................V.QNYLILYDG
ENSLAFP00000011243  ...................................................................Y.YDKLRVFDG
ENSLAFP00000005330  ...................................................................E.YDFVKLSSG
ENSLAFP00000001788  ...................................................................G.YDYVELFDG
ENSLAFP00000002459  ...................................................................-.HDVLRIWDG
ENSLAFP00000012733  ...................................................................-.ADVVEIRDG
ENSLAFP00000002552  ...................................................................T.HDAVVIYGD
ENSLAFP00000001222  ...................................................................-.FDVLQVYDG
ENSLAFP00000006979  ...................................................................Y.GDYVKIYDG
ENSLAFP00000002138  ...................................................................-.HDYLLITED
ENSLAFP00000002459  ...................................................................-.YDEFEIFDG
ENSLAFP00000002138  ...................................................................-.-DILKVYDG
ENSLAFP00000002459  ...................................................................-.-DVLKVYDG
ENSLAFP00000011243  ...................................................................D.FDKLVIRDV
ENSLAFP00000002459  ...................................................................-.HDYLLITEN
ENSLAFP00000001222  ...................................................................-.HDYLLITEN
ENSLAFP00000007874  ...................................................................A.SDYLLFTSS
ENSLAFP00000001222  ...................................................................-.-DVLKIYDG
ENSLAFP00000017785  ...................................................................G.-DYLVMRKT
ENSLAFP00000007414  ...................................................................-.ADMVELLDG
ENSLAFP00000011243  ...................................................................NqGDYLVLKNG
ENSLAFP00000001222  ...................................................................-.-DVVEVYDG
ENSLAFP00000003531  ...................................................................R.YDFVEVEDI
ENSLAFP00000018719  ...................................................................-.-DILTIYDG
ENSLAFP00000006819  ...................................................................-.GDVLVMRKS
ENSLAFP00000002459  ...................................................................-.GDFITVWDG
ENSLAFP00000011243  ...................................................................Q.FDVLEFRVG
ENSLAFP00000002459  ...................................................................-.-DVVEVHDG
ENSLAFP00000008097  ...................................................................-.WDHLYVYDG
ENSLAFP00000010601  ...................................................................H.HNYLSIHSL
ENSLAFP00000006682  ...................................................................-.GDVLVMRKN
ENSLAFP00000002138  ...................................................................-.-DLAELFDG
ENSLAFP00000010902  ...................................................................K.YDFVEIEEP
ENSLAFP00000011243  ...................................................................Q.NSFVKVWAG
ENSLAFP00000022313  ...................................................................-.DDRLIIRNG
ENSLAFP00000015950  ...................................................................-.YDFLEIS--
ENSLAFP00000003844  ...................................................................-.WDHMYVYDG
ENSLAFP00000018719  ...................................................................-.-DRMMVYSG
ENSLAFP00000003576  ...................................................................R.YDFVDVYNG
ENSLAFP00000022313  ...................................................................-.-DVLTFYDG
ENSLAFP00000007640  ...................................................................G.SDLVTVYDS
ENSLAFP00000020407  ...................................................................-.-DMLTLFDG
ENSLAFP00000012733  ...................................................................-.-DVLNIYEG
ENSLAFP00000008183  ...................................................................K.RNFVAVYDG
ENSLAFP00000006102  ...................................................................K.RNFVAVYDG
ENSLAFP00000025996  ...................................................................-.-DAVHVYDG
ENSLAFP00000001586  ...................................................................E.SENIKVFDR
ENSLAFP00000020407  ...................................................................-.-EELLVLAG
ENSLAFP00000011243  ...................................................................S.QNYLEFQDS
ENSLAFP00000020407  ...................................................................-.NDRLMVRSG
ENSLAFP00000021631  qgvsevgigeglegrslpppgrpggrrrdtklgprvpwtlgqtngswvlgrtwnmlgdqxprrvllqA.EAATDVYEG
ENSLAFP00000018719  ...................................................................-.-ELLSIRGV
ENSLAFP00000002138  ...................................................................-.YDTLTVGDA
ENSLAFP00000002552  ...................................................................H.RPVLGMLQA
ENSLAFP00000001222  ...................................................................-.YDYLEIEGS
ENSLAFP00000022313  ...................................................................-.-EMVTVEGL
ENSLAFP00000010905  ...................................................................-.GDFLKVFDG
ENSLAFP00000025996  ...................................................................-.SEHLILHSP
ENSLAFP00000020178  ...................................................................-.RDRLELRDA


                                           70          80        90        100            110       
                                            |           |         |          |              |       
d1szba1               ..................AKVLA..TLCGQESTDTERAPGKDTFYSL.GSSLDITFRSDYSNEK.....PFTGFEAFY
ENSLAFP00000011535  .............asgdkGNLLG..RFCGQVPPP--------PFSSS.WHVMLVVFHSDKHVA-.....-SHGFSAAY
ENSLAFP00000015430  ..............rdakAPVLG..RFCGSKKPE--------AVLAT.SNRMFLRFFSDNSVQ-.....-RKGFQASH
ENSLAFP00000001788  ..............etekSPILG..RLCGNKIPE--------PLVAT.GNKMFVRFVSDASVQ-.....-RKGFQATH
ENSLAFP00000008208  ..............yddvHGFVG..RFCGDELPE--------DIIST.GNVMTLKFLSDASVT-.....-AGGFQIKY
ENSLAFP00000006852  ..............lsqdARLHG..KFCGSETPD--------VITSQ.SNNMRVEFKSDNTVS-.....-KRGFRAHF
ENSLAFP00000006852  ..............pdslAPILG..RFCGSKKPA--------PVVAS.SSSLFLRFHSDASVQ-.....-RKGFQAVH
ENSLAFP00000015430  ..............hsesSTLIG..RYCGYEKPD--------DIKST.SSRLWLKFVSDGSIN-.....-KAGFAVNF
ENSLAFP00000006852  ..............lteeSTLIG..HFCGYEKPE--------DVKSS.SNRMWMKFVSDGSIN-.....-KAGFAANF
ENSLAFP00000001788  ..............tsenSPLIG..RFCGYDKPE--------DIRST.ANTLWMKFVSDGTVN-.....-KAGFAATF
ENSLAFP00000015430  ..............ltadSKLHG..KFCGSEKPE--------VITSQ.YNNMRVEFKSDNTVS-.....-KKGFKAHF
ENSLAFP00000001788  ..............ywrkSPLLG..RFCGDKLPD--------VLTST.DSRLWVEFRSSSNWV-.....-GKGFAAVY
ENSLAFP00000015430  ..............fwrkAPLRG..RFCGGKLPE--------PIVST.DSRLWVEFRSSSNWV-.....-GKGFFAVY
ENSLAFP00000019561  .............avtddAKRLG..KFCGDKVPG--------PISSD.GNELLVQFVSDLSVT-.....-ADGFSASY
ENSLAFP00000001788  ..............lsseSKLHG..KFCGAEVPE--------VITSQ.FNNMRIEFKSDNTVS-.....-KKGFKAHF
ENSLAFP00000006852  ..............ywrkAPLLG..RFCGDKVPE--------PLIST.DSRLWVEFRSSSNIL-.....-GKGFFAEY
ENSLAFP00000001222  ..............pdsnSPLIG..SFQDSKLPE--------RIESS.SNTMHLAFRSDGSVS-.....-YTGFHLEY
ENSLAFP00000011535  ................pgPAHRH..HYCGSAKPP--------TLVSL.DHELQVIFKSDFNIG-.....-GRGFKAYY
ENSLAFP00000011243  ..............dsenANLAG..TFCGSTVPA--------PFVSS.GNFLTVQFVSDIILE-.....-REGFNATY
ENSLAFP00000002459  ..............rdslSPLIG..SFYGSQLPG--------RIESS.SNSLFLAFRSDASVS-.....-NAGFVIDY
ENSLAFP00000003576  .............geindAKRIG..RYCGDSPPA--------PIVSE.SNELLIQFLSDLSLT-.....-ADGFIGHY
ENSLAFP00000011535  ..............aseeAPLLG..SWCGHHLPP--------PITSS.QNQLLLLLHTDRSTT-.....-RRGFSVAY
ENSLAFP00000011243  ..............pdfhSPRIA..QLCAQRSSENPM-----QVSST.GNELAIRFKTDSSIN-.....-GRDFNISW
ENSLAFP00000006102  ..............pfgfSPLID..RYCGMKSPP--------LIRST.GRFMWIKFSSDEELE-.....-GLGFRAKY
ENSLAFP00000013784  ..............iqhvGPLIG..KYCGTKTPS--------ELRSS.TGILSLTFHTDMAVA-.....-KDGFSARY
ENSLAFP00000001222  ..............pnllSPLLG..SYNGTQVPQ--------FLFSS.SNFIYLLFTTDNSRS-.....-NNGFKIHY
ENSLAFP00000009052  ..................DQVLA..NFCGRETTDTEQTPGQEAILSP.GSFMSITFRSDFSNEE.....RYTGFDAHY
ENSLAFP00000002138  ..............sansSPLIG..EYHGTQAPQ--------FLIST.GNFMYLLFTTDNSRS-.....-NVGFLIHY
ENSLAFP00000019561  ..............agtsGQRLG..RFCGTFRPA--------PVVVP.GNQATLRMTADEGTG-.....-GRGFLLWY
ENSLAFP00000024776  .................pEGPLL..RVCGKLPPP--------TLNTN.ASRLRVAFASDSSVE-.....-GLGFHAWY
ENSLAFP00000013784  ..............dsesADLLG..KHCGNIAPP--------TIISS.GSVLYIKFTSDYARQ-.....-GAGFSLRY
ENSLAFP00000025560  ..............pyhsSPLIA..RVCNGVSG---------SFTSS.SNFMSVRFISDGSVT-.....-RKGFQAEY
ENSLAFP00000011243  ..............sdydAPLRG..RYCGISMPH--------PITSF.SNALTLRFVSDSRVN-.....-SVGFHASY
ENSLAFP00000011243  ..............gyenSPSLG..IYCGSNPPP--------RIISH.SNKLWIRFKSDLFDS-.....-RSGFSAYW
ENSLAFP00000002459  ..............rtysAPLIG..VYHGTQVPQ--------FLIST.SNYLYLLFSTDKSHS-.....-DIGFQLRY
ENSLAFP00000002520  ..............fpevGPHIG..RYCGQKTPG--------RIRSS.SGILSMVFYTDSAIA-.....-KEGFSANY
ENSLAFP00000002138  ..............pyhtSPMIG..QFSGSDLPS--------ALLST.THETLIHFYSDHSQN-.....-RQGFKLAY
ENSLAFP00000024776  .............snsgaLSLLG..RFCGAEPPP--------RLVSS.HHELAVLFRTDHGIS-.....-SGSFSATY
ENSLAFP00000011243  ..............pstsSHLRT..QLCGDQKPP--------LIRSS.GDSMSLKMRTDEGQQ-.....-GGGFLASY
ENSLAFP00000011243  ...............natGHLVG..RYCGHVLPL-------NYSSIV.GHILWVRFVSDGSGS-.....-DTGFQATF
ENSLAFP00000002138  ..............gdmtAPRLG..SFSGTTVPA--------LLNST.SNQLYLHFQSDISVA-.....-AAGFHLEY
ENSLAFP00000002138  ..............gisdITVLG..TFSGNEVPS--------QLASS.GHIVRLEFQSDHSTT-.....-GRGFNITY
ENSLAFP00000002138  ..............edsnSPLIG..SFQGSQAPE--------RIESS.GNSLFLAFRSDASVG-.....-LSGFAIEF
ENSLAFP00000001583  ..............pqsePLSLG..RFCASTTP---------IFTSS.SNRMTVVFHSDAIIT-.....-NIGFYASY
ENSLAFP00000004942  ..............igvgRTEIG..KYCGLGLQM------NHTIESK.SNEITVLFMSGIHVS-.....-GRGFLASY
ENSLAFP00000001222  ..............dspdSPILG..TFTGAEVPS--------HLTSN.SHILRLEFQADHSMS-.....-GRGFNITY
ENSLAFP00000001222  ..............gdnnAPRLG..SYSGTTIPH--------LLNST.SNNLYLNFQSDISVS-.....-AAGFHLEY
ENSLAFP00000002520  ..............dnpnGRLWG..KFCGKIAPS--------PVVSL.GPFLFIRFVSDYETH-.....-GAGFSIRY
ENSLAFP00000014838  ..............dnsdGQIIK..RFCGNERPA--------PIRST.GPALHILFHSDGSKN-.....-FDGFHAIF
ENSLAFP00000008183  ..............pfgfSPIIG..RFCGQQNPP--------VIKSS.GRFLWIKFFADGELE-.....-SMGFSARY
ENSLAFP00000011243  ..............irsnSPQLE..ELCSSVNVS-------DQIKSS.GNTMKVVFFTDGSRP-.....-YGGFIASY
ENSLAFP00000001222  ..............ssetSTVIG..RLSGPQIPS--------SIFST.THETSLYFHSDYSQN-.....-KQGFHIIY
ENSLAFP00000009052  ..................LKSLG..PFCGEKAPG--------PINTQ.SHSVQILFHSDNSGE-.....-NRGWKLSY
ENSLAFP00000002459  ..............adntVTMLG..SFSGTTVPA--------LLNST.SNQLYLHFYSDISVS-.....-AAGFHLEY
ENSLAFP00000004228  ..................ESQ-T..KFCGATAKG-------LSFNSS.ANEMHVSFSSDFSIQ-.....-KKGFNASY
ENSLAFP00000002459  ..............pyetSRMMG..RFSGSELPS--------SLLST.SHETTVYFHSDHSQN-.....-RPGFKLEY
ENSLAFP00000011243  ..............adsnAPVLS..KFCGTSLPS--------SQLSS.EEVMYLRFRSDNSPT-.....-HVGFKAKY
ENSLAFP00000011243  ..............gspgSPIIG..QYCGSSNPR--------IIQSG.SNQLVVIFNSDHSVQ-.....-HGGFYATW
ENSLAFP00000011243  ..............snvsDPLLG..KFCGSNLPP--------NVKSS.NNSLLLVFKTDSFQT-.....-ARGWRVSF
ENSLAFP00000001586  ..............sstdSGLIA..QVCGLTKP---------TFESS.SDSLTVVLSTDYANS-.....-YRGFSASY
ENSLAFP00000001583  ..............rqvaSLSVG..RFCAGAEL---------TFLSS.SNIMTAVFRSDAMIT-.....-NTGFYALY
ENSLAFP00000001222  ..............pdqnSPQIG..QFSGNTALE--------SVYST.SNQILIKFHSDFTT--.....-SGFFVLSY
ENSLAFP00000002459  ..............ataeAPVLG..TFSGNQLPS--------SITSS.GHVARLEFQTDHSTG-.....-KRGFNITF
ENSLAFP00000011243  ..............sdssYPLLG..KYCGALLPN--------PVFSQ.NNVLYLRFKSNSGIS-.....-SHGYEIIW
ENSLAFP00000011243  ...............hisGHVLG..RFCGNTIPD--------SIDTS.GNVALVKFVTDGSLT-.....-ASGFRLRF
ENSLAFP00000006979  .................kNIESY..RACGSTIPP--------PYISS.QDHVWIRFHSDDNIS-.....-RKGFRLAY
ENSLAFP00000011243  ..................SRRMG..RYCGTDIPP--------PGSTT.GSKLRVLFYTDGVGN-.....REKGFQMQW
ENSLAFP00000012428  ..................KKNLG..RFCGQLGSPLGNPPGKKEFLSQ.GNKMLLTFHTDFSNEEngaimFYKGFLAYY
ENSLAFP00000002138  ..............pvdsNILLK..EWSGSALPE--------DIHST.FNSLTLQFDSDFFIS-.....-KSGFSIQF
ENSLAFP00000011243  ..............lntaTTRLA..SVCGRQQLT-------NPITSS.GNALFVRFQSGASSQ-.....-SRGFRARF
ENSLAFP00000015430  ..............ydstAPRLG..RYCGSGPPE--------EVYSA.GDSVLVKFHSDDTIT-.....-KKGFHLRY
ENSLAFP00000006852  ..............ydstAPRLG..RFCGSWPLE--------EIYSA.GDSLMIRFHTDDTIN-.....-KKGFHARY
ENSLAFP00000002138  ..............pdqnSPQLG..VFSGNTALE--------TAYSS.TNQVLLKFHSDFSN--.....-GGFFVLNF
ENSLAFP00000001583  ..............priaSLSMG..KFCAPVTV---------IFFSS.SNIMTVVFRSDSMIT-.....-NIGFTTHW
ENSLAFP00000002138  ..............ssgqSPLLV..VLSGNHTEQ-------SNFTSK.SNQLYLRWSTDHATS-.....-KKGFKIRY
ENSLAFP00000005330  ..................KGEYG..PFCGTTLPP--------RIETK.SNSVTITFVSDQSGD-.....-HTGWKIHY
ENSLAFP00000010601  ...............verKKEIA..RLCGFAVPA--------PVLSS.SSVMFISFQSDENMS-.....-FRGFQATV
ENSLAFP00000012428  ..................GKSIG..EFCGTQRPP--------DLDSS.SNAVDLLFFTDESGD-.....-SRGWKLHY
ENSLAFP00000007640  ..................----E..KHCGEKSQF--------VVTSN.SSKMTVRFHSDQSYT-.....-DTGFLAEY
ENSLAFP00000001222  ..............ppenEMLLK..EISGSLIPE--------GIHST.LNIVTIQFDTDFYIS-.....-KSGFAIQF
ENSLAFP00000011243  ..............yslsSSPIA..TLCGEETL---------APIST.SGPMLLNFYSNAHIT-.....-DFGFKFSY
ENSLAFP00000001222  ............gevgdpRTVLQ..VLTGSFVPD--------LIVSM.SNQMWLHLQTDESVG-.....-SVGFKVNY
ENSLAFP00000011243  ..............pdadSPSTG..PYCGADIAI-------APFVGS.SHQVFIRFHAVYAVQ-.....-PSAFRLMW
ENSLAFP00000011243  ..............lgihSRQIG..TYCGTQSA---------SFSSS.RNSLTFQFSSDSSIS-.....-GKGFLLEW
ENSLAFP00000005330  ..................AKVLA..TLCGRESTDTEQAPGNTIFYSPpGSSLEVTFHSDYSNEK.....PFTGFEAFY
ENSLAFP00000001788  ..............ldstAVGLG..HFCGSGPPE--------EIYST.GDAVLIRFHTDDTIN-.....-KKGFHIRY
ENSLAFP00000002459  ..............pvesGVLLK..ELSGPALPK--------DLHST.FSSVVLQFSTDFFTS-.....-KQGFAIQF
ENSLAFP00000012733  ..............reddSLLLGaaVYTGSGPVK--------DVFST.TNRMTVLFITDDLVT-.....-SRGFKANF
ENSLAFP00000002552  ...............peeEHELA..KLCGVLNPT--------PICSP.SNMTVIRFKSDGEND-.....-FQGFRQRF
ENSLAFP00000001222  ..............pniqSPVLI..SLSGDYSSA-------FNITSN.GHEVFLQWSADHGNN-.....-KKGFRIRY
ENSLAFP00000006979  .............leenpHKLLRvlTAFDSHAPL--------TVVSS.SGQIRVHFCADKVNA-.....-ARGFNATY
ENSLAFP00000002138  ...............gsfTEPVA..RLTGSVLPH-----TIKAGLFG.NFTAQLRFISDFSIS-.....-YEGFNITF
ENSLAFP00000002459  ..............psgqSPLLK..ALSGNYSAP-------LIVTSS.SNSVYLRWSSDHAYN-.....-RKGFKIRY
ENSLAFP00000002138  ..............kdssSRPLG..AFTKNEMMG-------LILNST.SNHLWLEFNTNGSDT-.....-DQGFQLTY
ENSLAFP00000002459  ..............nnnsARLLG..VFSRSEMMG-------MTLNST.SSSLWLDFITDAENT-.....-SKGFELQF
ENSLAFP00000011243  ............igdsnlAQELA..VLCGREIPG--------PIRST.GEYMLIRFTSDFSVT-.....-GAGFNASF
ENSLAFP00000002459  ...............gsfTQPLK..QLTGSRLPA-----PISAGLYG.NFTAQVRFISDFSMS-.....-YEGFNITF
ENSLAFP00000001222  ...............gsfTQPLA..RLTGSELPS-----TINAGLYG.NFRAQLRFISDFSIS-.....-YEGFNITF
ENSLAFP00000007874  ..................SDQYG..PYCGSMTVP-------KELLLN.TSEVTIRFKSGSHIS-.....-GRGFLLTY
ENSLAFP00000001222  ..............kdktTHLLG..AFTGASMRG-------LTLSST.SNQLWLEFNSDAEGT-.....-DEGFQLVY
ENSLAFP00000017785  ..............sssnSVTTY..ETCQTYERP-------IAFTSR.SKKLWIQFKSNEGNS-.....-ARGFQVPY
ENSLAFP00000007414  ................ytHRVLV..RFNGRNRPP-------LSFNVS.LDFVILYFFSDRVNQ-.....-AQGFAVLY
ENSLAFP00000011243  ........pdiyspplgpHGGNG..HFCGSHPSS--------TMFTS.DNEMFAQFISDNSNG-.....-GQGFKIKY
ENSLAFP00000001222  ..............ptqqSSLLS..SLSGSHSGE-------SLPLSS.GNQITIRFTSVGPIT-.....-AKGFHFVY
ENSLAFP00000003531  ..............setsTVIRG..RWCGHKEVP-------PRITSR.TNQIKITFKSDDYFV-.....AKPGFKIYY
ENSLAFP00000018719  ..............devmPHILG..QYLGNSGPQ--------KLYSS.TPDLTIQFHSDPAGLIfg...KGQGFIMNY
ENSLAFP00000006819  ..............asptSITTY..ETCQTYERP-------IAFTSR.SRKLWIQFKSNEGNS-.....-GKGFQVPY
ENSLAFP00000002459  ..............pqqtAPQLG..VFTRSLVKK--------TLHSS.SNQVLLKFHRNAAT--.....-GGIFAIAF
ENSLAFP00000011243  ...............nadGPLIW..RLCGHSRPT-------MPLVIP.HPQVWIHFVTNRQVE-.....-HIGFHAEY
ENSLAFP00000002459  ..............hsqqSRLLS..SLSGSHTGE-------SLPLAT.SNQVLIKFSAKGQAP-.....-ARGFHFVY
ENSLAFP00000008097  ..............dsiyAPLVA..AFSGLIVPERDGNETVPEVVAT.SGYALLHFFSDAAYN-.....-LTGFNITY
ENSLAFP00000010601  .................gDRLIG..KLCEEGLFS--------SVHIG.SNSIRLKFISDATDY-.....-AAGFNLTY
ENSLAFP00000006682  ..............sspsSITTY..ETCQTYERP-------IAFTAR.SRKLWINFKTSEANS-.....-ARGFQIPY
ENSLAFP00000002138  ..............thpqARLLS..SLSGSHSGE-------TLPLAT.SNQILLRFSAKSGAS-.....-ARGFHFVY
ENSLAFP00000010902  ................sdGTILG..RWCGSGAVP-------GKQISK.GNQIRIRFVSDEYFP-.....SQPGFCIHY
ENSLAFP00000011243  .............teeadKALLA..TGCGNVAPD--------PIITP.KNTFTAVFQAQGAP--.....-AQGFSASF
ENSLAFP00000022313  .............dnveaPPVYD..SYEVEYLPI-------EGLLSS.GRHFFVELSTDSNGA-.....-AAGMALRY
ENSLAFP00000015950  ..................-----..----------------------.----------------.....---------
ENSLAFP00000003844  ..............dsiyAPLIA..VLSGLIVPEVRGNETVPEVVTT.SGYALLHFFSDAAYN-.....-LTGFNIFY
ENSLAFP00000018719  .............rtnksALLYD..SFQTESVPF-------EGLLSD.SNTISIEFMSDQARV-.....-ASAFNIRF
ENSLAFP00000003576  ...............hanGQRIG..RFCGTFRPG--------ALVSS.SNKMMVQMISDANTA-.....-GNGFMAMF
ENSLAFP00000022313  ..............ddltARVLG..QYSGPRGHF--------KLFTS.MADVTIQFQSDPGASVlg...YQQGFVIHF
ENSLAFP00000007640  .............lspiePSAVV..QLCGTYPPSYNL-----TFLSS.QNVFLVTLITNTERR-.....-HPGFEATF
ENSLAFP00000020407  ..............dgpsARVLA..QLRGPQPRR--------RLLSS.GPDLTLQFQAPPGPPNpg...LGQGFVLHF
ENSLAFP00000012733  ...............igpSKILR..AFIWETNPG--------IIRIF.SNQVTVTFLIESDES-.....VYAGFNAKY
ENSLAFP00000008183  ..............sssvEDLKA..KFCSTVAN---------DVMLR.TGLGVIRMWADEGSR-.....-NSRFQMLF
ENSLAFP00000006102  ..............sssiENLKA..KFCSTVAN---------DVMLK.TGVGVIRMWADEGSR-.....-LSRFRMLF
ENSLAFP00000025996  ................tgPPETT..RLLRSLTYFSNGKAV--TVETL.SGQAVVAYHTVAWSS-.....-GRGFNATY
ENSLAFP00000001586  ..............tstaGPLLG..EVCSKNDFV-------PVFESS.SNTLTFQIITDSTVI-.....-QRSVFLFY
ENSLAFP00000020407  ...............ggsPGLAP..RLLANSSMLGEG----QVLRSP.TNRLLLHFQSPRSPR-.....-GSGFRIHY
ENSLAFP00000011243  ..............pasnRNPGI..RFCGGNISA------VPAFYSS.VRTAIVVFKAEVFNRN.....SRVGFT---
ENSLAFP00000020407  .................gGPLSP..VIYDSDMDD----VPERGLISD.AQSLYVELLSETPAN-.....-PLLLSLRF
ENSLAFP00000021631  .................lGERGD..RLLQTLSYRSNHRPV--SLEAA.QGRLTVAYHARARSA-.....-GHGFNATY
ENSLAFP00000018719  .................dGPTLT..VLANQTLLVEGQ-----VIRSP.TNTISIYFRTFQEDG-.....-LSTFQLHY
ENSLAFP00000002138  ............gkvgdtRTVLY..VLTGSSVPD--------LIVSM.TNQMWLHLQSDDSIG-.....-SPGFKAVY
ENSLAFP00000002552  .................aYLPRG..KVCGDMLPP--------PLLTD.TNEIAVTLVSDTESG-.....-GSAFELTF
ENSLAFP00000001222  ..................EPPTI..WLSGMNIPP--------PIISN.KNWLRLHFVTDSSHR-.....-YRGFSAPY
ENSLAFP00000022313  ...............ggsD--PL..PLANESFLLRG-----QVIRSP.THQAALRFQSLPPPA-.....GPGTFHFHY
ENSLAFP00000010905  wilkgekfpssqdhplpmTERYI..DYCENGLSR-------RSVRSS.QNVAMIFFRVQEPG--.....--NGFTLT-
ENSLAFP00000025996  ..................LQPLI..SLCQAPAG---------PLQLP.GGNVTITYTYVGGRAP.....MGQGFLLSY
ENSLAFP00000020178  ................asGRLLR..TFDGNRPPP------SGPLRLR.PAALLLTFRSDARGN-.....-AQGFALTY


                      120        
                        |        
d1szba1               AA--ed.....
ENSLAFP00000011535  Q---.......
ENSLAFP00000015430  ----s......
ENSLAFP00000001788  S---t......
ENSLAFP00000008208  VA--v......
ENSLAFP00000006852  ----f......
ENSLAFP00000006852  S---t......
ENSLAFP00000015430  ----f......
ENSLAFP00000006852  ----.......
ENSLAFP00000001788  ----f......
ENSLAFP00000015430  ----f......
ENSLAFP00000001788  EAI-c......
ENSLAFP00000015430  EAI-c......
ENSLAFP00000019561  RA--.......
ENSLAFP00000001788  ----f......
ENSLAFP00000006852  EA--tc.....
ENSLAFP00000001222  KA--.......
ENSLAFP00000011535  ----f......
ENSLAFP00000011243  TIV-drpcg..
ENSLAFP00000002459  T---e......
ENSLAFP00000003576  K---f......
ENSLAFP00000011535  ----.......
ENSLAFP00000011243  K---a......
ENSLAFP00000006102  SF--i......
ENSLAFP00000013784  Y---l......
ENSLAFP00000001222  ES--v......
ENSLAFP00000009052  MA--m......
ENSLAFP00000002138  ES--v......
ENSLAFP00000019561  S---.......
ENSLAFP00000024776  QAV-.......
ENSLAFP00000013784  EI--f......
ENSLAFP00000025560  Y---s......
ENSLAFP00000011243  A---a......
ENSLAFP00000011243  ----.......
ENSLAFP00000002459  ET--i......
ENSLAFP00000002520  S---.......
ENSLAFP00000002138  QAY-elqnc..
ENSLAFP00000024776  QA--.......
ENSLAFP00000011243  RQ--ic.....
ENSLAFP00000011243  ----v......
ENSLAFP00000002138  KTV-glaac..
ENSLAFP00000002138  TT--f......
ENSLAFP00000002138  ----k......
ENSLAFP00000001583  E---s......
ENSLAFP00000004942  SV--i......
ENSLAFP00000001222  NT--f......
ENSLAFP00000001222  TA--i......
ENSLAFP00000002520  EI--f......
ENSLAFP00000014838  EE--itac...
ENSLAFP00000008183  N---f......
ENSLAFP00000011243  TS--.......
ENSLAFP00000001222  QA--yqlqscp
ENSLAFP00000009052  SA--.......
ENSLAFP00000002459  KTV-glssc..
ENSLAFP00000004228  T---r......
ENSLAFP00000002459  QA--y......
ENSLAFP00000011243  S---i......
ENSLAFP00000011243  ----i......
ENSLAFP00000011243  ----r......
ENSLAFP00000001586  TS--v......
ENSLAFP00000001583  QAV-.......
ENSLAFP00000001222  HA--yqlrvc.
ENSLAFP00000002459  TT--f......
ENSLAFP00000011243  TS--.......
ENSLAFP00000011243  E---s......
ENSLAFP00000006979  ----f......
ENSLAFP00000011243  ----f......
ENSLAFP00000012428  QAV-.......
ENSLAFP00000002138  ST--tiastc.
ENSLAFP00000011243  S---.......
ENSLAFP00000015430  TS--.......
ENSLAFP00000006852  TS--.......
ENSLAFP00000002138  HA--fqlkkc.
ENSLAFP00000001583  ----.......
ENSLAFP00000002138  A---a......
ENSLAFP00000005330  M---s......
ENSLAFP00000010601  S---f......
ENSLAFP00000012428  TT--.......
ENSLAFP00000007640  L---s......
ENSLAFP00000001222  SS--s......
ENSLAFP00000011243  RI--tsc....
ENSLAFP00000001222  K---e......
ENSLAFP00000011243  ----.......
ENSLAFP00000011243  FA--v......
ENSLAFP00000005330  A---a......
ENSLAFP00000001788  K---s......
ENSLAFP00000002459  S---.......
ENSLAFP00000012733  TT--.......
ENSLAFP00000002552  TF--.......
ENSLAFP00000001222  IAF-y......
ENSLAFP00000006979  Q---.......
ENSLAFP00000002138  S---e......
ENSLAFP00000002459  SA--.......
ENSLAFP00000002138  TSF-d......
ENSLAFP00000002459  SS--f......
ENSLAFP00000011243  ----.......
ENSLAFP00000002459  SE--ydlepc.
ENSLAFP00000001222  S---e......
ENSLAFP00000007874  A---s......
ENSLAFP00000001222  TS--f......
ENSLAFP00000017785  VT--y......
ENSLAFP00000007414  QA--i......
ENSLAFP00000011243  EA--.......
ENSLAFP00000001222  QAV-.......
ENSLAFP00000003531  SF--v......
ENSLAFP00000018719  ----ie.....
ENSLAFP00000006819  VT--y......
ENSLAFP00000002459  SA--y......
ENSLAFP00000011243  SF--.......
ENSLAFP00000002459  QAV-.......
ENSLAFP00000008097  NF--dmc....
ENSLAFP00000010601  KA--.......
ENSLAFP00000006682  VT--y......
ENSLAFP00000002138  QAV-.......
ENSLAFP00000010902  S---i......
ENSLAFP00000011243  ----v......
ENSLAFP00000022313  EA--f......
ENSLAFP00000015950  ----gt.....
ENSLAFP00000003844  SI--nscp...
ENSLAFP00000018719  EAF-ekghc..
ENSLAFP00000003576  SA--.......
ENSLAFP00000022313  F---ev.....
ENSLAFP00000007640  ----f......
ENSLAFP00000020407  K---e......
ENSLAFP00000012733  NA--f......
ENSLAFP00000008183  TSF-qeppce.
ENSLAFP00000006102  TS--fveppc.
ENSLAFP00000025996  ----h......
ENSLAFP00000001586  YF--f......
ENSLAFP00000020407  QA--yllscg.
ENSLAFP00000011243  ----yq.....
ENSLAFP00000020407  ----eaf....
ENSLAFP00000021631  Q---v......
ENSLAFP00000018719  QA--.......
ENSLAFP00000002138  QE--iekggc.
ENSLAFP00000002552  TA--.......
ENSLAFP00000001222  Q---.......
ENSLAFP00000022313  RA--yllsc..
ENSLAFP00000010905  ----iktd...
ENSLAFP00000025996  S---qdwlmc.
ENSLAFP00000020178  R---.......


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0043807 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Manihot esculenta v147 - Cassava
NoYes   Actinidia chinensis Hongyang
NoYes   Amborella trichopoda 22
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Bathycoccus prasinos
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   [Ruminococcus] obeum
NoYes   Saprospira grandis str. Lewin
NoYes   Flexibacter litoralis DSM 6794
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella ruminicola 23
NoYes   Fluviicola taffensis DSM 16823
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurovum sp. NBC37-1
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]