SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Concanavalin A-like lectins/glucanases alignments in Dipodomys ordii 76_1

These alignments are sequences aligned to the 0046423 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1dyka1               hgpcvaesepalltgskqfg..........................................................
ENSDORP00000004746  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvntqtdddyagfifgyqds
ENSDORP00000012229  tdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgynefnavnfigtffinterdddyagfvfgyqss
ENSDORP00000000427  wkkatlhavdvtldpdtahphlflyedsksvrledsrqnlpdkperfdswpcvlgretftsgshywevevgdrtdwai
ENSDORP00000000159  ktpqpigevyftetfdsgklagwvlskakkddmdseisiydgrweieelkenqvpgdrglvlksrakhhavaaalerp
ENSDORP00000004727  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSDORP00000003629  rkilktyaadvrldpdtaysrlivsedrkcvhygdiqqklpdnperfyrynivlgsqcissgrhywevevgnrsewgl
ENSDORP00000013312  mramlrkfstditldpatanaylvlsedlksvkyggirqqlpdnperfdqsatvlgaqiftcgrhywevevgnktewe
ENSDORP00000006777  ckptrldllldmppvshdiqllhswnnndrslnvfvkeddklifhrhpvaqstdairgkvgytrglhvwqitwamrqr
ENSDORP00000012298  atvyfreefldgerwrnrwvqstndsncghftvssgkfyghkekdkglqttqngrf......................
ENSDORP00000009508  pavyfkeqfldgddwtsrwieskhksdfgkfvlssgkfygdqekdkglqtsqdarfyalsarfepfsnkgqtlvvqft
ENSDORP00000001545  fikdndrltfhrhpvaqssegirgkvgharglhawqihwparqrgthavvgvataraplhavgytalvgsdaeswgwd
ENSDORP00000002361  wrslcarslaeealrtdilcnlpsykakvrafqhafstndcsrnvyikkngftlhrnpiaqstdgartkigfsegrha
ENSDORP00000000528  pcflkdwemhvhfkvhgtgkknlhgdgialwytrdrlvpgpvfgskdnfhglavfldtypndetterv..........
ENSDORP00000010791  xpcflrdwelqvhfkihgqgkknlhgdglaiwytkdrmqpgpvfgnmdkfvglgvfidtypneekqqeaqkrryspgv
ENSDORP00000011238  aipssdqiriapslksqrgsvwtktka...................................................
ENSDORP00000010089  aarvdltldpdtahpalllspdrrgvrmaerrpevadhskrfssdccvlgaqgfrsgrhywevevggrrgwavgaare
ENSDORP00000001376  xqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvisgstwyaiglayk
ENSDORP00000004121  dihpvpaaltldpgtahqrlilsddctivaygnlhpqplqdspkrfdvevsvlgseafssgvhywevvvaektqwvig
ENSDORP00000013180  rtahisldpqtshpklllsenhrrarfsykwqnspdnpqrfdratcvlahsgftggrhswvvgvdlthggsctlgvvs
ENSDORP00000014663  xpvpytgrlqggltarktiiikgyvpphsksfainlkvsssgdlalhinprlgenavvrnsflngswgsee.......
ENSDORP00000013181  itldpetaspslvlsedrksgrytrrkrtlpdsplrfdglpavlgspgftsgrhrwqvevqlgkggscavgvaveevg
ENSDORP00000002877  medvridektvspllqlsddrrtvtfsakkpkacvdgperfdhwpnalaatsfqeglhawvvnvqnscaykvgvasgq
ENSDORP00000004311  iynptipyvgtiseqlkpgslivirghvpsdadrfqvdlqvgssvkpradvafhlnprfkrsgcivcntltqekwg..
ENSDORP00000010919  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafn............................
ENSDORP00000005266  asnlnlkpgeclrvrgevapdakxfvlnlgkdsnnlclhfnprfnahgdantivcnskdggawgaeqrepaf......
ENSDORP00000007149  xacditfdpdtahrylrlqednrkvtntspwehpypdhpsrfvywrqvlsqqslylhryyfevei.............
ENSDORP00000010588  ecftdgchywevyvgektkwilgvcsesvsrkgkvtaspanghwllrqsrelhyealtspqtsfrlkeppkcvgifld
ENSDORP00000008072  kgfa..........................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  vlpaleclrldpatahpllelskgdtvvqcglldqrrasqperfdyntcvlasrvlscdrhywevtvgsksdwrleii
ENSDORP00000000831  pppgectfdqdecaftqekrnpsswhrrrgetptsytgpkgdhttgvgyymyieashmvygqkaqlssrplrgv....
ENSDORP00000001903  xxditldpatahpslevskdgksvsssrgprtpascdpsrfseqtcvlsherfpsgrhywevhvgsrsrw........
ENSDORP00000005972  leltnmdmkpgttlklkgriasdassftinlgqdknqldlhfnprfsestivcnsfsggswgpeqrd...........
ENSDORP00000001918  ktl...........................................................................
ENSDORP00000007695  avawfafdpgsahsdiifsndnltvtcssyddrvvlgktgfskgvhyweltidrydnhpdpafgvarmdvmkdvmlgk
ENSDORP00000004311  ylsktlpfkgrlnspmgfgrtvvikgevntnakgfnvdlvagkskdialhlnprlnvkafvrnsflqgawgeeernit
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  fhlnkdtchpaltisedgltvlrnerktparepppsrsrfsrcaavmgnlipvrgrhywevevdehsdytvgvaaedi
ENSDORP00000002718  pcenggicflldghp...............................................................
ENSDORP00000014779  cvfdepystcgysqsedddfnwdqvntltkptsdpwmpsgsfmlvntsgrpegqrthlllpqlkendthcidfhyfvs
ENSDORP00000015207  twggs.........................................................................
ENSDORP00000006488  vggfk.........................................................................
ENSDORP00000015549  tdahr.........................................................................
ENSDORP00000011135  pvdvlkaldfhkspegitkttgfctnrknskgsdtayrvsklaqisaptkqlfp........................
ENSDORP00000005153  ctfddgpgacdyhqdlyddfewvhvsaqeplylppempqgsymivdssnhdpgekarlqlptmkendthcidfsylly
ENSDORP00000010633  rfirfvplewnpsgk...............................................................
ENSDORP00000015207  dsy...........................................................................
ENSDORP00000001625  mdiiseldlvnttfgvtqvsglhnaskaflfqdidrevhaaphvsekliqlfrnks......................
ENSDORP00000012987  psvdvlralrfpslpdgvrrtrgicpadaayrvsrpaqlsaptrqlfp..............................
ENSDORP00000008072  dye...........................................................................
ENSDORP00000011377  nmlhrltadltldpgtahrrllvstdrrsvrlappgtpapldgparfdqlpavlgaqgfgagrhcwevetaetasgrd
ENSDORP00000012080  ipviqivyetlkdqqegkkgkttiktgasvlnkwqmnpydrgsafaigsdglccqsrevkewhgcratkglmkgkhyy
ENSDORP00000015490  ymdqckdgditycelnarf...........................................................
ENSDORP00000001823  vsfkleektahsslalfkkdtgvkyglvgleptq............................................
ENSDORP00000006422  padllkvldfhnlpdgitkttgfcatrrsakgpdvayrvtkeaqlsaptkql..........................
ENSDORP00000005718  ryvrmvpldwsgegriglrievyg......................................................
ENSDORP00000007984  gvva..........................................................................
ENSDORP00000012134  pvipyvttifgglyagkmvmlqgvvplharrfqvdfqcgcslsprpdiaihfnprfhtttphaicn............
ENSDORP00000008778  sr............................................................................
ENSDORP00000011367  cqdvdecqqgrceqtcvnspgsytchcdgrgglklspdmdtcewqdilpcvpfsmaksmksfv...............
ENSDORP00000015433  aryirivplawnprgkaglrlgiyg.....................................................
ENSDORP00000010222  gt............................................................................
ENSDORP00000007984  yidlckngdidycelnarfgfrnii.....................................................
ENSDORP00000015122  csfdehysncgysvalgtngftweqintwekpmldpavptgsfmmvnssgrasgqkahlllptlkendthcidfhyyf
ENSDORP00000007984  pcknnvmcrdgwnry...............................................................
ENSDORP00000009837  hyh...........................................................................
ENSDORP00000004773  evscnferdactwhtghltdahwrrveshgpgydhttgrgfymllnptdppaqgqgahlltgpqvpaapeecfsfwyh
ENSDORP00000002718  dlckngdidycelkarfglrniia......................................................
ENSDORP00000002718  tld...........................................................................
ENSDORP00000007045  atvvldhtggfeglllvdddllgvighsnfgtirsttcvykgkwvyevlissqgl.......................
ENSDORP00000002313  agctfeevsdpavpceysqaqyddfqweqvrihpgtrasadlphgaylmvnasqhapgqrahvifqslsendthcvqf
ENSDORP00000008072  ggae..........................................................................
ENSDORP00000006248  kinchfedgfcywiqdlnddneweriqgvtfppttgpnfdhtfgnnsgfyistptfqg....................
ENSDORP00000010222  fgssqned......................................................................
ENSDORP00000002718  pcknnavckdgwnrf...............................................................
ENSDORP00000012229  svfdvlelagaarrgsgrrlvkgpdpsspafrienadlippmpddkfqdlvdavraekgflllaslrqmkr.......
ENSDORP00000008778  qkg...........................................................................
ENSDORP00000011689  nmdfevsgiye...................................................................
ENSDORP00000012107  pkrasigsrppsvrgsrdrftgesytvlgdtaiesgqhywevkaqkdcksysvgvayktlgkfdqlgktntswcihvn
ENSDORP00000015490  ls............................................................................
ENSDORP00000011311  svtpcfegpme...................................................................
ENSDORP00000010633  cygdrhfw......................................................................
ENSDORP00000009458  elqcnfehgicnweqsteddfdwtrnqgststlntgpmkdntlgtskghylyiessepqafqnhasllspilnatsps
ENSDORP00000015490  pcrnggicregwnrf...............................................................
ENSDORP00000011367  tkmqcfsvte....................................................................
ENSDORP00000005718  scv...........................................................................
ENSDORP00000005718  ncenggkciekyhgys..............................................................
ENSDORP00000010633  iy............................................................................
ENSDORP00000002718  canqgvcmqqwegf................................................................
ENSDORP00000012335  pcqnggqcydsesssyk.............................................................
ENSDORP00000007984  eyi...........................................................................
ENSDORP00000004740  hldlteligvplpsavsfvtgyggfp....................................................
ENSDORP00000009458  cdfeanscgwfeaiggdhfdwlwsspsdlpadfeqqapprdhthnttqghfmfilknssslsqvaklqsptfsqtgsg
ENSDORP00000004828  sgiwprhavkllsvlnqmpqrhgpd.....................................................
ENSDORP00000005348  ttfdlfslsninrktigakqfrgpdpgvpayrfvrfdyippvnsddlgriikvmrqkdgffltaqlkqd.........
ENSDORP00000012335  ..............................................................................
ENSDORP00000010222  ca............................................................................
ENSDORP00000006888  ek............................................................................
ENSDORP00000014173  gmdty.........................................................................
ENSDORP00000015433  niadlavrrhsritfegk............................................................
ENSDORP00000015490  fv............................................................................
ENSDORP00000015433  pcfhggrcverysyy...............................................................
ENSDORP00000008422  fnqepqnpgvmqfdyvrklmprhvflnsdgssnltgwgvnvfssgk................................
ENSDORP00000014582  pkhlfrygvrnhplkdsiqnggrspgreedtsnpqgglpvlyfsgrrerlllqpevlaespreaftvevwvrpeggqs
ENSDORP00000000340  vgpvfifpnast..................................................................
ENSDORP00000006042  sceggkscfrlgralliretfkvfpeglpeey..............................................
ENSDORP00000011311  eh............................................................................
ENSDORP00000002081  pgfdlisqfqvdkaasrravqrvmgstalqvayklgnnvdfrvptrhlyphgl.........................
ENSDORP00000007641  ylshedqqvthhrepqgparpgsfelwqvqcaqgfragrhywevltsdhsvtlgvtypeltrrkqgmntdnigrgpds
ENSDORP00000004773  apfscdfeqdscgwrdistsgyrwlrdragavlaglglhtdhthgtdlgwymavgthpgkeastatlrspvlrqaapa
ENSDORP00000005198  dlsrayslfsysyvegkdnelliykertgdyslhiggrkvtfkvmetllspv..........................
ENSDORP00000004766  tkcdfeddskplcdwsqvsaddgdwirtsgpsptgisgppggyptgegyylhmdsrt.....................
ENSDORP00000010554  v.............................................................................
ENSDORP00000009837  rflrflplewnpkgrigmriev........................................................
ENSDORP00000006857  tvphktslpdglrtgtvmrirgivpdkasrfhvnllcsedqgadaal...............................
ENSDORP00000004773  pgscdfesglcgwshctraspgryswdwsgasipsrypqptvdhtlgtqaghfvlfetgvlgtggraawlcseplpat
ENSDORP00000005718  qgdrnyw.......................................................................
ENSDORP00000010633  nchnggkcvekhsgys..............................................................
ENSDORP00000015231  enlpiqevsfdpekaqcclvengqilthgsggkgyglastgvtsgcyqwkfyivkenrgnegtcvgvsrwpvhdfnhr
ENSDORP00000008778  segt..........................................................................
ENSDORP00000002718  cl............................................................................
ENSDORP00000010794  fdginyfavsgaqifcsgkhywelsvddsldwavgiyrncktmnepviidpedvflllcvkddigysifttspmlrhy
ENSDORP00000010053  hetplprswspkdk................................................................
ENSDORP00000000831  yciecdfeenhlcgfvnrwnpnvnwfvgggttrnthsnlpkdhtfkselghymyvdsvyvkhfqevaql.........
ENSDORP00000006237  vfifpqesatahv.................................................................
ENSDORP00000007918  gqhgf.........................................................................
ENSDORP00000010789  lppqitpiedpdvgpaydfgpgansgqgaqs...............................................
ENSDORP00000013462  vwtqqyavlnseesfhftafgrkvfssgkhywevsvddsstwalgvtrhssiesnltesedlfl..............
ENSDORP00000015490  rgl...........................................................................
ENSDORP00000010679  rlsqyrveisfneavgnfmgavldrtiyavlnseesllftafghpvfssgkhywevsvddsstwalgvvrdsaigsnl
ENSDORP00000005726  mremlrkfqvd...................................................................
ENSDORP00000010222  yqpqi.........................................................................
ENSDORP00000001974  ykapvptgevyfadsfdrgslsxxxxxxxxxxxxxxxxxxxkwevdemketklpgdkglvlmsrakhhaisakl....
ENSDORP00000007984  csnqgvclqqwdgfs...............................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  erlsqhwveisfneavgnqdhgssvrhnhgvlnseesphftafgcqvfssgkhyweisvddsstwalgvvrdsvigsn
ENSDORP00000000902  eavpavsavvgvrlvqtpgaqglrlaaadpralsfpasrifyrcqr................................
ENSDORP00000015490  canqgvclqqwdgf................................................................
ENSDORP00000004773  prscsfedsacgfssggqglwrrqahvtghvpwgpwadhttetaqghymvvdtspgalsqgqvapltsarhp......
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  edvdvlqrlglswtkaggsrspappgvipfqsgfiftqrarlqaptatvlpaalgtklalvlslcshr..........
ENSDORP00000015433  rcygdrnsw.....................................................................
ENSDORP00000000831  veascnfeedfckfyqdkeglgwtrvkvkpnmyragdhttgfgyyllantkftsqpgyigrlygpslpgn........
ENSDORP00000007918  nlwlsy........................................................................
ENSDORP00000008744  nsedslhftafgcqvfssgkhywdvsvdesstwalgvvtdsvigsnsvsedvflllfv....................
ENSDORP00000002285  tygfncefgwgshktfchwehdnhvqlkwsvltsktgpiqdhtgdgnfiysqadenq.....................
ENSDORP00000003368  dtlvaidtyncdlhfkvardrssgypltiegfaylwsgarasygvrgrvcfemineeisvkhlpstepdphvvrigws
ENSDORP00000003394  pqlkisddrltvvgekgysmvrashgvrkgawyfeitvdemppdtaarlg............................
ENSDORP00000009086  dcrcgeedeyfdwvwddasrs.........................................................
ENSDORP00000011645  frldastshqnlrvdnlsvewdamggkvqdikarekdgkgrtaspvnspadtmidggehywevryepdskafgvgvay
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ramlnsndvseylkisphglarcdassfesvrctfcvdagvwyyevtvvtsgvmqigwatrdskflnhegygigdde.
ENSDORP00000008778  g.............................................................................
ENSDORP00000011611  sgfncnfdfpeepcgwmydhakwlrstwtsstspndrtfpdeknflrlqsdgrregqygrlisppvhlp.........
ENSDORP00000013538  saikkirnpkgplilrlgtasvtqptrrvfprslpeefa.......................................
ENSDORP00000013974  tk............................................................................
ENSDORP00000005843  ypslrrrgasaaarlgcnrqswclkrydleywafhdgq........................................
ENSDORP00000010222  vlepi.........................................................................
ENSDORP00000004325  dv............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  al............................................................................
ENSDORP00000013182  scmvgvardtvkrkgdlslrpedgvwalrlsssgiwantspeaqlfpalrprrvgial....................
ENSDORP00000015207  pcahggscrprkesye..............................................................
ENSDORP00000008905  xawkdkmsyrwflqhsaqvgyirvrfyegpel..............................................
ENSDORP00000011670  slnwtiglptdnghdsd.............................................................
ENSDORP00000007640  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgty...............
ENSDORP00000014580  cdlhfkisrdrlsassltmesfaflwaggrasygvskgkvcfemkvtekipvrhlytkdidihevrigwslttsgmll
ENSDORP00000008412  erwggfn.......................................................................
ENSDORP00000008778  gdcirtykpe....................................................................
ENSDORP00000014953  iidllpspsaatnwtagllvdsge......................................................
ENSDORP00000014173  vn............................................................................
ENSDORP00000012269  lhftafghqvfssgkhywevsvddsctwalgvirnsaigsnl....................................
ENSDORP00000011311  s.............................................................................
ENSDORP00000004766  hcdfedsahpfcdwshvfsdgghwawgsknlptivggskdstyegeh...............................
ENSDORP00000009369  vhscnfdhglcgwirekdsdlhwepirdpaggqyltvsaakapggkaarlvlplghllhsgdlclsfrhkv.......
ENSDORP00000001250  dntchfedekicgytqdltdnfdwtrqnaltqnpkrspntgpptdisgt.............................
ENSDORP00000000609  xttpftplhikvkpk...............................................................
ENSDORP00000013695  ktslsysteqssremqlslgpraeelvmggesr.............................................
ENSDORP00000006888  vepcrrrkees...................................................................
ENSDORP00000006888  k.............................................................................
ENSDORP00000014663  fqvnfmvgqdpgadiafhfnprfdgwdkv.................................................
ENSDORP00000014524  pgfdlmgafglvateyastpgvamgpwawgwaptftlfkdaqltrrardvhpalpp......................
ENSDORP00000002925  tdlskkafvfpketd...............................................................
ENSDORP00000008975  evdllpmpgpnanwtaglsvqysqdssliywfngtqavqvpvgspagpgsapidg.......................
ENSDORP00000009862  chnggrclekhagi................................................................
ENSDORP00000008034  kgkrldfygrsdryvsltnsipelsrftacidlvsmadrstywmafsyiakntllg......................
ENSDORP00000009547  pgfkmleaynlteknfasvqgvslesgsfpshsayrlqknafisqptaelhpnglppsytiillfrllpetpndpfai
ENSDORP00000013182  rdleykt.......................................................................
ENSDORP00000004773  atdfetglglwsrsegwtrnhsaggpqslawplrdhsqnsahgtflasvakpgtpavlsspvfqasdpyncslify..
ENSDORP00000015608  gctadllve.....................................................................
ENSDORP00000011311  gyg...........................................................................
ENSDORP00000009882  svdcsfdhgvcdwkqdreddfdwnpadrdnavgyymavpalaghkkdvgrlklllpglqpqsnfcllf..........
ENSDORP00000014749  syavrsgkwyfefevvtggamrvgwarpgcrpdvelgaddqafvfegskgqrwh........................
ENSDORP00000002643  gvhgy.........................................................................
ENSDORP00000008412  ggf...........................................................................
ENSDORP00000004406  csytsrdqgwvvgihtvgdqgnr.......................................................
ENSDORP00000015608  lelevrpadlgqvfhgr.............................................................
ENSDORP00000006462  syvvqsgrwyfefeavttgemrvgwarpelrpdvelgadelayvfnghrgqrwhlgsesfg.................
ENSDORP00000014161  dvglaqarhplstrshyfeveivdpgekcyialglarkdypknrhpgwsrgsvayhaddgkifhgsgvgdpfgpr...
ENSDORP00000009648  vpitldpntasgwlsvhddlasvsnqpywrqvenpdrfssapalmgsqvfsqgs........................
ENSDORP00000008146  lrvgwsidfshpqlgedefsygfdgrglkaengqfeefgqt.....................................
ENSDORP00000015608  kpcarykstgdpwlt...............................................................
ENSDORP00000010181  fralmpaleemtldpssthtnlmvspsdrrvqsaehkgtaetevskddlhlnkamalvehqslsevehycdvdvgdnp
ENSDORP00000012134  pcsralsrglwpgqviivrglvtqepkdftlslrdeaarvpvtlrasfadqtlawishwgrkklipapfl........
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  fpstvpsqphmrrhhsgt............................................................
ENSDORP00000013974  gspsns........................................................................
ENSDORP00000010919  xvklyegpqlvadsgviidtsmrggr....................................................
ENSDORP00000007213  gscnfetpsgnwttacsltqgtendldwtignrifteapspdpdhtpgsgq...........................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  vgcyvasrpltkdsn...............................................................
ENSDORP00000012877  agfycnfendfcgwsqgilsphtpraprwqvrsikdsryqehqghslmlsttdvptsenatvtsttfpapmknspcel
ENSDORP00000000831  agscafedgtcgfdsvmeflpwilneeghyvyvdtsfakpgekavllssdlqaeewsclrlvyqiaassgalsds...
ENSDORP00000004746  paalqpvltdpalnelyl............................................................
ENSDORP00000009837  diidlakqqdpqiiim..............................................................
ENSDORP00000012348  isvaksvsipelsaftlcfeatkvgkd...................................................
ENSDORP00000005348  tdfrnfqmvpldpkgttqidp.........................................................
ENSDORP00000006888  pm............................................................................
ENSDORP00000002643  pclnggtclvtwndfn..............................................................
ENSDORP00000015608  kvsmkfngrsgvqlrtprdlsdlaaytalkfhlqsptpapapgent................................
ENSDORP00000003089  xvsirldgenkaveynavgafkdavrvvfrgpqvn...........................................
ENSDORP00000010458  gtdytwvfsfkkiylgkqmhrvgvldyeygql..............................................
ENSDORP00000015512  sflfdekcgynaehlllnlkrdrvesraglatlleaeriqtghhasldyivadagiakgrhfwafrvepysylvkvgv
ENSDORP00000004552  efhcgfedgniclftqddtdnfdwtk....................................................
ENSDORP00000015664  fkmmemfglvekdfssvegvsmepgtfnlypcyhlhkdalvsqptkylh.............................
ENSDORP00000009837  crhggkcrekpsgf................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  rlktnsqpfkldpkmthkklkisndglqmekdesslkkshtpe...................................
ENSDORP00000010917  rlaiskdqravrsvpglplllaaerlltgchlsvdvvlgdvavtqgrsywacavdpasylvkvgvglesklqesfqga
ENSDORP00000011435  pelqeysaiiildyntahdkvaltdsftt.................................................
ENSDORP00000005241  aialppiakwpyqsgftfhtwlrmdpvnninvd.............................................
ENSDORP00000006995  vavvtvddcdtavavhfggyvgn.......................................................
ENSDORP00000008412  kk............................................................................
ENSDORP00000005807  sapvtligpp....................................................................
ENSDORP00000002451  akfssgkqywevsvddsstwalgvtrhss.................................................
ENSDORP00000001974  lepfrmtpfsaiglelwsmtsdif......................................................
ENSDORP00000010154  rhavlnseesfhftafghqvfssg......................................................
ENSDORP00000012877  yglecsfdfpceleyspplhslgnqswswrrvpseeassmdlldgpeaerskempr......................
ENSDORP00000000298  erllfhpncgqkaaithegrtalrphatddfnhgvvlssralrdgevfqvridkmvdkwagsieigvtthnpaylqlp
ENSDORP00000010446  gerffpppsglsysswfciehfssppnnhpvrlltvvrransseqhfvclavvlsakdrslivstkeellqnyvddfs
ENSDORP00000015587  yfdltpsmagimvppiqrwpgpaftfhawlclhsantapasvspqpfqrkqly.........................
ENSDORP00000000298  rlvslsacgrtarrqqpgqefnhgl.....................................................
ENSDORP00000005805  vetlqrfhvdvtld................................................................
ENSDORP00000014749  kwyfeliidqvdpfltaepthlrvgwasspgyapypgggegwggngvgddlhsygfdglhlwsgripravasinqhll
ENSDORP00000013974  l.............................................................................
ENSDORP00000006462  yyysvrvfa.....................................................................
ENSDORP00000004941  daasvrathpipaacgiyyfevkivs....................................................
ENSDORP00000010082  eay...........................................................................
ENSDORP00000010919  agdiyllstfrlpp................................................................
ENSDORP00000004773  cgstgfelasaggwedasvgplqwrrlpaqahrdargaaaghflslekawgqlkaearartsvl..............


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ss............................................................................
ENSDORP00000012229  srfyvvmwkqvtqsywdtnptraqgysgls................................................
ENSDORP00000000427  gvcrenvikkgsdpmtpengfwavelygnrywal............................................
ENSDORP00000000159  fvfadkplivqyevnfqegidcggayiklladtddlilenfydktsytimfg..........................
ENSDORP00000004727  gvcedsvcrkggvtsapqngfwavslwygkey..............................................
ENSDORP00000003629  gvckenvdrkevvylspdygfwvirlrkgteyragtneypllslpvpprr............................
ENSDORP00000013312  vgickdsvsrkgnlpkppgdlfsliglkigddysl...........................................
ENSDORP00000006777  gthavvgvatadaplhsvgyttlvgnnheswgwdlgrnrlyhdgknqpsktypaflepdetfivpdsf..........
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  vkheqnidcgggyvklfpgnldqkdmhgdseynimfgpdicgpgtk................................
ENSDORP00000001545  lgrgrlyhdgdhrpgaaypaglapgeafatp...............................................
ENSDORP00000002361  wevwwegplgtvavigiatkrapmqcqgyvallgsddqswgwnl..................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  qrvf..........................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  sthhkekmgpggssvgsgdasssrhhhrrrrlhlpqqlllqrevwcvgthgkryqaqssteqtllsp...........
ENSDORP00000001376  sapkhewigknsaswal.............................................................
ENSDORP00000004121  laheaasrkgsiqiqpsrgfycivmhdgnq................................................
ENSDORP00000013180  eevrrkgelrlrpeegvwairlawgfisalgsfpt...........................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  r.............................................................................
ENSDORP00000002877  lprkgsgndcrlghnefswvfsryd.....................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  yeagiisfy.....................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  kgtasrkgklskspelg.............................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ddk...........................................................................
ENSDORP00000004311  cfpf..........................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  prqedlgaspqawclrhtfsssrhkye...................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  sksnaapgllnvyvkvnngplgnpiwnisgdptr............................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  sqnglnp.......................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ssgedeedgesryavgaagesvqrkgrirlcpae............................................
ENSDORP00000012080  evschdqglcrvgwstmqasldlgtdkfg.................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ssr...........................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  lygpqigtl.....................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  syf...........................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  nwlqntfaakhnnkvkaldvsvpeki....................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  gctfrlyyhmfgkhiyrlaiyqriwsn...................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ctlsfw........................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  npaiiagvfdncshtitdkgwalgirtgkergrrdp..........................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  wgl...........................................................................
ENSDORP00000004773  celr..........................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  aasclrfwyhmgfpeh..............................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ttsdmw........................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  iekp..........................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  teyedvflllivkentlytlfttsplmphyvek.............................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  svsedvflllfvkentlytlfttfpllsqyiek.............................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ldscstqlgeelfsygyggtgkkstnsrfenygdkfae........................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  rslgrfeqlgktaaswcl............................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  geeefsygyslkgik...............................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  wqitdr........................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  rwslgvikseaprcgvrlhalpllgmw...................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  rmswlirgvlrgnvslvlvenktgkeqsrriwhvttdeglslw...................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  asldk.........................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  pdvisprydpdsghdsgaedatveasppfafltigmgkillgsgasanagltgrdgpaagctvplpprlgicldyerg
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  stmtnlrs......................................................................
ENSDORP00000010446  eessfyeilpccarfr..............................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  rsddvvsccldlgvpsi.............................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                               10                                                   
                                                |                                                   
d1dyka1               ...............----..----------...................--.........---..............
ENSDORP00000004746  ...............----..----------...................--.........---..............
ENSDORP00000012229  ...............----..----------...................--.........---..............
ENSDORP00000000427  ...............----..----------...................--.........---..............
ENSDORP00000000159  ...............----..----------...................--.........---..............
ENSDORP00000004727  ...............----..----------...................--.........---..............
ENSDORP00000003629  ...............----..----------...................--.........---..............
ENSDORP00000013312  ...............----..----------...................--.........---..............
ENSDORP00000006777  ...............----..----------...................--.........---..............
ENSDORP00000012298  ...............----..----------...................--.........---..............
ENSDORP00000009508  ...............----..----------...................--.........---..............
ENSDORP00000001545  ...............----..----------...................--.........---..............
ENSDORP00000002361  ...............----..----------...................--.........---..............
ENSDORP00000000528  ...............----..----------...................--.........---..............
ENSDORP00000010791  ...............----..----------...................--.........---..............
ENSDORP00000011238  ...............----..----------...................--.........---..............
ENSDORP00000010089  ...............----..----------...................--.........---..............
ENSDORP00000001376  ...............-CRC..NNNWVVRHNS...................--.........---..............
ENSDORP00000004121  ...............----..----------...................--.........---..............
ENSDORP00000013180  ...............----..----------...................--.........---..............
ENSDORP00000014663  ...............----..----------...................--.........---..............
ENSDORP00000013181  ...............----..----------...................--.........---..............
ENSDORP00000002877  ...............----..----------...................--.........---..............
ENSDORP00000004311  ...............----..----------...................--.........---..............
ENSDORP00000010919  ...............----..----------...................--.........---..............
ENSDORP00000005266  ...............----..----------...................--.........---..............
ENSDORP00000007149  ...............----..----------...................--.........---..............
ENSDORP00000010588  ...............----..----------...................--.........---..............
ENSDORP00000008072  ...............-CSC..PAGRGGAVCE...................EAlrs......SVP..............
ENSDORP00000014474  ...............VCQC..LPGFGGPECE...................KL.........LSV..............
ENSDORP00000014482  ...............----..----------...................--.........---..............
ENSDORP00000000831  ...............----..----P-----...................--.........---..............
ENSDORP00000001903  ...............----..----------...................--.........---..............
ENSDORP00000005972  ...............----..----------...................--.........---..............
ENSDORP00000001918  ...............----..----------...................--.........---..............
ENSDORP00000007695  ...............----..----------...................--.........---..............
ENSDORP00000004311  ...............----..----------...................--.........---..............
ENSDORP00000000551  ...............ICQC..LPGYQGEKCE...................KL.........VSV..............
ENSDORP00000006798  ...............----..----------...................--.........---..............
ENSDORP00000002718  ...............TCDCs.TTGYGGTLCSegsegnsclshlmmseqarEE.........NVA..............
ENSDORP00000014779  ...............----..----------...................--.........---..............
ENSDORP00000015207  ...............RCHC..NLGKGGEGCS...................EDivi......QYP..............
ENSDORP00000006488  ...............-CDCp.SGDFEKPYCQ...................V-.........TTR..............
ENSDORP00000015549  ...............----..----------...................--.........---..............
ENSDORP00000011135  ...............----..----------...................--.........---..............
ENSDORP00000005153  ...............----..----------...................--.........---..............
ENSDORP00000010633  ...............----..----IGMRVE...................VYgcsyks...DVA..............
ENSDORP00000015207  ...............ICLC..PLGFKGRHCE...................AAftl......TMP..............
ENSDORP00000001625  ...............----..----------...................--.........---..............
ENSDORP00000012987  ...............----..----------...................--.........---..............
ENSDORP00000008072  ...............-CLC..PGGFSGRRCE...................KGlveksagdlETL..............
ENSDORP00000011377  ...............----..----------...................--.........---..............
ENSDORP00000012080  ...............----..----------...................--.........--F..............
ENSDORP00000015490  ...............----..-----GLRAI...................VA.........DPV..............
ENSDORP00000001823  ...............----..----------...................--.........---..............
ENSDORP00000006422  ...............----..----------...................--.........---..............
ENSDORP00000005718  ...............----..--------CA...................YWa........DVI..............
ENSDORP00000007984  ...............----..------FKCE...................NVatl......DPI..............
ENSDORP00000012134  ...............----..----------...................--.........---..............
ENSDORP00000008778  ...............----..----------...................--.........---..............
ENSDORP00000011367  ...............----..----------...................--.........LGR..............
ENSDORP00000015433  ...............----..--------CP...................YKs........DIL..............
ENSDORP00000010222  ...............----..----------...................--.........---..............
ENSDORP00000007984  ...............----..----------...................-A.........DPV..............
ENSDORP00000015122  ...............----..----------...................--.........---..............
ENSDORP00000007984  ...............VCDCs.GTGFLGRSCE...................REa........TVL..............
ENSDORP00000009837  ...............-CNC..---------D...................ADrnesfw...NSA..............
ENSDORP00000004773  ...............----..----------...................--.........---..............
ENSDORP00000002718  ...............----..----------...................--.........DPV..............
ENSDORP00000002718  ...............----..----------...................--.........-PI..............
ENSDORP00000007045  ...............----..----------...................--.........---..............
ENSDORP00000002313  ...............----..----------...................--.........---..............
ENSDORP00000008072  ...............-CEC..PPGREGALCQ...................TVsergsssrpFLA..............
ENSDORP00000006248  ...............----..----------...................--.........---..............
ENSDORP00000010222  ...............----..----------...................--.........GSF..............
ENSDORP00000002718  ...............ICDCt.GTGYWGRTCE...................REa........SIL..............
ENSDORP00000012229  ...............----..----------...................--.........---..............
ENSDORP00000008778  ...............----..----------...................--.........--T..............
ENSDORP00000011689  ...............----..----------...................--.........---..............
ENSDORP00000012107  ...............----..-----GVFCD...................F-.........---..............
ENSDORP00000015490  ...............----..------FRCE...................DVaal......DPV..............
ENSDORP00000011311  ...............----..----------...................--.........TGT..............
ENSDORP00000010633  ...............----..----------...................--.........NAV..............
ENSDORP00000009458  ...............----..----------...................--.........---..............
ENSDORP00000015490  ...............VCDCi.GTGFLGRVCE...................REa........TVL..............
ENSDORP00000011367  ...............----..----------...................--.........KGS..............
ENSDORP00000005718  ...............----..----------...................EPyt.......VPV..............
ENSDORP00000005718  ...............-CDCs.HTPYDGTFCN...................KD.........VGA..............
ENSDORP00000010633  ...............----..-TGNVTFSCS...................EPqi.......VPI..............
ENSDORP00000002718  ...............TCDCs.MTSYSGNQCN...................DPg........ATY..............
ENSDORP00000012335  ...............-CVC..PAGFTGSRCE...................HS.........EALhchpxxxxxxxxxx
ENSDORP00000007984  ...............----..----------...................--.........--A..............
ENSDORP00000004740  ...............----..----------...................--.........-AY..............
ENSDORP00000009458  ...............----..----------...................--.........---..............
ENSDORP00000004828  ...............----..----------...................--.........TFF..............
ENSDORP00000005348  ...............----..----------...................--.........---..............
ENSDORP00000012335  ...............---C..EPGYTGQYCE...................QCa........PGYvgnpnvqggrclpe
ENSDORP00000010222  ...............----..-ADVTSGYVS...................GA.........HQF..............
ENSDORP00000006888  ...............----..----------...................--.........-GI..............
ENSDORP00000014173  ...............YCHC..PFGVFGKHCE...................L-.........NSY..............
ENSDORP00000015433  ...............----..----VAFRCL...................DPvp.......HPI..............
ENSDORP00000015490  ...............----..----------...................--.........--A..............
ENSDORP00000015433  ...............TCDCd.LTAFDGPYCN...................HD.........IGG..............
ENSDORP00000008422  ...............----..----------...................--.........---..............
ENSDORP00000014582  ...............----..----------...................--.........---..............
ENSDORP00000000340  ...............----..----------...................--.........---..............
ENSDORP00000006042  ...............----..----------...................--.........---..............
ENSDORP00000011311  ...............----..----------...................--.........-AY..............
ENSDORP00000002081  ...............----..----------...................--.........---..............
ENSDORP00000007641  ...............----..----------...................--.........---..............
ENSDORP00000004773  ...............----..----------...................--.........---..............
ENSDORP00000005198  ...............----..----------...................--.........---..............
ENSDORP00000004766  ...............----..----------...................--.........---..............
ENSDORP00000010554  ...............----..----------...................--.........--V..............
ENSDORP00000009837  ...............----..----------...................-Fgcayrs...EVV..............
ENSDORP00000006857  ...............----..----------...................--.........---..............
ENSDORP00000004773  ...............----..----------...................--.........---..............
ENSDORP00000005718  ...............----..----------...................--.........NAA..............
ENSDORP00000010633  ...............-CDCt.NSPYEGPFCQ...................KE.........VSA..............
ENSDORP00000015231  ...............----..----------...................--.........---..............
ENSDORP00000008778  ...............----..----------...................--.........--I..............
ENSDORP00000002718  ...............----..----------...................--.........-GL..............
ENSDORP00000010794  ...............----..-L--------...................--.........---..............
ENSDORP00000010053  ...............----..----------...................--.........---..............
ENSDORP00000000831  ...............----..----------...................--.........---..............
ENSDORP00000006237  ...............----..----------...................--.........---..............
ENSDORP00000007918  ...............TCLC..PAGHAGAVCD...................TV.........TTL..............
ENSDORP00000010789  ...............----..----------...................--.........---..............
ENSDORP00000013462  ...............----..----------...................--.........---..............
ENSDORP00000015490  ...............----..----------...................--.........---..............
ENSDORP00000010679  ...............----..P---------...................--.........---..............
ENSDORP00000005726  ...............----..----------...................--.........---..............
ENSDORP00000010222  ...............----..----------...................--.........---..............
ENSDORP00000001974  ...............----..----------...................--.........---..............
ENSDORP00000007984  ...............-CDCs.MTSFSGPLCN...................DPg........TTY..............
ENSDORP00000004108  ...............-CQC..PPGKLGE-CS...................GH.........TSL..............
ENSDORP00000002773  ...............----..P---------...................--.........---..............
ENSDORP00000000902  ...............----..----------...................--.........---..............
ENSDORP00000015490  ...............TCDCt.MTSYGGPVCN...................DPg........TTY..............
ENSDORP00000004773  ...............----..----------...................--.........---..............
ENSDORP00000006488  ...............-CEC..PLGFGGKSCA...................QEma.......NPQ..............
ENSDORP00000007684  ...............----..----------...................--.........---..............
ENSDORP00000015433  ...............----..----------...................--.........NTI..............
ENSDORP00000000831  ...............----..----------...................--.........---..............
ENSDORP00000007918  ...............RCEC..DRPYTGPDCL...................SEy........VAG..............
ENSDORP00000008744  ...............----..----------...................--.........---..............
ENSDORP00000002285  ...............----..----------...................--.........---..............
ENSDORP00000003368  ...............----..----------...................--.........---..............
ENSDORP00000003394  ...............----..----------...................--.........---..............
ENSDORP00000009086  ...............----..----------...................--.........---..............
ENSDORP00000011645  ...............----..----------...................--.........---..............
ENSDORP00000006995  ...............-CEC..PLHFGGKNCE...................QAmp.......HAQ..............
ENSDORP00000015377  ...............----..----------...................--.........YSC..............
ENSDORP00000008778  ...............----..--------CS...................LEnv.......YTV..............
ENSDORP00000011611  ...............----..----------...................--.........---..............
ENSDORP00000013538  ...............----..----------...................--.........---..............
ENSDORP00000013974  ...............----..----------...................--.........-GI..............
ENSDORP00000005843  ...............----..----------...................--.........---..............
ENSDORP00000010222  ...............----..----------...................--.........RSV..............
ENSDORP00000004325  ...............----..----------...................--.........-AL..............
ENSDORP00000009862  ...............----..----------...................--.........---..............
ENSDORP00000006888  ...............----..----------...................--.........---..............
ENSDORP00000013182  ...............----..----------...................--.........---..............
ENSDORP00000015207  ...............-CDC..PLGFEGLHCQ...................KEcg.......NYClntiteaieip...
ENSDORP00000008905  ...............----..----------...................--.........---..............
ENSDORP00000011670  ...............----..----------...................--.........QVF..............
ENSDORP00000007640  ...............----..----------...................--.........---..............
ENSDORP00000014580  ...............TCNC..ETEDYGEKFD...................ENd........VIT..............
ENSDORP00000008412  ...............-CDC..PVGFGGKDCR...................LTma.......HPY..............
ENSDORP00000008778  ...............----..----------...................--.........---..............
ENSDORP00000014953  ...............----..----------...................--.........MIF..............
ENSDORP00000014173  ...............----..----------...................--.........---..............
ENSDORP00000012269  ...............----..----------...................--.........---..............
ENSDORP00000011311  ...............----..----------...................--.........--Y..............
ENSDORP00000004766  ...............----..----------...................--.........---..............
ENSDORP00000009369  ...............----..----------...................--.........---..............
ENSDORP00000001250  ...............----..----------...................--.........---..............
ENSDORP00000000609  ...............----..----------...................--.........---..............
ENSDORP00000013695  ...............----..----------...................--.........---..............
ENSDORP00000006888  ...............----..----------...................--.........DKN..............
ENSDORP00000006888  ...............----..--------CS...................EDwklv.....RSA..............
ENSDORP00000014663  ...............----..----------...................--.........---..............
ENSDORP00000014524  ...............----..----------...................--.........---..............
ENSDORP00000002925  ...............----..----------...................--.........---..............
ENSDORP00000008975  ...............----..----------...................--.........---..............
ENSDORP00000009862  ...............QCDCa.SSAFEGPFCS...................QE.........VSA..............
ENSDORP00000008034  ...............----..----------...................--.........---..............
ENSDORP00000009547  ...............----..----------...................--.........---..............
ENSDORP00000013182  ...............----..----------...................--.........---..............
ENSDORP00000004773  ...............----..----------...................--.........---..............
ENSDORP00000015608  ...............----..----------...................--.........RIM..............
ENSDORP00000011311  ...............----..--------CP...................EDslis.....RRA..............
ENSDORP00000009882  ...............----..----------...................--.........---..............
ENSDORP00000014749  ...............----..----------...................--.........---..............
ENSDORP00000002643  ...............VCRC..PPGSHGPSCG...................HN.........TTF..............
ENSDORP00000008412  ...............RCQCpaGGAFEGPRCE...................V-.........AAR..............
ENSDORP00000004406  ...............----..----------...................--.........---..............
ENSDORP00000015608  ...............----..----------...................--.........---..............
ENSDORP00000006462  ...............----..----------...................--.........---..............
ENSDORP00000014161  ...............----..--------C-...................--.........---..............
ENSDORP00000009648  ...............----..----------...................--.........---..............
ENSDORP00000008146  ...............----..----------...................--.........---..............
ENSDORP00000015608  ...............----..----------...................--.........DGS..............
ENSDORP00000010181  ...............----..----------...................--.........---..............
ENSDORP00000012134  ...............----..----------...................--.........---..............
ENSDORP00000014409  ...............----..--------CD...................VElq.......PGL..............
ENSDORP00000005830  ...............----..----------...................--.........DAL..............
ENSDORP00000013974  ...............----..----------...................--.........TSF..............
ENSDORP00000010919  ...............----..----------...................--.........---..............
ENSDORP00000007213  ...............----..----------...................--.........---..............
ENSDORP00000002643  ...............RCTC..PRPYGGPTCA...................DEs........PAA..............
ENSDORP00000014161  ...............----..----------...................--.........---..............
ENSDORP00000012877  ...............----..----------...................--.........---..............
ENSDORP00000000831  ...............----..----------...................--.........---..............
ENSDORP00000004746  ...............----..----------...................--.........---..............
ENSDORP00000009837  ...............----..--GNVSFICS...................QPqs.......VPV..............
ENSDORP00000012348  ...............----..----------...................--.........---..............
ENSDORP00000005348  ...............----..----------...................--.........---..............
ENSDORP00000006888  ...............----..----------...................--.........---..............
ENSDORP00000002643  ...............-CTC..PDNFTGPTCA...................QQ.........RWCpsqpclppatceev
ENSDORP00000015608  ...............----..----------...................--.........---..............
ENSDORP00000003089  ...............----..----------...................--.........---..............
ENSDORP00000010458  ...............----..----------...................--.........---..............
ENSDORP00000015512  ...............----..----------...................--.........---..............
ENSDORP00000004552  ...............----..----------...................--.........---..............
ENSDORP00000015664  ...............----..----------...................--.........---..............
ENSDORP00000009837  ...............FCDCs.ASAYTGPFCS...................NE.........ISA..............
ENSDORP00000011311  ...............RCIC..KENYAGPNCE...................RCa........PGYygnslligstcrkc
ENSDORP00000011141  ...............----..----------...................--.........---..............
ENSDORP00000010917  rvsfldavsfrglle---C..PLDCSGPVC-...................--.........---..............
ENSDORP00000011435  ...............----..----------...................--.........---..............
ENSDORP00000005241  ...............----..----------...................--.........---..............
ENSDORP00000006995  ...............----..----------...................--.........---..............
ENSDORP00000008412  ...............----..----------...................--.........---..............
ENSDORP00000005807  ...............----..--SFVGVFLD...................FSp........EHI..............
ENSDORP00000002451  ...............----..----------...................--.........---..............
ENSDORP00000001974  ...............----..----------...................--.........---..............
ENSDORP00000010154  ...............----..----------...................--.........---..............
ENSDORP00000012877  ...............----..----------...................--.........---..............
ENSDORP00000000298  ...............----..----------...................--.........---..............
ENSDORP00000010446  ...............----..----------...................--.........---..............
ENSDORP00000015587  ...............----..----------...................--.........---..............
ENSDORP00000000298  ...............----..----------...................--.........---..............
ENSDORP00000005805  ...............----..----------...................--.........---..............
ENSDORP00000014749  ...............----..----------...................--.........---..............
ENSDORP00000013974  ...............----..----------...................--.........---..............
ENSDORP00000006462  ...............----..----------...................--.........---..............
ENSDORP00000004941  ...............----..----------...................--.........---..............
ENSDORP00000010082  ...............TCVC..PGGRLAQ-CP...................GS.........SSV..............
ENSDORP00000010919  ...............----..----------...................--.........---..............
ENSDORP00000004773  ...............----..--GSSGPHCE...................LR.........MAY..............


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  xxxxxxxxxxxxxxxxxxxxxxxxvtvttp................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  adeaplvvqvhptrsvvpqggphslqckvtgspphyfywsredgrpmpssaqqrhqgselhfpsvqpsdagvyictcr
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  pdgfvxxxxxxxxxxxxv............................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  dcxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxcncgggpcdsvtgecleegfelptg
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  nlhhtsnsraellvseapskpitvtveeprsqsvrpgadvtfvctakskspaytlvwtrlhneklpsramdfngilti
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  tdcptiscdkciwdltddlrlaalsieesksgllsvssgaaahrhvnemnstisllktklserenqytlrkiqinnae
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  rnvqpsdagtytctgsnmfamdlgtatlhvqasgtlsapvvsisppqltvqpgqlaefrcsatgnppptlewsggpgg
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ntmksllsdleeltrkgnqasrkgqlvqkesmdtidhatqlveqahnmrdkiqeinnkmlyyeeeqelgpeevaeklv
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  qlpqkaqihggilrlpavepsdqsqylcrahssagqhvarallqvqggsgprvqvspertqvtegrtvrlycrvlgvp
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  larkmveeirsypsfltqrelvdeeadeaqdllshvenwqrlhndtrslfpvileqlddyraklsdlqesldqaldhv
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  stsitwrkeggslppqarsehtdiatliipavtladagfylcvatsptgtsqariqvvvlsasgastlpvriesssps
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  rdaedmnraiasrqrdhekqhervqekvelvnmslsasaeslstprltlvelddiiknasgiyaeidgaknelqrtls
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  vtegqtldlncavtglahtqitwykrggslpphaqvhgsrlrlpqvspadsgdyvcrveselgpkeasivvsvlstps
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  nlsnlnhdlvqeaidharnlqeeadelsrrlhssdmnglvqkaldasnvyeniasyvdeasekaefalniteriydav
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  gpshtlatgstqpiriesssshvaegqtldlnckvprqarvtwrkrggslparhqthgsllrlhqvspadsgeyvchv
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  sgidtqiiyhrdesdnllnqarelqdqadisneaavadtsrrvsgalsrkdvlknilndavkrlqaaergdaqlrlgq
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  tlgsehtetsvlvtiepsgsipgpvppvriesssstvaegqtldlscvvagqahaqvtwykrggslparhqvrgsrly
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  sklviqeankammevqrvtgpmagnltdwsqnlqsfdssvytavxxxxxxxrnlsevvpqlldqlrtveqkrpasnvs
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  ifqaspvdageyvcrasngqeasitvtvagtqganfahppgstqplriepssshvaegqtldlncvvpgqahaqvtwq
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  asiqrireliaqtrsvankiqvsm......................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  krggslptrhqthgsllrlyqvspadsgeyvcrvegsstpletsvlvnivpadsvpalgvtptvriesssshvaegqt
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  ldlnclvngqahaqvtwhkrggslparhqvlgsrlrlpqvtpadsgeyvcrvasgsgtqeasvlvtiqqrlrpfhtqs
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  mvypvriesssaslanghtldlncvvashtphtitwykrggslpsrhqivgsrlripqvtpadsgeyvchvsngagsq
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  etslivtiqgsgsmhvpsvsppiriesssstvlkgdtldlncvvagqtqatitwfkrggslparhqahgsrlrlhqms
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  vadsgeyvcrannnieaqetsivvtvsprtsnpsgpgaavpiriesssshvaegqtldlncvvpghahaqvtwhkrgg
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  slpahhqahgsrlrlyqvspadsgeytcrvlgssgpleasvlvsiepagsstvhvpasggappirietsssrvaegqt
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  ldlncvvpgqahaqvtwhkrggslpahhqxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvhgsqlrlphvspadsgeyvcrvavgsgp
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................
ENSDORP00000011670  ..............................................................................
ENSDORP00000007640  ..............................................................................
ENSDORP00000014580  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000014953  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000012269  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000009369  ..............................................................................
ENSDORP00000001250  ..............................................................................
ENSDORP00000000609  ..............................................................................
ENSDORP00000013695  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000014524  ..............................................................................
ENSDORP00000002925  ..............................................................................
ENSDORP00000008975  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000008034  ..............................................................................
ENSDORP00000009547  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000009882  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000004406  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000009648  ..............................................................................
ENSDORP00000008146  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000010181  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000014409  ..............................................................................
ENSDORP00000005830  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000007213  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000014161  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000012348  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000002643  ..............................................................................
ENSDORP00000015608  ..............................................................................
ENSDORP00000003089  ..............................................................................
ENSDORP00000010458  ..............................................................................
ENSDORP00000015512  ..............................................................................
ENSDORP00000004552  ..............................................................................
ENSDORP00000015664  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000011141  ..............................................................................
ENSDORP00000010917  ..............................................................................
ENSDORP00000011435  ..............................................................................
ENSDORP00000005241  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000008412  ..............................................................................
ENSDORP00000005807  ..............................................................................
ENSDORP00000002451  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000010154  ..............................................................................
ENSDORP00000012877  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000010446  ..............................................................................
ENSDORP00000015587  ..............................................................................
ENSDORP00000000298  ..............................................................................
ENSDORP00000005805  ..............................................................................
ENSDORP00000014749  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000006462  ..............................................................................
ENSDORP00000004941  ..............................................................................
ENSDORP00000010082  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000004773  ..............................................................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSDORP00000004746  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000000427  ..............................................................................
ENSDORP00000000159  ..............................................................................
ENSDORP00000004727  ..............................................................................
ENSDORP00000003629  ..............................................................................
ENSDORP00000013312  ..............................................................................
ENSDORP00000006777  ..............................................................................
ENSDORP00000012298  ..............................................................................
ENSDORP00000009508  ..............................................................................
ENSDORP00000001545  ..............................................................................
ENSDORP00000002361  ..............................................................................
ENSDORP00000000528  ..............................................................................
ENSDORP00000010791  ..............................................................................
ENSDORP00000011238  ..............................................................................
ENSDORP00000010089  ..............................................................................
ENSDORP00000001376  ..............................................................................
ENSDORP00000004121  ..............................................................................
ENSDORP00000013180  ..............................................................................
ENSDORP00000014663  ..............................................................................
ENSDORP00000013181  ..............................................................................
ENSDORP00000002877  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000010919  ..............................................................................
ENSDORP00000005266  ..............................................................................
ENSDORP00000007149  ..............................................................................
ENSDORP00000010588  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000014474  ..............................................................................
ENSDORP00000014482  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000001903  ..............................................................................
ENSDORP00000005972  ..............................................................................
ENSDORP00000001918  ..............................................................................
ENSDORP00000007695  ..............................................................................
ENSDORP00000004311  ..............................................................................
ENSDORP00000000551  ..............................................................................
ENSDORP00000006798  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000014779  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000015549  ..............................................................................
ENSDORP00000011135  ..............................................................................
ENSDORP00000005153  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000001625  ..............................................................................
ENSDORP00000012987  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000011377  ..............................................................................
ENSDORP00000012080  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000001823  ..............................................................................
ENSDORP00000006422  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000012134  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000015122  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000007045  ..............................................................................
ENSDORP00000002313  ..............................................................................
ENSDORP00000008072  ..............................................................................
ENSDORP00000006248  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012229  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011689  ..............................................................................
ENSDORP00000012107  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000011367  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000012335  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004740  ..............................................................................
ENSDORP00000009458  ..............................................................................
ENSDORP00000004828  ..............................................................................
ENSDORP00000005348  ..............................................................................
ENSDORP00000012335  eqeasftvtvppsagssyrlrspvisidppsstvqqgqdasfkclihegatpinlewktrnpelednvhispngsiit
ENSDORP00000010222  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000014173  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000008422  ..............................................................................
ENSDORP00000014582  ..............................................................................
ENSDORP00000000340  ..............................................................................
ENSDORP00000006042  ..............................................................................
ENSDORP00000011311  ..............................................................................
ENSDORP00000002081  ..............................................................................
ENSDORP00000007641  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005198  ..............................................................................
ENSDORP00000004766  ..............................................................................
ENSDORP00000010554  ..............................................................................
ENSDORP00000009837  ..............................................................................
ENSDORP00000006857  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000005718  ..............................................................................
ENSDORP00000010633  ..............................................................................
ENSDORP00000015231  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000002718  ..............................................................................
ENSDORP00000010794  ..............................................................................
ENSDORP00000010053  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000006237  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000010789  ..............................................................................
ENSDORP00000013462  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000010679  ..............................................................................
ENSDORP00000005726  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000001974  ..............................................................................
ENSDORP00000007984  ..............................................................................
ENSDORP00000004108  ..............................................................................
ENSDORP00000002773  ..............................................................................
ENSDORP00000000902  ..............................................................................
ENSDORP00000015490  ..............................................................................
ENSDORP00000004773  ..............................................................................
ENSDORP00000006488  ..............................................................................
ENSDORP00000007684  ..............................................................................
ENSDORP00000015433  ..............................................................................
ENSDORP00000000831  ..............................................................................
ENSDORP00000007918  ..............................................................................
ENSDORP00000008744  ..............................................................................
ENSDORP00000002285  ..............................................................................
ENSDORP00000003368  ..............................................................................
ENSDORP00000003394  ..............................................................................
ENSDORP00000009086  ..............................................................................
ENSDORP00000011645  ..............................................................................
ENSDORP00000006995  ..............................................................................
ENSDORP00000015377  ..............................................................................
ENSDORP00000008778  ..............................................................................
ENSDORP00000011611  ..............................................................................
ENSDORP00000013538  ..............................................................................
ENSDORP00000013974  ..............................................................................
ENSDORP00000005843  ..............................................................................
ENSDORP00000010222  ..............................................................................
ENSDORP00000004325  ..............................................................................
ENSDORP00000009862  ..............................................................................
ENSDORP00000006888  ..............................................................................
ENSDORP00000013182  ..............................................................................
ENSDORP00000015207  ..............................................................................
ENSDORP00000008905  ..............................................................................