SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Concanavalin A-like lectins/glucanases alignments in Taeniopygia guttata 76_3.2.4

These alignments are sequences aligned to the 0046423 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1dyka1               hgpcvaesepalltgskqfg..........................................................
ENSTGUP00000016927  tdfrkfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgfdefnavdfsgtffinterdddyagfvfgyqss
ENSTGUP00000003709  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvntvtdddyagfif.....
ENSTGUP00000010031  tdfrkfqmvpldpkgtaqidpnwvirhqgkelvqtansdpgiavgydefssvdfsgtfyvntdrdddyagfvfgyqss
ENSTGUP00000001099  yrppvptgevyfaesfdkgtldgwvlsrakkddtddeiakydgkwevqdmketklpgdkglvmvtrakhhaissklsk
ENSTGUP00000011992  tdfrkfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgfdefnavdfsgtffinterdddyagfvfgyqss
ENSTGUP00000014278  tdfrayqtvildpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvntitdddya.........
ENSTGUP00000014987  hrrfeykysfkgphlvqadgtvpfwvhtgnaipsadqirittslksqkgsvwtktksifeywevevtfrvtgrgriga
ENSTGUP00000002371  qtpkptgevyftetfdeglsgwvfsvtlkedtddnvakydgrweveelkenalpgdrglvlksvakyhaissmltkaf
ENSTGUP00000000385  pftgagsaamplwdftgstmvtsqyvrltpdersregsiwnrvpcflkdwelhvhfrihgagkknlhgdglalwytqe
ENSTGUP00000007869  ckparldmlldmppaklevqykhawnnedrslnifvkeddkltfhrhpvaqstdcirgkvgytrglhvwqihwptrqr
ENSTGUP00000003849  kptrldllldmppvsyevqllhswnnddrslnvfvkeddklifhrhpvaqstdairgkvgytrglhvwqitwamrqrt
ENSTGUP00000003292  mrdmlkkfkvdvildpetahpdltvsedrksvrrgskklllslfdspkrfgtapvvlgspsffsgrhywevqvgdkpe
ENSTGUP00000015979  edltldpdsanhllilsadlktvrmgcrkqelpdnpkrfdtnsrvlasagfssgrhfwevevgpsdgwafgvakesvr
ENSTGUP00000016008  lsldpdtanpylvlsedkrsvrlrgapqelpahpkrfdfafciltsegfsagrhywevevgdgeswvlgaaresvrrk
ENSTGUP00000000111  flkharsptweydsihprlklsddrlevscswrrifypcnpqrfdklwqvlsrdaflsgshywevdllqagagwwiga
ENSTGUP00000014546  dihpvpaaltldpgtahhrlilsddctivaygnlhpqplqdsprrfdvevsvlgaeafgagvhywevvvsektqwmig
ENSTGUP00000006031  fhhafstndcsrnvyikkngftlhrnpiaqstdgartkigfsegrhawevwwegplgtvavigiatkraamqcqgyva
ENSTGUP00000003669  lhrvrdcrcgeedeyfdwvwd.........................................................
ENSTGUP00000005348  vdvtldpatagpevilsedlkeatwgrpqcqwpegpgrfdtdpcmlgsegftsgrhyweveangrfwavgvaresvrr
ENSTGUP00000008609  klktnsqpfkldpksahrklkvshdnltverdetsskkshtperftsqgsygvagnvfidsgrhywevvisgstwyai
ENSTGUP00000017060  dvildadtahprleisadgrrvkdtgvirflfrnekrfdshlfvlakegytsgkhywevnvgtrrnwalgiacesvtr
ENSTGUP00000009828  reellqyaanitldyntahstvvlaenytrmsisdtfpghkyhpqrftdyrqv.........................
ENSTGUP00000014507  tdfrafqtvvldpegdaqidpnwivlnqgmeivqtmnsdpglavgytafng...........................
ENSTGUP00000010199  hfnstynarvkafnssgvgpysktvilqtsdvawftfdpssahrdivlsndnqtatcnsyddrvvlgtaafskgvhyw
ENSTGUP00000005117  rlktnsqpfkldpkmahkklkisndglqmekdesslkkshtperfsgtgcygaagnvfidsgchywevvvgsstwyai
ENSTGUP00000008110  dntcrfedekicgfvqdkmdnfdwtrqnaltqnpkrtvntgpptdisgtpegyymfieasrprvtgdkarlisplyni
ENSTGUP00000004907  gyryilaepdphapdpekleldcwagkpipgdlyraclyervllalhdrapqlkisddrltvvgekgysmvrashgvr
ENSTGUP00000010725  isnpiipyvgtihgglvpgelivihgtvpddadrfqvdlqcgssikpradvafhfnprfkrsgcivcntlerekw...
ENSTGUP00000005437  detplprswspkd.................................................................
ENSTGUP00000013465  kvpfelplqagliprllititgtvnpnpdrfsldfkrg........................................
ENSTGUP00000000911  tpgectfekdecmftqkkrgrgswhrkrgptptsytgpkgdhttgvgyymyieasnmvygqraylvsrslrgtsg...
ENSTGUP00000010911  ieilnlnmkpgntlkvkgkifadtvgfsinlgyssr..........................................
ENSTGUP00000010725  gvpytgkldtalrpgctiaikgevnknpksfainlrps........................................
ENSTGUP00000008902  ygkikkt.......................................................................
ENSTGUP00000007890  fylnedtahpllailddgftiscdelenpecdlpvydnsftrciailgslipfpgkhyweveveedteyrigvafent
ENSTGUP00000002179  pcanggtcipkkdsye..............................................................
ENSTGUP00000013613  fhwgfedgniclftqndtnnfdwtkqstatrdtkytpntgpnadrtgskegfymyietsrprlegekarlvspvfnva
ENSTGUP00000009917  ..............................................................................
ENSTGUP00000002689  qeihidektlsphlslsedkrtltfspkkakvdsgcperfdhwpnalatapfhsgvcawkvsveqscayklgvcyssv
ENSTGUP00000002179  ggs...........................................................................
ENSTGUP00000011992  svfdlfeligfmrkgagrrapgvylvkgpessspayriedasripavpdskfqdlldaihaekgfillatlrqa....
ENSTGUP00000013892  ycdgkkgfklskdmkncesvtecihlnleknyqlly..........................................
ENSTGUP00000004653  idiiteldlvnttlgvtqvsglhnaskaflfqdtereihaaphvsekliqlf..........................
ENSTGUP00000005148  epvdvlkalefhnspegvtrtagfctnrrnskgsdvayrvsktaqlsaptkqly........................
ENSTGUP00000006286  iglsqnnlrvhykghgktpkdaasvrathpipaacgiyyfevkivskgrdgymgiglsaqgvnmnrlpgwdkhsygyh
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000008379  fealhpegicpgwsivvkgetssrssmfeinllcepgdq.......................................
ENSTGUP00000006159  padllkvldfhnlpdgitkttgfctsrrsskeadvayrvtkdaqlsaptkql..........................
ENSTGUP00000012721  pcenggtcflldgep...............................................................
ENSTGUP00000009636  hcdgrggvklsqdmntceniip........................................................
ENSTGUP00000005001  vevfg.........................................................................
ENSTGUP00000001754  lvvtqldvepgecikvkgkiqsdakgfavnvgkdsntlmlhfnprfdchgdv..........................
ENSTGUP00000001756  lvvtqldvepgecikvkgkiqsdakgfavnvgkdsntlmlhfnprfdchgdv..........................
ENSTGUP00000001267  hcnfefdfcgwkqdenddfdwylrtsstaklgtgpatdhtlqessghyifikssffqlpgqkarisspvlsrknknck
ENSTGUP00000000484  rflrfvpldwnpn.................................................................
ENSTGUP00000007830  ggf...........................................................................
ENSTGUP00000002179  adsy..........................................................................
ENSTGUP00000001495  vggf..........................................................................
ENSTGUP00000010031  ttfdllqvsninrktvgakvfrgpdptmpayrfirfdhippckpeklkkilklirqnegfilsatlrqdrq.......
ENSTGUP00000017400  d.............................................................................
ENSTGUP00000007223  gky...........................................................................
ENSTGUP00000010276  d.............................................................................
ENSTGUP00000005926  gvva..........................................................................
ENSTGUP00000004461  lggcsfdehysncgysvalgtngftweqintwekptmdpavptgsfmmvnssgrasgqkahlllptlkendthcidfh
ENSTGUP00000015340  wtrrwveskhkpdygrfvltagkfygdaekdkgiqtsqdarfyalssrfepfsnrdktlvvqftvkheqnidc.....
ENSTGUP00000000813  tagctfeedsdpnqceysqgedddfdwelirsylmphlmpdlphgsylmvnssqhtpgqkahllfqalsendthc...
ENSTGUP00000002366  ivpfcghikggmrpgkkilvmgivdlnpesfgisltcgesedppadvaielkavfterqfvrnscvagewgeeqssip
ENSTGUP00000016735  yrkvfvfrkdpsdafvalrarlqqplhnftvclrsytdltr.....................................
ENSTGUP00000002833  ryiriipvawnprgkiglrlglyg......................................................
ENSTGUP00000003828  iggfk.........................................................................
ENSTGUP00000013533  idikkmvavawfsfdpssahadiifsndnltvtcnsyddrvvlgktgfskgl..........................
ENSTGUP00000001271  dlqcnfenglcnweqdvqddfdwirirgptptvntgplkdhttgtarghylylesseprlfqdkavllsplfnpsgyg
ENSTGUP00000010605  ymyarvkk......................................................................
ENSTGUP00000001337  sgfnldfevs....................................................................
ENSTGUP00000005926  pcknngvcrdgwnry...............................................................
ENSTGUP00000013493  ipviqivyetlkdqmegkkgkatiktggavlnkwqmnpydrgsafaigsdglccqsreikewhgcratrgvtkgkyyy
ENSTGUP00000005001  qiy...........................................................................
ENSTGUP00000012721  idlckngdidycelkarfglrniia.....................................................
ENSTGUP00000005926  yidlckngdidycelnarfgfrniia....................................................
ENSTGUP00000012721  vatl..........................................................................
ENSTGUP00000000499  llcrgdr.......................................................................
ENSTGUP00000012721  pcknnavckdgwnrf...............................................................
ENSTGUP00000001856  cqgdrnyw......................................................................
ENSTGUP00000001856  ycanggkcvekyngys..............................................................
ENSTGUP00000012350  fsvtpcfegpse..................................................................
ENSTGUP00000013256  ..............................................................................
ENSTGUP00000001271  cdferescgwieavntdefdwvrsssnalppafqkqapprdhtynkpeghfmfilkssnsisqiar............
ENSTGUP00000005001  leescldmryfcncdadreewtndtgllafkdhlpvtqivitdtnrsnseaawkigplr...................
ENSTGUP00000013952  kinctfedgfcfwiqdldddsdwdrvqgptfpfmsgpefdhtfgnfsgyyistpirpgfieervrilslplvp.....
ENSTGUP00000003772  fhllsdtahpalqissnatvihlpektklsgfpsvlgellpaqgchyweivvsacrsyrigicyeaitqssvlglsdt
ENSTGUP00000011887  yvgeikgglrptmkltvigmvhskpksfsvtllcdpvdankdvgllftvnfseksitrnariagkwgkeektipyfpf
ENSTGUP00000002105  glegy.........................................................................
ENSTGUP00000005926  mgsgkee.......................................................................
ENSTGUP00000003312  edenlpiqevsfdpekaqccivengqilthgsggkgyglastgvtsgcyqwkfyivkenrgnegtcvgvsrwpvhdfn
ENSTGUP00000006486  rgsrdrfagesytvlgdtaiesgqhywevraqkdcksysvgvtyrnlgkfdqlgktnsswcihinswlqatfsakhnn
ENSTGUP00000017417  cisqvmcsqgfstgchywevitkdsdgwavgvahgmigkrdklgrtehswcvewlgpkkqlsv...............
ENSTGUP00000002833  ngvniaelarhrrpnirfe...........................................................
ENSTGUP00000005052  cisqvmcsqgfstgchywevitkdsdgwavgvahgmigkrdklgrterswcvewlgpkkqlsvw..............
ENSTGUP00000000988  lyncafgwgsqktlchwehdnqvdlrwailtsktgpiqdhsgdgnfiysqadesqkgkvarllspviysqnsahcmtf
ENSTGUP00000012350  chlpmnpkate...................................................................
ENSTGUP00000012758  gfkmmemfglvekefsavegvsmepgtfnvfpcyrlhkdalvsqptkylh............................
ENSTGUP00000005462  glllvdddllgvighsnfgsirattcvykgkwiyevlissqglmqigwctlncrfnqeegvgdtp.............
ENSTGUP00000006169  srnvkaspetaeiffq..............................................................
ENSTGUP00000002833  pcqnsglcveryshy...............................................................
ENSTGUP00000010134  ..............................................................................
ENSTGUP00000013027  pgfkmlesynltekhfasvqgvslesgsfpsyvayrlhknafvsqpireihp..........................
ENSTGUP00000012212  rhavkllsvlnqmpqrhgpd..........................................................
ENSTGUP00000017145  ..............................................................................
ENSTGUP00000009339  vdtlngy.......................................................................
ENSTGUP00000012283  gy............................................................................
ENSTGUP00000010839  lpcldvpmd.....................................................................
ENSTGUP00000009346  ..............................................................................
ENSTGUP00000011096  tcsfelenvcgmiqssddnsdwqrlsqvpagpntdhtnmgeckdsgyfmhfdtsaggegstavlesrilypkrgfqcl
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000009346  vdtlngy.......................................................................
ENSTGUP00000013113  fdlisqfqiekaasqgiiervvgstslqvayklgpnvdfriptsaiysnglp..........................
ENSTGUP00000003411  ppteeihriygpdnnpgyvfg.........................................................
ENSTGUP00000007370  fclpglpavtacahlqwdtstqeiatifsyavpafmnefqlrgfvdeegfvrfalivhg...................
ENSTGUP00000010839  sn............................................................................
ENSTGUP00000000911  panagcnfeedlcnfyqdhkdgpgwsrvkvkrnvyragdhttgfgyyllantkftsqpgyigr...............
ENSTGUP00000014074  gfkmmemfglvekefsavegvsmepgtfnvfpcyrlhkdalvsqptkylh............................
ENSTGUP00000012721  cl............................................................................
ENSTGUP00000003983  pafyfpveniesfvevhplravslqaftlcfwsraqpvgsqtv...................................
ENSTGUP00000013002  iqsayvrlgsfpvvqktedvfpqg......................................................
ENSTGUP00000000499  chnggkcrekysgfs...............................................................
ENSTGUP00000009339  ..............................................................................
ENSTGUP00000005926  canqgvclqqwdgfs...............................................................
ENSTGUP00000005377  amlnsndvseylkisphglearcdassfesvrctfcvdsgvwyyevtvitsgvmqigwatkdskflnhegygigdde.
ENSTGUP00000013614  dqcsfelenicgmiqgtkhdqdwvhqqgsvtgqedhtlsghcrdagyfmyfntnsgqadevailesrilypkrt....
ENSTGUP00000015460  qtpkptgevyftetfdeglsgkavisllqtaffkdsvhvcgrweveelkenalpgdrglvlksvakyhaissmltkaf
ENSTGUP00000002977  lsk...........................................................................
ENSTGUP00000011574  etailfpmrsrkifgsvhpts.........................................................
ENSTGUP00000013208  kgfdilvglgvkkkvkkriqisstnakayevtsrvdlseltrnvfpeglppsyvfvstqrfkvkktwdlwri......
ENSTGUP00000003385  sra...........................................................................
ENSTGUP00000002977  vtk...........................................................................
ENSTGUP00000000499  nms...........................................................................
ENSTGUP00000005001  chnggkcvekyngy................................................................
ENSTGUP00000012283  ..............................................................................
ENSTGUP00000003494  spipqgvipfksgv................................................................
ENSTGUP00000000911  ciecdfeenhlcgyvnrwnpnvnwfvgggnirnsqsilpkdhtlnsalghymyvdsvyvkdfqe..............
ENSTGUP00000006192  pralgfpasrlfihcdrfpeefsiiatlrarrrpakrneyiftlmvedspsvlvglry....................
ENSTGUP00000009636  mnekmqcfavagrg................................................................
ENSTGUP00000002624  ialppiakwpyqngftfhtwlrmdpvnninvdkdkpylycfrtnkglgysahfvgsclivtsikskgkgfqhcvk...
ENSTGUP00000000797  eq............................................................................
ENSTGUP00000013145  ..............................................................................
ENSTGUP00000003828  ..............................................................................
ENSTGUP00000008611  ddtvvcldtyncdlhfkisrdrfsassltmesfaflwaggrasygvskgkvcfemkvtekipvkhlytkdidihevrv
ENSTGUP00000015228  vdcsfsrgvcdwkqdtdddfdwnpadrdrgdgyymavpafvghkndmgrlklllndlkpkssyclifsy.........
ENSTGUP00000012725  at............................................................................
ENSTGUP00000002105  vdqwswq.......................................................................
ENSTGUP00000013146  ..............................................................................
ENSTGUP00000010269  gsfmlvntsgrfsgqkahllmphlkendthcidfhyyvssksgatpgilnvyvkvnd.....................
ENSTGUP00000010196  anfncnfdlpedlcgwshdlatihgtwtgnselspdtvpdvknylqlqssgrregqrarlisptiylpqsa.......
ENSTGUP00000007726  gfdmmevfglvekeyssikgvamepfvfsgsrtftlfrdiqltqrtsdvhlfaippehtivillrllpdtpkepfavw
ENSTGUP00000004439  inlwlsy.......................................................................
ENSTGUP00000017145  ekeskh........................................................................
ENSTGUP00000008485  svdcsfsrgvcdwkqdadddfdwnpadrdrgdgyymavpafvghkndmgrlkllltdlkpkssyclifsyrla.....
ENSTGUP00000002833  ygdrntw.......................................................................
ENSTGUP00000007830  wgtys.........................................................................
ENSTGUP00000013892  qekeskh.......................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000007218  vdlwatf.......................................................................
ENSTGUP00000008492  ldsdtadkfiqlfgtkgakrvlcpipypesptrfinceqvlglnlmnrgn............................
ENSTGUP00000001272  nncdfetnlckllpefnlqpgwirrngqsgmgppyfdhngnesayflslssemqss......................
ENSTGUP00000007218  hghl..........................................................................
ENSTGUP00000003750  saanwtvglptdnghdsd............................................................
ENSTGUP00000005281  idllpspstttnwtvglli...........................................................
ENSTGUP00000000714  smvdllllgsfpssvqsqphmrrhhsgtdalyfsgkedafgiis..................................
ENSTGUP00000012350  av............................................................................
ENSTGUP00000004160  ggf...........................................................................
ENSTGUP00000003982  vhscdfdsglcgwikdkdddlhwepvrdvsggqyltisdpkgkeggvahlilplgylaqagdlclsfrhkv.......
ENSTGUP00000002535  thcsfdydlcdweaaagppvwgrntslnlgisysiptrdhsnnsragfflhvssdrtggtaql...............
ENSTGUP00000013650  geidllpvpsptanwtarlsvhysq.....................................................
ENSTGUP00000002531  thcsfdydlcdweaaagppvwgrntslnlgisysiptrdhsnnsragfflhvssdrtggtaql...............
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000010869  ctnlglkpgqrltvkgkiapnakrtlslgwkrrravlpvshhlmhiadtnpfvcnskkveewgehretvfpfqrg...
ENSTGUP00000006581  dahiesrvaqvipsnlg.............................................................
ENSTGUP00000002535  pftcdfedsdcgwqdvgtsmygwvrgraslatwgmgphsdhtvgtdlgksmeggssaakiaatawlrspemreaaatc
ENSTGUP00000002531  pftcdfedsdcgwqdvgtsmygwvrgraslatwgmgphsdhtvgtdlgksmeggssaakiaatawlrspemreaaatc
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000001266  ipgscnfetqdqewttvcgltqdttddfdwnisngavtgqtdphtdhtpgkgqrflyvnsstqkegnraritttk...
ENSTGUP00000016883  vvp...........................................................................
ENSTGUP00000012350  n.............................................................................
ENSTGUP00000013146  ..............................................................................
ENSTGUP00000012110  endthcidfsyllysknggnpgtlnilvrvnkgplanpiwnvtgstgkd.............................
ENSTGUP00000004798  hywpledvdgihefrdtngdiiegmvnkgiyvtekkgv........................................
ENSTGUP00000001382  agfplllgserlqvgcyttldyiigdtgiakgkhfwaftveaysylvkvgvvpsnkiqkl..................
ENSTGUP00000012350  qv............................................................................
ENSTGUP00000012081  syavksgkwyfefeavtggdmrvgwarpgcrpdielgaddqafvfegskgqcwhq.......................
ENSTGUP00000000911  apgsctfedsacgyqwdyahlpwtlhgeghyisvdtsyeg......................................
ENSTGUP00000002977  pgsssnassfifhnhkdcfstpr.......................................................
ENSTGUP00000010839  dqs...........................................................................
ENSTGUP00000012486  mpavhldtqrmgtdvvivkngrricgtggclanaplhqnksyfefkiqstgiwgigvatqkanlnqiplgrdvhslvv
ENSTGUP00000010913  yavkagkwyfefeavtagdmrvgwtrpgclpdqelgsdeeafvfdgfkaqrwhqgnehfgrswlagdvvgc.......
ENSTGUP00000010839  kk............................................................................
ENSTGUP00000001856  g.............................................................................
ENSTGUP00000010839  vai...........................................................................
ENSTGUP00000011307  avsvaetisvpelrqftlcfeatkgnsddnddwkvfsytdallrevfsfgkttkghflsisgtqcilknalprnaeff
ENSTGUP00000005592  sgfycsfeegdcgwmpgssashpspwrigsaehkrfpsiegcalllntskapavaktvmtstafpaplrnspfcdlrm
ENSTGUP00000003709  lqqafgdpmlnevyllst............................................................
ENSTGUP00000000097  kreqvtldqetanldlilsddrktvrf...................................................
ENSTGUP00000010913  kwyyelmvdhlepfvtaesthlrvgwastegyspypgggaewggngvgddlysygfdglhlwsgcvartvnspnqhll
ENSTGUP00000014278  ndvyllstfrlpp.................................................................
ENSTGUP00000012086  s.............................................................................
ENSTGUP00000012081  kwyfeliidqvdpfltaepthlrvgwastsgyapypgggegwggngvgddlysfgfdglhlwsgrvpravasvnqhll
ENSTGUP00000010276  yv............................................................................
ENSTGUP00000001099  epfkmtpfsavglelwsmtsd.........................................................
ENSTGUP00000002570  gtgerffpppsglsystwfciehfstppnnhpvrlltvvrransseqhyvclaivlsakdrslivstkeellqnyvdd
ENSTGUP00000013145  a.............................................................................
ENSTGUP00000009567  ypmftisiwlyllhhcekdl..........................................................
ENSTGUP00000010913  tyyysvrifpgqepanvwvgwitsdfhqydtsfdldrvrtvtvtlgdekgkvhesi......................
ENSTGUP00000002371  ldpfkmtavsavglelwsmts.........................................................
ENSTGUP00000012081  lrifagqdpssvwvgwvtpdyhfysenfdlnknctvtvtlgderg.................................


                                                                                                    
                                                                                                    
d1dyka1               ..............................................................................
ENSTGUP00000016927  srfyvvmwkqitqsywdstptkaqgysglsikvvnsttg.......................................
ENSTGUP00000003709  ..............................................................................
ENSTGUP00000010031  srfyvlmwkqvtqtywe.............................................................
ENSTGUP00000001099  pfvfdtkpliiqyevnfqngiecggayvkllsktpelnldqfhdktpytimfgpdkcgedyklhfifrhknpktgkye
ENSTGUP00000011992  srfyvv........................................................................
ENSTGUP00000014278  ..............................................................................
ENSTGUP00000014987  dglaiwfteeqglegpvfgaadkwngvgiffdsfdnd.........................................
ENSTGUP00000002371  vfedkplivqyevnfqkgidcggayikllsssndlnleyffdktpy................................
ENSTGUP00000000385  rltpgpvfgskdnfhglaifldtypndeaterv.............................................
ENSTGUP00000007869  gthavvgvstadaplhsvgytslvgsnneswgwdlgrnklyhncknqpgvtypvflepdesfvlpdsl..........
ENSTGUP00000003849  havvgvataeaplhsvgyttlvgnnheswgwdlgrnrlyhdgknqpsktypaflepdetfivpdsf............
ENSTGUP00000003292  wglglcrea.....................................................................
ENSTGUP00000015979  rkgltqfspeegiwavq.............................................................
ENSTGUP00000016008  ekvdfapeegiwavglnwkgknwdqyqaftspetplsl........................................
ENSTGUP00000000111  ayptigrkgdseacrlgwnrasw.......................................................
ENSTGUP00000014546  laheavtrkgsiqiqpsrgfycivmhdgnqysactepwtrln....................................
ENSTGUP00000006031  llgsddqswgwnl.................................................................
ENSTGUP00000003669  ..............................................................................
ENSTGUP00000005348  kgrvlfkpnteiwglqkydelcvaltapsntsvpl...........................................
ENSTGUP00000008609  gisyksapkhewigknsaswvlcrcnntwvvrhnskeipiepaphlrrvgi...........................
ENSTGUP00000017060  kgtltlcpe.....................................................................
ENSTGUP00000009828  ..............................................................................
ENSTGUP00000014507  ..............................................................................
ENSTGUP00000010199  elhvdrydnhpdpafgiarinvvkdmmlgkddkawamyvdnnrswfmhc.............................
ENSTGUP00000005117  gvayksapknewigknssswvfsrcnnnfvvrhnnkemlvevhpqmkrl.............................
ENSTGUP00000008110  takyycvsf.....................................................................
ENSTGUP00000004907  kgawyfeismdemppdtaarlgwsqpl...................................................
ENSTGUP00000010725  ..............................................................................
ENSTGUP00000005437  ..............................................................................
ENSTGUP00000013465  ..............................................................................
ENSTGUP00000000911  ..............................................................................
ENSTGUP00000010911  ..............................................................................
ENSTGUP00000010725  ..............................................................................
ENSTGUP00000008902  ..............................................................................
ENSTGUP00000007890  prhghlgannsswcmrhiitpsrh......................................................
ENSTGUP00000002179  ..............................................................................
ENSTGUP00000013613  pknpygatn.....................................................................
ENSTGUP00000009917  ..............................................................................
ENSTGUP00000002689  prkgsanegrlgfnaaswvf..........................................................
ENSTGUP00000002179  ..............................................................................
ENSTGUP00000011992  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000005148  ..............................................................................
ENSTGUP00000006286  gddghsfcssgtgqp...............................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000008379  ..............................................................................
ENSTGUP00000006159  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000009636  ..............................................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000001754  ..............................................................................
ENSTGUP00000001756  ..............................................................................
ENSTGUP00000001267  vce...........................................................................
ENSTGUP00000000484  ..............................................................................
ENSTGUP00000007830  ..............................................................................
ENSTGUP00000002179  ..............................................................................
ENSTGUP00000001495  ..............................................................................
ENSTGUP00000010031  ..............................................................................
ENSTGUP00000017400  ..............................................................................
ENSTGUP00000007223  ..............................................................................
ENSTGUP00000010276  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000004461  yylssrd.......................................................................
ENSTGUP00000015340  ..............................................................................
ENSTGUP00000000813  ..............................................................................
ENSTGUP00000002366  yf............................................................................
ENSTGUP00000016735  ..............................................................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000003828  ..............................................................................
ENSTGUP00000013533  ..............................................................................
ENSTGUP00000001271  tc............................................................................
ENSTGUP00000010605  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000013493  evschdqglcrvgwstmqasldlgtdkfgfgfg.............................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000000499  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000001856  ..............................................................................
ENSTGUP00000001856  ..............................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000013256  ..............................................................................
ENSTGUP00000001271  ..............................................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000013952  ..............................................................................
ENSTGUP00000003772  swcmrccptqtrflhtgv............................................................
ENSTGUP00000011887  tagdt.........................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000003312  hrttsdmwly....................................................................
ENSTGUP00000006486  kaktldipipd...................................................................
ENSTGUP00000017417  ..............................................................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000005052  ..............................................................................
ENSTGUP00000000988  wyhmsgah......................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000012758  ..............................................................................
ENSTGUP00000005462  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000010134  ..............................................................................
ENSTGUP00000013027  ..............................................................................
ENSTGUP00000012212  ..............................................................................
ENSTGUP00000017145  ..............................................................................
ENSTGUP00000009339  ..............................................................................
ENSTGUP00000012283  ..............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000009346  ..............................................................................
ENSTGUP00000011096  qfylynsgnesd..................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000009346  ..............................................................................
ENSTGUP00000013113  ..............................................................................
ENSTGUP00000003411  ..............................................................................
ENSTGUP00000007370  ..............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000000911  ..............................................................................
ENSTGUP00000014074  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000003983  ..............................................................................
ENSTGUP00000013002  ..............................................................................
ENSTGUP00000000499  ..............................................................................
ENSTGUP00000009339  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000005377  ..............................................................................
ENSTGUP00000013614  ..............................................................................
ENSTGUP00000015460  vfedkplivqyev.................................................................
ENSTGUP00000002977  ..............................................................................
ENSTGUP00000011574  ..............................................................................
ENSTGUP00000013208  ..............................................................................
ENSTGUP00000003385  ..............................................................................
ENSTGUP00000002977  ..............................................................................
ENSTGUP00000000499  ..............................................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000012283  ..............................................................................
ENSTGUP00000003494  ..............................................................................
ENSTGUP00000000911  ..............................................................................
ENSTGUP00000006192  ..............................................................................
ENSTGUP00000009636  ..............................................................................
ENSTGUP00000002624  ..............................................................................
ENSTGUP00000000797  ..............................................................................
ENSTGUP00000013145  ..............................................................................
ENSTGUP00000003828  ..............................................................................
ENSTGUP00000008611  gwslntsgmllgeeefsygyslkgik....................................................
ENSTGUP00000015228  ..............................................................................
ENSTGUP00000012725  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000013146  ..............................................................................
ENSTGUP00000010269  ..............................................................................
ENSTGUP00000010196  ..............................................................................
ENSTGUP00000007726  qvtdedfqpllgvnldpskksltyfnhdykadlqevsfdeqev...................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017145  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000007830  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000008492  ..............................................................................
ENSTGUP00000001272  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000003750  ..............................................................................
ENSTGUP00000005281  ..............................................................................
ENSTGUP00000000714  ..............................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000004160  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000002535  ..............................................................................
ENSTGUP00000013650  ..............................................................................
ENSTGUP00000002531  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000010869  ..............................................................................
ENSTGUP00000006581  ..............................................................................
ENSTGUP00000002535  eirtwyhlsgswrpvlr.............................................................
ENSTGUP00000002531  eirtwyhlsgswrpvlr.............................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000001266  ..............................................................................
ENSTGUP00000016883  ..............................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000013146  ..............................................................................
ENSTGUP00000012110  ..............................................................................
ENSTGUP00000004798  ..............................................................................
ENSTGUP00000001382  ..............................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000012081  ..............................................................................
ENSTGUP00000000911  ..............................................................................
ENSTGUP00000002977  ..............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000012486  rndgalyynneeknrl..............................................................
ENSTGUP00000010913  ..............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000001856  ..............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000011307  tgtfqqlcvvwdslsgtigiyakstyhvvdcpevf...........................................
ENSTGUP00000005592  swliqgvllgnvslvlvenktgkeqswtfwhsenskglgiw.....................................
ENSTGUP00000003709  ..............................................................................
ENSTGUP00000000097  ..............................................................................
ENSTGUP00000010913  rtddvisccldlsapsi.............................................................
ENSTGUP00000014278  ..............................................................................
ENSTGUP00000012086  ..............................................................................
ENSTGUP00000012081  asddvvsccldlgv................................................................
ENSTGUP00000010276  ..............................................................................
ENSTGUP00000001099  ..............................................................................
ENSTGUP00000002570  fseessfyeilpccarfrc...........................................................
ENSTGUP00000013145  ..............................................................................
ENSTGUP00000009567  ..............................................................................
ENSTGUP00000010913  ..............................................................................
ENSTGUP00000002371  ..............................................................................
ENSTGUP00000012081  ..............................................................................


                                          10                                                        
                                           |                                                        
d1dyka1               ...........----.----------...................--......---......................
ENSTGUP00000016927  ...........----.----------...................--......---......................
ENSTGUP00000003709  ...........----.----------...................--......---......................
ENSTGUP00000010031  ...........----.----------...................--......---......................
ENSTGUP00000001099  ekhakrpdadl----.----------...................--......---......................
ENSTGUP00000011992  ...........----.----------...................--......---......................
ENSTGUP00000014278  ...........----.----------...................--......-G-......................
ENSTGUP00000014987  ...........----.----------...................--......---......................
ENSTGUP00000002371  ...........----.----------...................--......---......................
ENSTGUP00000000385  ...........----.----------...................--......---......................
ENSTGUP00000007869  ...........----.----------...................--......---......................
ENSTGUP00000003849  ...........----.----------...................--......---......................
ENSTGUP00000003292  ...........----.----------...................--......---......................
ENSTGUP00000015979  ...........----.----------...................--......---......................
ENSTGUP00000016008  ...........----.--------CE...................RPrk....IGV......................
ENSTGUP00000000111  ...........----.----------...................--......---......................
ENSTGUP00000014546  ...........----.----------...................--......---......................
ENSTGUP00000006031  ...........----.----------...................--......---......................
ENSTGUP00000003669  ...........----.----------...................--......---......................
ENSTGUP00000005348  ...........----.----------...................--......---......................
ENSTGUP00000008609  ...........----.----------...................--......-LL......................
ENSTGUP00000017060  ...........----.----------...................--......---......................
ENSTGUP00000009828  ...........----.----------...................--......---......................
ENSTGUP00000014507  ...........----.----------...................--......---......................
ENSTGUP00000010199  ...........----.----------...................--......---......................
ENSTGUP00000005117  ...........----.-----G----...................--......---......................
ENSTGUP00000008110  ...........----.----------...................--......---......................
ENSTGUP00000004907  ...........----.----------...................--......---......................
ENSTGUP00000010725  ...........----.----------...................--......---......................
ENSTGUP00000005437  ...........----.----------...................--......---......................
ENSTGUP00000013465  ...........----.----------...................--......---......................
ENSTGUP00000000911  ...........----.----------...................--......---......................
ENSTGUP00000010911  ...........----.----------...................--......---......................
ENSTGUP00000010725  ...........----.----------...................--......---......................
ENSTGUP00000008902  ...........----.----------...................--......---......................
ENSTGUP00000007890  ...........----.----------...................--......---......................
ENSTGUP00000002179  ...........-CDC.PLGFDGQHCQ...................KAiteai.EIP......................
ENSTGUP00000013613  ...........----.----------...................--......---......................
ENSTGUP00000009917  ...........ICQC.LSGYQGEKCE...................KL......ISI......................
ENSTGUP00000002689  ...........----.----------...................--......---......................
ENSTGUP00000002179  ...........RCHC.NLGKGGETCE...................EDisi...QYP......................
ENSTGUP00000011992  ...........----.----------...................--......---......................
ENSTGUP00000013892  ...........----.----------...................--......LAE......................
ENSTGUP00000004653  ...........----.----------...................--......---......................
ENSTGUP00000005148  ...........----.----------...................--......---......................
ENSTGUP00000006286  ...........----.----------...................--......---......................
ENSTGUP00000001570  ...........VCRC.LAGFAGQRCE...................KL......ITV......................
ENSTGUP00000008379  ...........----.----------...................--......IAL......................
ENSTGUP00000006159  ...........----.----------...................--......---......................
ENSTGUP00000012721  ...........HCDCsATGYAGKLCSevslslsglshlmmseqarDE......NMA......................
ENSTGUP00000009636  ...........---C.VPFAVGRSVK...................SLh.....LGR......................
ENSTGUP00000005001  ...........----.--------CS...................YKs.....DIA......................
ENSTGUP00000001754  ...........----.----------...................--......---......................
ENSTGUP00000001756  ...........----.----------...................--......---......................
ENSTGUP00000001267  ...........----.----------...................--......-G-......................
ENSTGUP00000000484  ...........----.--GRIGMRVE...................VYgctyrsEVV......................
ENSTGUP00000007830  ...........RCQCpAGGFEAPFCE...................V-......STR......................
ENSTGUP00000002179  ...........ICLC.PLGFKGHHCE...................EAltl...AIP......................
ENSTGUP00000001495  ...........RCQCpPGHYEKPFCT...................M-......STR......................
ENSTGUP00000010031  ...........----.----------...................--......---......................
ENSTGUP00000017400  ...........----.----------...................--......-GT......................
ENSTGUP00000007223  ...........TCVC.QDSKAGQ-CP...................AG......SAV......................
ENSTGUP00000010276  ...........----.----------...................--......-GT......................
ENSTGUP00000005926  ...........----.------FKCE...................NVatl...DPI......................
ENSTGUP00000004461  ...........----.----------...................--......---......................
ENSTGUP00000015340  ...........----.----------...................--......---......................
ENSTGUP00000000813  ...........----.----------...................--......---......................
ENSTGUP00000002366  ...........----.----------...................--......---......................
ENSTGUP00000016735  ...........----.----------...................--......---......................
ENSTGUP00000002833  ...........----.--------CP...................YRs.....HVL......................
ENSTGUP00000003828  ...........-CECpPGEYERPYCE...................M-......TTR......................
ENSTGUP00000013533  ...........----.----------...................--......---......................
ENSTGUP00000001271  ...........----.----------...................--......---......................
ENSTGUP00000010605  ...........----.----------...................--......---......................
ENSTGUP00000001337  ...........----.----------...................--......---......................
ENSTGUP00000005926  ...........VCDCsGTGYLGRSCE...................REa.....TIL......................
ENSTGUP00000013493  ...........----.----------...................--......---......................
ENSTGUP00000005001  ...........----.-TGNVTFSCS...................EPqi....VPI......................
ENSTGUP00000012721  ...........----.----------...................--......DPV......................
ENSTGUP00000005926  ...........----.----------...................--......DPV......................
ENSTGUP00000012721  ...........----.----------...................--......DPI......................
ENSTGUP00000000499  ...........----.----------...................-Tfw....NSA......................
ENSTGUP00000012721  ...........ICDCtGTGYWGRTCE...................REa.....SIL......................
ENSTGUP00000001856  ...........----.----------...................--......NAA......................
ENSTGUP00000001856  ...........-CDCsKTAYDGPFCI...................KD......VGA......................
ENSTGUP00000012350  ...........----.----------...................--......AGT......................
ENSTGUP00000013256  ...........ICQC.PPGKLGE-CS...................GH......TSL......................
ENSTGUP00000001271  ...........----.----------...................--......---......................
ENSTGUP00000005001  ...........----.--------CY...................GDrqfw..NAA......................
ENSTGUP00000013952  ...........----.----------...................--......---......................
ENSTGUP00000003772  ...........----.----------...................--......---......................
ENSTGUP00000011887  ...........----.----------...................--......---......................
ENSTGUP00000002105  ...........FCHC.PFGVFGNHCE...................L-......NSY......................
ENSTGUP00000005926  ...........----.----------...................--......YIA......................
ENSTGUP00000003312  ...........----.----------...................--......---......................
ENSTGUP00000006486  ...........----.---RIGVYCD...................FDg.....GQL......................
ENSTGUP00000017417  ...........----.----------...................--......---......................
ENSTGUP00000002833  ...........----.--GKVGHYCQ...................DQlt....SPI......................
ENSTGUP00000005052  ...........----.----------...................--......---......................
ENSTGUP00000000988  ...........----.----------...................--......---......................
ENSTGUP00000012350  ...........----.----------...................--......HAY......................
ENSTGUP00000012758  ...........----.----------...................--......---......................
ENSTGUP00000005462  ...........----.----------...................--......D--......................
ENSTGUP00000006169  ...........----.----------...................--......---......................
ENSTGUP00000002833  ...........TCNCsISAFTGPFCN...................HD......IGG......................
ENSTGUP00000010134  ...........-CQC.LPGFGGPKCE...................KL......LSV......................
ENSTGUP00000013027  ...........----.----------...................--......---......................
ENSTGUP00000012212  ...........----.----------...................--......TFF......................
ENSTGUP00000017145  ...........----.----------...................--......---......................
ENSTGUP00000009339  ...........RCLC.PASFHGPDCQ...................Q-......TKH......................
ENSTGUP00000012283  ...........RCKC.AANFHGPDCQ...................Q-......TKH......................
ENSTGUP00000010839  ...........----.----------...................--......TGI......................
ENSTGUP00000009346  ...........-CHC.LPGYHGYRCD...................KVa.....KEY......................
ENSTGUP00000011096  ...........----.----------...................--......---......................
ENSTGUP00000004439  ...........-CIC.PPGYTGIHCE...................TI......TTF......................
ENSTGUP00000009346  ...........RCLC.PASFHGPDCQ...................Q-......TKH......................
ENSTGUP00000013113  ...........----.----------...................--......---......................
ENSTGUP00000003411  ...........----.----------...................--......---......................
ENSTGUP00000007370  ...........----.----------...................--......---......................
ENSTGUP00000010839  ...........----.----------...................--......---......................
ENSTGUP00000000911  ...........----.----------...................--......---......................
ENSTGUP00000014074  ...........----.----------...................--......---......................
ENSTGUP00000012721  ...........----.----------...................--......-GL......................
ENSTGUP00000003983  ...........----.----------...................--......---......................
ENSTGUP00000013002  ...........----.----------...................--......---......................
ENSTGUP00000000499  ...........-CDCtFSAYAGPFFQ...................NK......ISA......................
ENSTGUP00000009339  ...........-CHC.LPGYHGYRCD...................KVa.....KEY......................
ENSTGUP00000005926  ...........-CDCsMTSFSGPLCN...................DPg.....TTY......................
ENSTGUP00000005377  ...........----.----------...................--......YSC......................
ENSTGUP00000013614  ...........----.----------...................--......---......................
ENSTGUP00000015460  ...........----.----------...................--......---......................
ENSTGUP00000002977  ...........----.----------...................--......-GA......................
ENSTGUP00000011574  ...........----.----------...................--......---......................
ENSTGUP00000013208  ...........----.----------...................--......---......................
ENSTGUP00000003385  ...........----.----------...................--......--L......................
ENSTGUP00000002977  ...........----.----------...................--......-GI......................
ENSTGUP00000000499  ...........----.------FSCL...................EPqv....VPV......................
ENSTGUP00000005001  ...........FCDCtNSAYEGPFCK...................EE......VSA......................
ENSTGUP00000012283  ...........RCDC.SPGYAGLACE...................KVl.....PEW......................
ENSTGUP00000003494  ...........----.----------...................--......---......................
ENSTGUP00000000911  ...........----.----------...................--......---......................
ENSTGUP00000006192  ...........----.----------...................--......---......................
ENSTGUP00000009636  ...........----.----------...................--......--S......................
ENSTGUP00000002624  ...........----.----------...................--......---......................
ENSTGUP00000000797  ...........----.-------ICS...................CNg.....TAV......................
ENSTGUP00000013145  ...........VCLC.PYGRSGILCS...................DAini...TQP......................
ENSTGUP00000003828  ...........ICEC.PVRYGGKNCE...................QAmp....SPQ......................
ENSTGUP00000008611  ...........TCNC.ETEDFGEKFD...................ENdvig..CFA......................
ENSTGUP00000015228  ...........----.----------...................--......---......................
ENSTGUP00000012725  ...........----.----------...................--......--Y......................
ENSTGUP00000002105  ...........QCHC.KDGLTGRHCE...................KYvtad..TAL......................
ENSTGUP00000013146  ...........TCAC.ALGWTGKYCD...................TKikf...YIA......................
ENSTGUP00000010269  ...........----.----------...................--......---......................
ENSTGUP00000010196  ...........----.----------...................--......---......................
ENSTGUP00000007726  ...........----.----------...................--......---......................
ENSTGUP00000004439  ...........HCDC.YRPYTGPDCA...................AEy.....IPG......................
ENSTGUP00000017145  ...........----.--------CF...................VEve....RGS......................
ENSTGUP00000008485  ...........----.----------...................--......---......................
ENSTGUP00000002833  ...........----.----------...................--......NTV......................
ENSTGUP00000007830  ...........-CLC.PVGFGGKDCR...................HAmh....HAH......................
ENSTGUP00000013892  ...........----.--------CF...................VEve....RGS......................
ENSTGUP00000004439  ...........TCTC.PPNTVGKACE...................EV......KWCelgpcpheaqcklvhqgfecla
ENSTGUP00000007218  ...........RCDC.ARPYGGPACS...................YEr.....PAA......................
ENSTGUP00000008492  ...........----.----------...................--......---......................
ENSTGUP00000001272  ...........----.----------...................--......---......................
ENSTGUP00000007218  ...........-CQC.QPGFSDATCS...................TP......TTF......................
ENSTGUP00000003750  ...........----.----------...................--......QVF......................
ENSTGUP00000005281  ...........----.---------D...................SNd.....MIF......................
ENSTGUP00000000714  ...........----.----------...................--......---......................
ENSTGUP00000012350  ...........----.----------...................--......-SY......................
ENSTGUP00000004160  ...........TCSC.PVGTAGTTCK...................KWcpc...PLP......................
ENSTGUP00000003982  ...........----.----------...................--......---......................
ENSTGUP00000002535  ...........----.----------...................--......---......................
ENSTGUP00000013650  ...........----.----------...................-Dss....LIY......................
ENSTGUP00000002531  ...........----.----------...................--......---......................
ENSTGUP00000014137  ...........TCTC.PPNTVGKACE...................EV......KWCelgpcpheaqcklvhqgfecla
ENSTGUP00000010869  ...........----.----------...................--......---......................
ENSTGUP00000006581  ...........----.----------...................--......---......................
ENSTGUP00000002535  ...........----.----------...................--......---......................
ENSTGUP00000002531  ...........----.----------...................--......---......................
ENSTGUP00000007218  ...........HCSC.PANFTGKFCE...................EK......VWCesdpcpeattcidvvagyvcla
ENSTGUP00000001266  ...........----.----------...................--......---......................
ENSTGUP00000016883  ...........----.----------...................--......---......................
ENSTGUP00000012350  ...........----.----------...................--......--A......................
ENSTGUP00000013146  ...........----.----------...................--......---......................
ENSTGUP00000012110  ...........----.----------...................--......---......................
ENSTGUP00000004798  ...........----.----------...................--......TFL......................
ENSTGUP00000001382  ...........----.----------...................--......---......................
ENSTGUP00000012350  ...........----.----------...................--......-SM......................
ENSTGUP00000012081  ...........----.----------...................--......---......................
ENSTGUP00000000911  ...........----.----------...................--......---......................
ENSTGUP00000002977  ...........----.----------...................--......---......................
ENSTGUP00000010839  ...........----.----------...................--......---......................
ENSTGUP00000012486  ...........----.----------...................--......---......................
ENSTGUP00000010913  ...........----.----------...................--......---......................
ENSTGUP00000010839  ...........----.--------CS...................DDwklv..RSA......................
ENSTGUP00000001856  ...........----.----------...................--......---......................
ENSTGUP00000010839  ...........----.----------...................--......-PM......................
ENSTGUP00000011307  ...........----.----------...................--......---......................
ENSTGUP00000005592  ...........----.----------...................--......---......................
ENSTGUP00000003709  ...........----.----------...................--......---......................
ENSTGUP00000000097  ...........----.----------...................--......---......................
ENSTGUP00000010913  ...........----.----------...................--......---......................
ENSTGUP00000014278  ...........----.----------...................--......---......................
ENSTGUP00000012086  ...........----.----------...................--......---......................
ENSTGUP00000012081  ...........----.----------...................--......---......................
ENSTGUP00000010276  ...........----.----------...................--......---......................
ENSTGUP00000001099  ...........----.----------...................--......---......................
ENSTGUP00000002570  ...........----.----------...................--......---......................
ENSTGUP00000013145  ...........----.----------...................--......---......................
ENSTGUP00000009567  ...........----.----------...................--......---......................
ENSTGUP00000010913  ...........----.----------...................--......---......................
ENSTGUP00000002371  ...........----.----------...................--......---......................
ENSTGUP00000012081  ...........----.----------...................--......---......................


                       20              30                40                                         
                        |               |                 |                                         
d1dyka1               ..-LSR......NSHIAIAFD..DTKVKN......RL........................TIELEVR..........
ENSTGUP00000016927  ..----......---------..------......--........................-------..........
ENSTGUP00000003709  ..----......---------..------......--........................-------..........
ENSTGUP00000010031  ..----......---------..------......--........................-------..........
ENSTGUP00000001099  ..----......---------..------......--........................-------..........
ENSTGUP00000011992  ..----......---------..------......--........................-------..........
ENSTGUP00000014278  ..----......---------..------......--........................-------..........
ENSTGUP00000014987  ..----......---------..------......--........................-------..........
ENSTGUP00000002371  ..----......---------..------......--........................-------..........
ENSTGUP00000000385  ..----......---------..------......--........................-------..........
ENSTGUP00000007869  ..----......---------..------......--........................-------..........
ENSTGUP00000003849  ..----......---------..------......--........................-------..........
ENSTGUP00000003292  ..----......---------..------......--........................-------..........
ENSTGUP00000015979  ..----......---------..------......--........................-------..........
ENSTGUP00000016008  ..YL--......---------..------......--........................-------..........
ENSTGUP00000000111  ..----......---------..------......--........................-------..........
ENSTGUP00000014546  ..----......---------..------......--........................-------..........
ENSTGUP00000006031  ..----......---------..------......--........................-------..........
ENSTGUP00000003669  ..----......---------..------......--........................-------..........
ENSTGUP00000005348  ..----......---------..------......--........................-------..........
ENSTGUP00000008609  ..DYDN......GSLAFYD--..------......--........................-------..........
ENSTGUP00000017060  ..----......---------..------......--........................-------..........
ENSTGUP00000009828  ..----......---------..------......--........................-------..........
ENSTGUP00000014507  ..----......---------..------......--........................-------..........
ENSTGUP00000010199  ..----......---------..------......--........................-------..........
ENSTGUP00000005117  ..----......---------..------......--........................-------..........
ENSTGUP00000008110  ..----......--------Y..------......--........................-------..........
ENSTGUP00000004907  ..----......---------..------......--........................-------..........
ENSTGUP00000010725  ..----......---------..------......--........................-------..........
ENSTGUP00000005437  ..----......---------..------......--........................-------..........
ENSTGUP00000013465  ..----......---------..------......--........................-------..........
ENSTGUP00000000911  ..----......---------..------......--........................-------..........
ENSTGUP00000010911  ..----......---------..------......--........................DLALHFN..........
ENSTGUP00000010725  ..----......---------..------......--........................-------..........
ENSTGUP00000008902  ..----......---------..-LPELY......AF........................TVCLWLR..........
ENSTGUP00000007890  ..----......---------..------......--........................-------..........
ENSTGUP00000002179  ..QFIG......RSYLTYDNP..DILKRLnrvsgtRT........................NVFMRFK..........
ENSTGUP00000013613  ..----......-T-------..------......--........................-------..........
ENSTGUP00000009917  ..NFVNk.....ESYLQIP--..SAKIRP......QT........................NITLQIA..........
ENSTGUP00000002689  ..----......---------..------......--........................------S..........
ENSTGUP00000002179  ..QFSG......YSYITFEP-..LKKSYQ......TF........................QITLEFR..........
ENSTGUP00000011992  ..----......---------..------......--........................-------..........
ENSTGUP00000013892  ..QFTG......APVLHLKF-..KLPNVT......RF........................TAEFDFR..........
ENSTGUP00000004653  ..----......---------..--RNRS......EF........................TFLATLQ..........
ENSTGUP00000005148  ..----......------P--..GGGFPE......DF........................SILMTVK..........
ENSTGUP00000006286  ..----......---------..------......--........................-------..........
ENSTGUP00000001570  ..NFVGk.....DSYVELP--..SAKIRP......QA........................NISLQVA..........
ENSTGUP00000008379  ..HFNPrls...SSRIVCNSF..LNSHWGqe....EV........................NSTFPFK..........
ENSTGUP00000006159  ..----......-----YP--..ASPFPE......DF........................SILTTVK..........
ENSTGUP00000012721  ..TFRG......SEYLCYDLS..QNPIQSs.....SD........................EITLSFK..........
ENSTGUP00000009636  ..MFSG......TPVIRLRF-..RRKQLT......RL........................VAEFDFR..........
ENSTGUP00000005001  ..DFDG......RSSLLYRFN..QKLMSTf.....KD........................VVSLKFK..........
ENSTGUP00000001754  ..----......---------..------......--........................-------..........
ENSTGUP00000001756  ..----......---------..------......--........................-------..........
ENSTGUP00000001267  ..----......---------..------......--........................-------..........
ENSTGUP00000000484  ..GFDG......KSCLIYTLNk.KLINAL......KD........................VISLKFK..........
ENSTGUP00000007830  ..SFPP......RSFIMFR--..GLRQRF......HL........................TLALSFS..........
ENSTGUP00000002179  ..QFNEsl....RSFASTPWPleSQNYLS......FM........................EFELTFR..........
ENSTGUP00000001495  ..SFPP......HSFLTFR--..GLRQRF......HF........................TLGLTFA..........
ENSTGUP00000010031  ..----......---------..------......--........................-------..........
ENSTGUP00000017400  ..FFDG......SGFAALARE..GYKVRS......DV........................NITLEFR..........
ENSTGUP00000007223  ..TFTG......SSYVKYRLM..ESENKE......EM........................KLTMRLR..........
ENSTGUP00000010276  ..FFDG......SGFAALARE..GYKVRS......DV........................NITLEFR..........
ENSTGUP00000005926  ..TFETp.....ESFISLP--..KWNAKK......TG........................SISFDFR..........
ENSTGUP00000004461  ..----......---------..------......--........................-------..........
ENSTGUP00000015340  ..----......---------..------......--........................-------..........
ENSTGUP00000000813  ..----......---------..------......--........................-------..........
ENSTGUP00000002366  ..----......---------..------......--........................-------..........
ENSTGUP00000016735  ..----......---------..------......--........................-------..........
ENSTGUP00000002833  ..YFDG......DDAISYRFR..ARRISTf.....ED........................DISFNFK..........
ENSTGUP00000003828  ..SFPP......QSFITFK--..GLRQRF......HF........................TVSLMFA..........
ENSTGUP00000013533  ..----......---------..------......--........................-------..........
ENSTGUP00000001271  ..----......----V----..------......--........................-------..........
ENSTGUP00000010605  ..----......---------..SLPELY......AF........................TICMWLK..........
ENSTGUP00000001337  ..---Gi.....YGYVMLDG-..VLPSLG......DI........................TCTFWMK..........
ENSTGUP00000005926  ..SYDG......SMFMKIQLP..VVMHTE......AE........................DVSLRFR..........
ENSTGUP00000013493  ..---G......---------..------......--........................-------..........
ENSTGUP00000005001  ..TFVSts....RSYLLLP--..GTAQID......GL........................SVSFQFR..........
ENSTGUP00000012721  ..TFKTk.....SSYLSLA--..TLQAYT......SM........................HLFFQFK..........
ENSTGUP00000005926  ..TFKTk.....ASYVALA--..TLQAYT......SM........................HLFFQFK..........
ENSTGUP00000012721  ..SFETp.....EAYISLP--..KWNTKR......MG........................SISFDFR..........
ENSTGUP00000000499  ..SFNTe.....TSYLHFP--..TFHGEF......SA........................DVSFFFK..........
ENSTGUP00000012721  ..SYDG......SMYMKIIMP..MVMHTE......AE........................DVSFRFM..........
ENSTGUP00000001856  ..SFVTs.....SSYLHFS--..TFQGET......SA........................DISFYFK..........
ENSTGUP00000001856  ..FFEE......GMWLRYNFH..SPGTSM......KDlvsrtllssadpeitapdlslnkeELSFSFS..........
ENSTGUP00000012350  ..YFSSe.....GGYVVLDE-..SFSLGL......KF........................EVVFEIR..........
ENSTGUP00000013256  ..SFAG......NSYIKYRVS..ENSKKE......EF........................KLALRLR..........
ENSTGUP00000001271  ..----......---------..------......--........................-------..........
ENSTGUP00000005001  ..SFNTe.....ASYLHFP--..TLHAEV......SA........................DISFFFK..........
ENSTGUP00000013952  ..----......---------..----S-......--........................-------..........
ENSTGUP00000003772  ..----......---------..------......--........................-------..........
ENSTGUP00000011887  ..----......---------..------......--........................-------..........
ENSTGUP00000002105  ..GFEE......LSYMEFP--..-SMDPN......NN........................YIYIKFA..........
ENSTGUP00000005926  ..TFKG......SEYFCYDLS..QNPIQSs.....SD........................EITLSFK..........
ENSTGUP00000003312  ..----......---------..------......--........................-------..........
ENSTGUP00000006486  ..SFYNa.....SSKALLHT-..------......--........................-----FR..........
ENSTGUP00000017417  ..----......---------..------......--........................-------..........
ENSTGUP00000002833  ..TFAGi.....NNYVQVP--..GIPRRN......RL........................AVSFRFR..........
ENSTGUP00000005052  ..----......---------..------......--........................-------..........
ENSTGUP00000000988  ..----......---------..------......V-........................-------..........
ENSTGUP00000012350  ..QFGGta....NSRQEFDHI..PKDFSQ......RA........................QFSISLK..........
ENSTGUP00000012758  ..----......---------..PEGLPS......DY........................TITFLFRilpd......
ENSTGUP00000005462  ..----......---------..------......--........................-------..........
ENSTGUP00000006169  ..----......---------..KLRNKC......EF........................TILVTLK..........
ENSTGUP00000002833  ..YFEE......GTWVRYNIL..PMSLYA......ARefasivsspwqplpgynltse...EVSFSFS..........
ENSTGUP00000010134  ..NFVDr.....DTYLQFT--..DLQDWP......RA........................NITLQVS..........
ENSTGUP00000013027  ..----......---------..-EGLPQ......AY........................TIILLFRll........
ENSTGUP00000012212  ..NFPGcs....AAAIALPPIa.KWPYQN......GF........................TLNTWFR..........
ENSTGUP00000017145  ..----......---------..------......-F........................TAEFDFR..........
ENSTGUP00000009339  ..SFHG......NGYAWFR--..PIRPCF......ES........................SLSLEFI..........
ENSTGUP00000012283  ..SFRG......HGYAWFP--..PLQPCF......ES........................RISLEFI..........
ENSTGUP00000010839  ..YFFNe.....GGYITIG--..NLLMSV......DF........................KIVFTIR..........
ENSTGUP00000009346  ..RFEA......GSHIRYQLP..VSVSAR......RT........................LLQALVR..........
ENSTGUP00000011096  ..----......---------..------......--........................QLNVWVReyt.......
ENSTGUP00000004439  ..SFQG......NSFLLLKNS..QTHKKE......FF........................NINLRFQ..........
ENSTGUP00000009346  ..SFHG......NGYAWFR--..PIRPCF......ES........................SLSLEFI..........
ENSTGUP00000013113  ..----......---------..-----D......EY........................SFLTTFRmtga......
ENSTGUP00000003411  ..---Pnant..GQVARYHL-..PSPFYR......DF........................SLLFHIQ..........
ENSTGUP00000007370  ..----......---------..------......--........................-------..........
ENSTGUP00000010839  ..---P......NSFISYMFS..PLLSTD......RL........................HFSVDVR..........
ENSTGUP00000000911  ..----......---------..------......--........................-------..........
ENSTGUP00000014074  ..----......---------..PEGLPS......DY........................TITFLFRilpd......
ENSTGUP00000012721  ..EFMGip....NQWARYL--..RWDAST......RS........................ELSFQFK..........
ENSTGUP00000003983  ..----......---------..------......--........................-------..........
ENSTGUP00000013002  ..----......---------..-LPDEY......AF........................VTTFKFRka........
ENSTGUP00000000499  ..YFWT......GTSVTYNFQ..EYYTLA......KNssshassfyadmtlare.......AITFAFR..........
ENSTGUP00000009339  ..RFEA......GSHIRYQLP..VSVSAR......RT........................LLQALVR..........
ENSTGUP00000005926  ..IFSKg.....GGQITYTWP..PNDRPStr....AD........................RLAIGFS..........
ENSTGUP00000005377  ..AYDGc.....RQLIWYN--..------......--........................-------..........
ENSTGUP00000013614  ..----......---------..------......QQ........................CLQFFYR..........
ENSTGUP00000015460  ..----......---------..------......--........................-------..........
ENSTGUP00000002977  ..HFLG......RGFLELHSG..VFSGGL......EF........................EISFKFR..........
ENSTGUP00000011574  ..----......---------..-GMTLS......SF........................TACIWLK..........
ENSTGUP00000013208  ..----......---------..------......--........................-------..........
ENSTGUP00000003385  ..YFSGq.....GDQLRLKAD..VELPRD......AF........................TLQVWLKaeggqrspav
ENSTGUP00000002977  ..RFPG......NGYYRFASS..TLPTNTy.....FT........................GIKVKFR..........
ENSTGUP00000000499  ..TFLSs.....SSFLALQ--..GTSGQD......EV........................FVSFEFR..........
ENSTGUP00000005001  ..LFEA......GTSVTYTFQe.PYPVTK......NAstsssaiyvdavmske........NIAFSFL..........
ENSTGUP00000012283  ..AFGR......DSWIHFEPR..SILSTR......ST........................RIQLLVR..........
ENSTGUP00000003494  ..IFTQ......RARVEAPLSt.LLPAGS......SS........................DLLLVLS..........
ENSTGUP00000000911  ..----......---------..------......--........................-------..........
ENSTGUP00000006192  ..----......---------..------......--........................-------..........
ENSTGUP00000009636  ..FYPG......RGFAVFNLT..YMQPSS......-Gnetktnwei...............EVNAVIQ..........
ENSTGUP00000002624  ..----......---------..------......--........................-------..........
ENSTGUP00000000797  ..RFGG......HSYIWYQ--..-HSQAG......SW........................HMHFRLK..........
ENSTGUP00000013145  ..SFGGtdvfgyTSFLAYSTIp.NITFYY......EF........................RLKFWLA..........
ENSTGUP00000003828  ..RFSG......ESIIIWSDL..DITISV......PW........................YIGLMFR..........
ENSTGUP00000008611  ..NFDG......---------..------......--........................-------..........
ENSTGUP00000015228  ..----......---------..------......--........................-------..........
ENSTGUP00000012725  ..IFGKs.....GGLILYTWP..ANDRPStr....TD........................RLAVGFS..........
ENSTGUP00000002105  ..SLEG......KGRLDYHMS..PNKKRD......YLmrlgargagagrpgve........RLEVKFM..........
ENSTGUP00000013146  ..KFVG......NSYIKYTDP..FYGKRDlq....YS........................RLSLNFT..........
ENSTGUP00000010269  ..----......---------..------......--........................-------..........
ENSTGUP00000010196  ..----......---------..------......-V........................CMVFQYQ..........
ENSTGUP00000007726  ..----......---------..------......--........................-------..........
ENSTGUP00000004439  ..RFGSeds...SGYAAFPV-..GSTQNE......NF........................IISMFVR..........
ENSTGUP00000017145  ..FYPG......TGMAAFQIN..YNNLDSaedw..LI........................NVTLTIR..........
ENSTGUP00000008485  ..----......---------..------......--........................-------..........
ENSTGUP00000002833  ..SFNR......GAALIFPL-..---QAN......HS........................LDIFYFK..........
ENSTGUP00000007830  ..YFQG......NSVLSWDFKa.DVKISV......PW........................YLGLAFR..........
ENSTGUP00000013892  ..FYPG......TGMAAFQIN..YNNLDSaedw..LI........................NVTLTIR..........
ENSTGUP00000004439  naVFSGr.....SSAIFYRSN..GKISRD......LT........................NIVFGFR..........
ENSTGUP00000007218  ..TFGLens...TSFASFTL-..SDSFGA......DF........................NLSFFLR..........
ENSTGUP00000008492  ..----......---------..------......--........................-------..........
ENSTGUP00000001272  ..----......---------..------......--........................-------..........
ENSTGUP00000007218  ..SFAS......RGHLLIELP..ENSASGrdag..GA........................SVSLRFR..........
ENSTGUP00000003750  ..EFNG......TQAVKIPDGvvTVNLKE......PF........................MISVWMRhgpg......
ENSTGUP00000005281  ..KFDG......KQGAKIPDGivPKNLTD......QF........................TITLWMK..........
ENSTGUP00000000714  ..----......---LEYPYE..GNTAVT......NF........................TFSAWLI..........
ENSTGUP00000012350  ..FFDG......SGYALARNIerRGKFSQ......VT........................RFDIEVR..........
ENSTGUP00000004160  ..AFSG......SSYLELP--..-CRASD......RM........................SLDLVLL..........
ENSTGUP00000003982  ..----......---------..--PGLH......SG........................TLQVFVR..........
ENSTGUP00000002535  ..----......---------..------......--........................-------..........
ENSTGUP00000013650  ..WFNG......SQAAQVPVV..NGPNGHeglsd.HF........................TLSVWMKhavvpskg..
ENSTGUP00000002531  ..----......---------..------......--........................-------..........
ENSTGUP00000014137  naVFSGr.....SSAIFYRSN..GKISRD......LT........................NIVFGFR..........
ENSTGUP00000010869  ..----......-G-------..------......--........................-------..........
ENSTGUP00000006581  ..----......---------..-----H......QF........................TLLVGLY..........
ENSTGUP00000002535  ..----......---------..------......--........................-------..........
ENSTGUP00000002531  ..----......---------..------......--........................-------..........
ENSTGUP00000007218  naTFNS......YAAVEFTTS..TSVTRT......LS........................SLHMDFR..........
ENSTGUP00000001266  ..FFPAs.....LGVCRVRFW..FWMFPS......RQ........................TGVLKVY..........
ENSTGUP00000016883  ..YFGQsp....RSFLPLPT-..IKDAYK......RF........................EILITFR..........
ENSTGUP00000012350  ..YFNG......ESFIASSQ-..KVSLFT......EF........................EGGFNFR..........
ENSTGUP00000013146  ..----......---------..------......--........................-------..........
ENSTGUP00000012110  ..----......---------..------......--........................-------..........
ENSTGUP00000004798  ..FFGSyr....NSCISNP--..EACGPE......GV........................TFSFFWK..........
ENSTGUP00000001382  ..----......---------..------......--........................-------..........
ENSTGUP00000012350  ..MFEG......QSAVEVNPKinVEELKS......FT........................SMSLYIKlhkdnpql..
ENSTGUP00000012081  ..----......---------..------......--........................-------..........
ENSTGUP00000000911  ..----......---------..------......--........................-------..........
ENSTGUP00000002977  ..----......---------..LPRLGA......SF........................TLTVWLK..........
ENSTGUP00000010839  ..YFEG......TGYASVTA-..GERSGE......RV........................RYEQTIE..........
ENSTGUP00000012486  ..----......---------..------......--........................-------..........
ENSTGUP00000010913  ..----......---------..------......--........................-------..........
ENSTGUP00000010839  ..AFSK......DGTLSLSAA..DFPFPK......DF........................QVGFGFQ..........
ENSTGUP00000001856  ..----......---------..------......--........................-------..........
ENSTGUP00000010839  ..RFNG......SSGVEVRPP..SNLEDLkg....YT........................SLSLFIQ..........
ENSTGUP00000011307  ..----......---------..------......--........................-------..........
ENSTGUP00000005592  ..----......---------..------......--........................-------..........
ENSTGUP00000003709  ..----......---------..------......--........................---FKLQ..........
ENSTGUP00000000097  ..----......---------..------......--........................-------..........
ENSTGUP00000010913  ..----......---------..------......--........................-------..........
ENSTGUP00000014278  ..----......---------..------......--........................-------..........
ENSTGUP00000012086  ..----......---------..------......--........................-------..........
ENSTGUP00000012081  ..----......---------..------......--........................-------..........
ENSTGUP00000010276  ..----......---------..------......--........................-------..........
ENSTGUP00000001099  ..----......---------..------......--........................-------..........
ENSTGUP00000002570  ..----......---------..------......--........................-------..........
ENSTGUP00000013145  ..----......---------..------......--........................-------..........
ENSTGUP00000009567  ..----......---------..------......--........................-------..........
ENSTGUP00000010913  ..----......---------..------......--........................-------..........
ENSTGUP00000002371  ..----......---------..------......--........................-------..........
ENSTGUP00000012081  ..----......---------..------......--........................-------..........


                                 50                          60                           70        
                                  |                           |                            |        
d1dyka1               ..........TEA...E........SG.......LLFYMARINH......A............DFAT.VQL.....RN
ENSTGUP00000016927  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003709  ..........---...-........--.......------G---......-............----.---.....--
ENSTGUP00000010031  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000001099  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000011992  ..........---...-........--.......----------......-............----.--M.....--
ENSTGUP00000014278  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000014987  ..........---...-........--.......------GKKN......N............PGVI.VVG.....NN
ENSTGUP00000002371  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000385  ..........---...-........--.......----------......F............PYIS.AMV.....NN
ENSTGUP00000007869  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003849  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003292  ..........---...-........--.......-------AGR......K............GSVL.FSP.....NN
ENSTGUP00000015979  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000016008  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000111  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000014546  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000006031  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003669  ..........---...-........--.......------DLNK......S............TATL.LTC.....DN
ENSTGUP00000005348  ..........---...-........--.......----------......-............----.---.....L-
ENSTGUP00000008609  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000017060  ..........---...-........--.......----------......-............----.---.....-N
ENSTGUP00000009828  ..........---...-........--.......-L--------......-............----.---.....--
ENSTGUP00000014507  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010199  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000005117  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000008110  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000004907  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010725  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000005437  ..........---...-........--.......----------......-............KYNY.IGL.....SQ
ENSTGUP00000013465  ..........---...-........ND.......VAFHFNPRFN......E............DHRK.VIV.....CN
ENSTGUP00000000911  ..........---...-........K-.......----------......-............----.---.....--
ENSTGUP00000010911  ..........PRF...N........ES.......VIVCNSKCS-......-............DCWQ.AEH.....RD
ENSTGUP00000010725  ..........--D...S........KD.......IALHLNPRMK......-............--NK.VFV.....RN
ENSTGUP00000008902  ..........SSA...S........PGigt....PFSYAVPGQA......N............EIVL.IEW.....GN
ENSTGUP00000007890  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002179  ..........TTM...K........EG.......LLMWRGNSPMrpn...S............DFIS.LGL.....QE
ENSTGUP00000013613  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000009917  ..........TDE...D........SG.......ILLYKGDK--......-............DHIA.VEL.....YR
ENSTGUP00000002689  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002179  ..........AES...E........DG.......LLLYCGENEHgr....G............DFMS.LAI.....IR
ENSTGUP00000011992  ..........-KK...S........RG.......TLLSVEQNDGs.....G............HVFS.LVSng...KA
ENSTGUP00000013892  ..........TYD...A........EG.......LILYAESLDN......S............AWIL.LAL.....RD
ENSTGUP00000004653  ..........QKAs..T........SG.......VILSIRELEH......-............SYFE.LESsg...LR
ENSTGUP00000005148  ..........PKKg..I........QS.......FLLSIYNEQG......I............QQVG.VEV.....GR
ENSTGUP00000006286  ..........---...-........Y-.......----------......-............----.---.....--
ENSTGUP00000001570  ..........TDK...D........NG.......ILLYKGDN--......-............DPLA.LEL.....YQ
ENSTGUP00000008379  ..........AKE...P........FQ.......VEIYSDQ---......-............DYFH.VFI.....NE
ENSTGUP00000006159  ..........AKKg..G........QS.......FLISIYNEQG......I............QQIG.VEL.....GR
ENSTGUP00000012721  ..........TWQ...R........NG.......LILHTGKSA-......-............DYVN.LAL.....KD
ENSTGUP00000009636  ..........TFD...P........EG.......ILFFAGGHQD......S............TWIV.LAL.....RK
ENSTGUP00000005001  ..........SMQ...G........DG.......VLFHGEGQRG......-............DYIT.LEL.....QK
ENSTGUP00000001754  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000001756  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000001267  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000484  ..........TMQ...S........DG.......ILLHREGQNG......-............DHIT.MEL.....TK
ENSTGUP00000007830  ..........TVE...P........SG.......LLLYNGRLNEr.....H............DFLA.VEI.....IQ
ENSTGUP00000002179  ..........PDL...E........TG.......VILYSYDSDS......K............DFLS.INM.....VA
ENSTGUP00000001495  ..........TQE...R........DG.......LLLYNGRFNEr.....H............DFVA.LEI.....VD
ENSTGUP00000010031  ..........---...S........RG.......TILALEGPGIse....R............QFEI.ISNg....RA
ENSTGUP00000017400  ..........TTA...V........HG.......VLLGVSSTKV......-............DAIG.LEI.....VH
ENSTGUP00000007223  ..........TYS...A........HA.......VVMYARGT--......-............DYSI.LEI.....HH
ENSTGUP00000010276  ..........TTA...V........HG.......VLLGVSSTKV......-............DAIG.LEI.....VH
ENSTGUP00000005926  ..........TTE...P........NG.......LILFSHGKPR......HqkdakhpqmvkvDFFA.IEM.....LD
ENSTGUP00000004461  ..........-R-...-........--.......----------......-............----.---.....--
ENSTGUP00000015340  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000813  ..........---...-........--.......-L--------......-............----.---.....--
ENSTGUP00000002366  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000016735  ..........---...P........HS.......LFSYATKAQ-......-............DNEI.LLF.....KP
ENSTGUP00000002833  ..........TLE...Q........DG.......VLMHGEGSQG......-............DYIT.VEL.....KQ
ENSTGUP00000003828  ..........TRE...R........NA.......LLLYNGRFNEk.....H............DFIA.LEI.....IE
ENSTGUP00000013533  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000001271  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010605  ..........SKA...L........AGigt....PFSYSVASQA......N............EIVL.LEW.....GT
ENSTGUP00000001337  ..........STD...T........TNygt....PISYAVENGS......D............NAFL.LTD.....YN
ENSTGUP00000005926  ..........SQR...A........YG.......ILMATTSRES......A............DTLR.LEL.....DA
ENSTGUP00000013493  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000005001  ..........TWN...K........DG.......LLLFTELSEN......S............GHLL.VYL.....RG
ENSTGUP00000012721  ..........TTS...A........DG.......FILFNSGDGN......-............DFIA.VEL.....VK
ENSTGUP00000005926  ..........TTS...L........DG.......LILFNSGDGN......-............DFIV.VEL.....VK
ENSTGUP00000012721  ..........TTE...P........NG.......LILFTHGKPQ......ErkdtrsqkntkvDFFA.VEL.....LD
ENSTGUP00000000499  ..........TIA...S........SG.......VFLENLGIQ-......-............DFIR.IELq....SP
ENSTGUP00000012721  ..........SQR...A........YG.......LLMATTSRDS......A............DTLR.LEL.....DG
ENSTGUP00000001856  ..........TSA...S........DG.......VFLENLGNT-......-............DFIK.LELk....SA
ENSTGUP00000001856  ..........TTK...S........PC.......VLFYVSSYTP......-............DFMA.VLVn....PT
ENSTGUP00000012350  ..........PRS...S........SG.......ILLHGHSVNG......-............EYLN.MHM.....RN
ENSTGUP00000013256  ..........TLQ...S........NG.......IIMYTRAN--......-............PCII.LKI.....VD
ENSTGUP00000001271  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000005001  ..........TTA...V........SG.......VFLENLGIK-......-............DFIR.IEIs....SP
ENSTGUP00000013952  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003772  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000011887  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002105  ..........TIK...S........NA.......LLLYNYDNQTger...A............EFLA.LEI.....VE
ENSTGUP00000005926  ..........TLQ...R........NG.......LMLHTGKSA-......-............DYVN.LAL.....KN
ENSTGUP00000003312  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000006486  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000017417  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002833  ..........SWD...T........AG.......LLLYTGFADR......L............GSLE.MVL.....SE
ENSTGUP00000005052  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000988  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000012350  ..........THS...S........HG.......MICYISDQKE......T............NFMA.LFV.....AH
ENSTGUP00000012758  ..........TPQ...E........PF.......ALWEILNEAY......E............PLVG.VILd....NG
ENSTGUP00000005462  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000006169  ..........QAHl..N........SG.......VILSIHYLDH......-............RYLE.LESsg...HR
ENSTGUP00000002833  ..........TTS...A........PA.......VLLYVSTFVK......-............DYMA.VLIk....DD
ENSTGUP00000010134  ..........TAE...G........NG.......ILLYNGDS--......-............DHMA.VEL.....YQ
ENSTGUP00000013027  ..........PES...P........NEpf.....AIWQITDRDY......K............PQVG.VVL.....DP
ENSTGUP00000012212  ..........MDP...L........NNinvdkdkPYLYCFRTSK......G............VGYS.AHF.....VG
ENSTGUP00000017145  ..........TYD...A........EG.......LILYAESLDN......S............AWIL.LAL.....RD
ENSTGUP00000009339  ..........TVV...P........DG.......LLLYSGPLSNpepgstE............NFIAiVEL.....SG
ENSTGUP00000012283  ..........TEV...V........DG.......LLLYHGPAARgqpgeqE............NFLA.LEL.....SG
ENSTGUP00000010839  ..........PRS...S........TG.......VLLHAGSKQD......-............NYLT.VYM.....KG
ENSTGUP00000009346  ..........TRQ...P........HG.......VIATVLSRAR......D............EHIT.LQV.....VQ
ENSTGUP00000011096  ..........SAD...P........NG.......TLRFIKEIKG......-............----.---.....--
ENSTGUP00000004439  ..........TVQ...P........TA.......FLFHRGEKNT......-............-FAK.LEL.....LN
ENSTGUP00000009346  ..........TVV...P........DG.......LLLYSGPLSNpepgstE............NFIA.IEL.....SG
ENSTGUP00000013113  ..........TLQ...K........YW.......TIWQIQDSSG......K............EQVG.VNL.....NG
ENSTGUP00000003411  ..........PTTp..R........AG.......VLFAVTDASQ......-............SIIY.VGVklselRA
ENSTGUP00000007370  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010839  ..........TRS...S........RG.......LIVFMEESSE......D............SYMA.LHI.....SK
ENSTGUP00000000911  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000014074  ..........TPQ...E........PF.......ALWEILNEAY......E............PLVG.VILd....NG
ENSTGUP00000012721  ..........TNV...S........AG.......LLLYFDDGGV......C............DFLC.VSL.....VD
ENSTGUP00000003983  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000013002  ..........SRK...E........DW.......YIWQIIDKYG......I............PQVS.IRL.....DG
ENSTGUP00000000499  ..........TTR...T........PS.......LLLYVSSFYK......-............EYLS.VILt....RN
ENSTGUP00000009339  ..........TRQ...P........HG.......VIATVLSRAR......D............EHIT.LQV.....VQ
ENSTGUP00000005926  ..........TVQ...K........EA.......VLVRVDSSTGl.....G............DYLE.LHI.....HQ
ENSTGUP00000005377  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000013614  ..........TTG...-........--.......----------......-............----.---.....--
ENSTGUP00000015460  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002977  ..........TDQ...L........NG.......LLLFVYNKDG......P............DYLA.IEL.....KS
ENSTGUP00000011574  ..........VTEa..L........DK.......TIVFSYGTRF......-............NPYE.IQL.....YL
ENSTGUP00000013208  ..........---...-........--.......-----LSLDK......R............PQIA.VTV.....NG
ENSTGUP00000003385  iaglydkcsyTSR...D........RG.......WVLGINTVS-......-............----.--Dqgn..RD
ENSTGUP00000002977  ..........TQE...P........DG.......LIFFSASPGNq.....E............EYIA.LQL.....KS
ENSTGUP00000000499  ..........TWN...K........EG.......LLLSSKLHQS......S............GGFL.LYL.....SD
ENSTGUP00000005001  ..........TAH...T........PS.......LLLYINTYFH......-............EYLA.VILs....KN
ENSTGUP00000012283  ..........TRI...S........HS.......TLLSLASVDG......N............RYIR.LEV.....FD
ENSTGUP00000003494  ..........LCShriN........NA.......FLFAVRSKKK......K............LQLG.VQF.....VP
ENSTGUP00000000911  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000006192  ..........---...-........--.......----------......-............----.---.....AP
ENSTGUP00000009636  ..........PAT...D........TG.......VLFALVTEEA......S............VPLS.LSL.....ID
ENSTGUP00000002624  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000797  ..........THQ...H........HS.......VVFHANGS--......-............DHTT.LEM.....VN
ENSTGUP00000013145  ..........NHHsalQ........DN.......LIFFTGQKGQglng..D............DFLE.LGL.....RN
ENSTGUP00000003828  ..........TRK...V........NG.......MLMQANAGAA......-............SKIN.IQI.....LN
ENSTGUP00000008611  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000015228  ..........---...-........--.......-----R----......-............----.---.....--
ENSTGUP00000012725  ..........TTV...K........DG.......ILVRIDSAPGl.....G............DFLQ.LHI.....EQ
ENSTGUP00000002105  ..........TRS...E........SG.......ILLHVQESSN......-............-FTT.VKI.....KG
ENSTGUP00000013146  ..........TNQ...T........EG.......LIAWMGKSEDed....N............DFLA.IGL.....AN
ENSTGUP00000010269  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010196  ..........AWG...S........NG.......VMLRVWREAS......Q............EHKA.LW-.....--
ENSTGUP00000007726  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000004439  ..........TRK...P........SG.......LLLALRNSTY......-............LYIR.VYL.....EG
ENSTGUP00000017145  ..........PST...D........TG.......VMFALVSNET......-............VPLA.LSIvgsn.SS
ENSTGUP00000008485  ..........---...-........--.......--------G-......-............----.---.....--
ENSTGUP00000002833  ..........TTA...Q........SG.......VFLENPGYRN......-............-YIR.IELn....TT
ENSTGUP00000007830  ..........TRQ...Q........DG.......VLLQAHAGQY......-............TTLL.CQL.....AG
ENSTGUP00000013892  ..........PST...D........TG.......VMFALVSNET......-............VPLA.LSIvgsn.SS
ENSTGUP00000004439  ..........TRD...T........DV.......ILLYAEREPE......-............-FVI.ISI.....HN
ENSTGUP00000007218  ..........SRK...P........DG.......LLLQVCNGTG......-............PCLT.LYL.....RD
ENSTGUP00000008492  ..........---...-........--.......----------......-............YYWE.VEL.....ID
ENSTGUP00000001272  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000007218  ..........TTL...P........SA.......VLFYRGREAE......-............-YLF.LEL.....LD
ENSTGUP00000003750  ..........TKE...K........E-.......TILCNSDKTDmn....R............HHYT.LYV.....HN
ENSTGUP00000005281  ..........HGP...S........PGlraeke.TILCNSDKTEmn....R............HHYA.LYV.....HN
ENSTGUP00000000714  ..........PNVn..T........DG.......YIVEKDDGNG......T............LYYG.VKIqt...ND
ENSTGUP00000012350  ..........TPT...D........NG.......LILLMINGSM......-............-FFS.LEM.....HN
ENSTGUP00000004160  ..........ARR...P........RG.......LILYNGQRSDgg....G............DFVS.LAL.....HG
ENSTGUP00000003982  ..........KTG...A........HG.......PAVWGRNG--......-............----.---.....--
ENSTGUP00000002535  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000013650  ..........RRE...E........ETv......ICSTVRSEDG......Y............SHYS.LAV.....HG
ENSTGUP00000002531  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000014137  ..........TRD...T........DV.......I-LYAEREP-......-............EFVI.ISI.....HN
ENSTGUP00000010869  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000006581  ..........SYRa..S........DA.......FLFSVRNKSR......-............LQFG.VQL.....LP
ENSTGUP00000002535  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002531  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000007218  ..........TRD...E........DA.......VLLQAVEEV-......-............DSLQ.VAI.....KN
ENSTGUP00000001266  ..........TVE...E........HGmd.....ILMW------......-............----.---.....--
ENSTGUP00000016883  ..........PDA...A........DG.......LLLYNGQRKNsg....A............DFIS.FGL.....VG
ENSTGUP00000012350  ..........TLQ...P........SG.......LLFYYSEGS-......-............DILS.ISM.....ER
ENSTGUP00000013146  ..........---...-........--.......----------......-............DFLC.ISL.....VN
ENSTGUP00000012110  ..........---...-........--.......----------......-............-W--.---.....--
ENSTGUP00000004798  ..........TQD...Q........QA.......KLLPASGGRVi.....S............SGFK.ICS.....NE
ENSTGUP00000001382  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000012350  ..........AAS...P........DR.......FVLYLGNKNA......K............HYIG.LAI.....KN
ENSTGUP00000012081  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000000911  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002977  ..........PEQ...E........GV.......MCVIEKAIDG......K............TVFK.LTI.....SE
ENSTGUP00000010839  ..........TTA...D........EG.......IVFFAANGDQ......-............-FIS.VLI.....RN
ENSTGUP00000012486  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010913  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010839  ..........TTA...S........AG.......TLLNYNLRP-......-............DVLS.IFL.....SP
ENSTGUP00000001856  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010839  ..........RPQ...PrsdtqqraNR.......FVLYLGNKNAs.....K............DYIG.MAV.....KD
ENSTGUP00000011307  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000005592  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000003709  ..........PKS...T........AT.......VFGLYSSADN......S............KYFE.FTVmgrm.SK
ENSTGUP00000000097  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010913  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000014278  ..........--K...Q........GG.......TLFGLYSKKDn.....T............RWLE.VSVvgk..IN
ENSTGUP00000012086  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000012081  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000010276  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000001099  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002570  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000013145  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000009567  ..........---...-........CG.......ILYFIDSKEM......Y............GTPA.VFLn....EE
ENSTGUP00000010913  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000002371  ..........---...-........--.......----------......-............----.---.....--
ENSTGUP00000012081  ..........---...-........--.......----------......-............----.---.....--


                             80                     90                     100                      
                              |                      |                       |                      
d1dyka1               ..GFPYFSYDL....GSG.........DTSTM....IPT.......KINDGQ...W...................HKI
ENSTGUP00000016927  ..---------....---.........-----....P--.......------...-...................---
ENSTGUP00000003709  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010031  ..-------D-....---.........-----....---.......------...-...................---
ENSTGUP00000001099  ..---------....---.........-----....-KT.......YFTDKK...T...................HLY
ENSTGUP00000011992  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014278  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014987  ..GKLLYDHQN....DGS.........TQALAsc..QRD.......FRNKPY...P...................VRV
ENSTGUP00000002371  ..---------....---.........--T--....---.......------...-...................---
ENSTGUP00000000385  ..GSLTYEHSK....DGR.........GTELAgc..SAD.......LRNQNH...D...................TFL
ENSTGUP00000007869  ..---------....---.........-----....---.......------...-...................-LV
ENSTGUP00000003849  ..---------....---.........-----....---.......------...-...................-LV
ENSTGUP00000003292  ..GYWVLRLQN....GGT.........YEALT....VPT.......SP----...-...................--V
ENSTGUP00000015979  ..------Q--....---.........-----....---.......------...-...................---
ENSTGUP00000016008  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000000111  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014546  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000006031  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000003669  ..RKVNFHMEY....SCG.........TAAIR....GNK.......ELAEGQ...-...................---
ENSTGUP00000005348  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000008609  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000017060  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000009828  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014507  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010199  ..---------....--N.........SHTNR....TEG.......GVSKGA...T...................VGV
ENSTGUP00000005117  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000008110  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000004907  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010725  ..---------....--G.........WEEIT....YEM.......PFGKGK...S...................FEI
ENSTGUP00000005437  ..GNLRVHYKG....HGK.........-----....---.......------...-...................---
ENSTGUP00000013465  ..SMFQNTWG-....--K.........EERTA....PRF.......PFEAGK...P...................FKL
ENSTGUP00000000911  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010911  ..RHLPFFRGC....T--.........-----....---.......------...-...................---
ENSTGUP00000010725  ..SYLHDSWG-....--E.........EEKEI....TNF.......PFSPGM...Y...................FEL
ENSTGUP00000008902  ..NPIELLIN-....---.........DKVAQ....LPL.......FISDGK...W...................HHI
ENSTGUP00000007890  ..---------....---.........-----....K--.......------...-...................---
ENSTGUP00000002179  ..GALIFSYNL....GSG.........IASIM....VNG.......SFSDGR...W...................HRV
ENSTGUP00000013613  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000009917  ..GRVRVSYDT....GSY.........PASAIy...SVE.......TINDGN...F...................HIV
ENSTGUP00000002689  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002179  ..RSLQFRFNC....GTG.........VGVIT....SEN.......KIKLGN...W...................HSV
ENSTGUP00000011992  ..GSLDLSLSV....DGK.........QQLVSv...EDV.......LLATGH...W...................KNI
ENSTGUP00000013892  ..GKIEIQFKN....EFG.........TKVTS....GGK.......AINDGL...W...................HIV
ENSTGUP00000004653  ..DEIRYHYRF....NGK.........MRTEV....FPY.......RLADGQ...W...................HRI
ENSTGUP00000005148  ..SPVFLFEDQ....NGKpape.....DYPLF....RTV.......NIADGK...W...................HRV
ENSTGUP00000006286  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000001570  ..GHVRLIYDT....LNSp........PTTVY....SVE.......TVNDGQ...F...................HSV
ENSTGUP00000008379  ..NKVLQYQH-....---.........-----....---.......------...-...................---
ENSTGUP00000006159  ..SPVFLYEDH....T-Gkpgpe....DYPLF....RGI.......NLADGK...W...................HRV
ENSTGUP00000012721  ..GAVSLVINL....GSGaf.......E--AIvep.VNG.......KFNDNA...W...................HDV
ENSTGUP00000009636  ..GRLELQLKY....SGI.........GRVTS....TGP.......LINHGM...W...................QTI
ENSTGUP00000005001  ..GKLSLHLNL....GDSnlhfsns..HTSVT....LGS.......LLDDQH...W...................HSV
ENSTGUP00000001754  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000001756  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000001267  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000000484  ..GKLSLLINL....GDTkthpsna..QINIT....LGS.......LLDDQH...W...................HSV
ENSTGUP00000007830  ..GQVQLKYST....GES.........STVVSpy..LPG.......GVSDGQ...W...................HTL
ENSTGUP00000002179  ..GYVEFRFDC....GSG.........TAVIR....SEE.......PVSLGQ...W...................HEL
ENSTGUP00000001495  ..EQLQLTFSA....GET.........TSTVSpf..VPG.......GVSDGQ...W...................HRV
ENSTGUP00000010031  ..NTLDLIYWV....DGF.........QNVISl...EDV.......DLADSQ...W...................KNL
ENSTGUP00000017400  ..GKVLFHVNN....GAG.........RITATyeprGTN.......SLCDGK...W...................HKL
ENSTGUP00000007223  ..GRLQYKFDC....GSG.........PGIVSv...QST.......QINDGQ...W...................HSI
ENSTGUP00000010276  ..GKVLFHVNN....GAG.........RITATyeprGTN.......SLCDGK...W...................HKL
ENSTGUP00000005926  ..GHLYLLLDM....GSG.........TIKIKa...LQK.......KVNDGE...W...................YHV
ENSTGUP00000004461  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000015340  ..---------....G--.........-----....---.......------...-...................---
ENSTGUP00000000813  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002366  ..---------....---.........-----....---.......PFIPDQ...P...................FRV
ENSTGUP00000016735  ..KPEEYRFYV....GGK.........FVTFR....--V.......PEGRRE...W...................EHV
ENSTGUP00000002833  ..AQLLLHISL....GSSplhaseg..HTTVA....VGS.......LLDDQH...W...................HSL
ENSTGUP00000003828  ..EQIQLTFSA....GET.........TTTVApf..IVG.......GVSDGQ...W...................HSV
ENSTGUP00000013533  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000001271  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010605  ..NPLELLIN-....---.........DKVAQ....LPL.......SLKDKA...W...................HHI
ENSTGUP00000001337  ..GWVLYVN--....--G.........KEKIT....DCP.......SVNDGN...W...................HHI
ENSTGUP00000005926  ..GRVKLTVNL....DCIrincnsskgPETLF....AGY.......NLNDNE...W...................HTV
ENSTGUP00000013493  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000005001  ..GRLMLLIQK....ETEn........PVEIS....EGT.......NLHDGL...W...................HSV
ENSTGUP00000012721  ..GYIHYVFDL....GNG.........PNVIKgn..SDR.......PLNDNQ...W...................HNV
ENSTGUP00000005926  ..GYLHYVFDL....GNG.........ANLIKgs..SNK.......PLNDNQ...W...................HNV
ENSTGUP00000012721  ..GNLYLLLDM....GSG.........TIKVKa...TQK.......KANDGE...W...................YHV
ENSTGUP00000000499  ..SEVAFSFDV....GNG.........PSEVVvq..SHN.......SLNDNQ...W...................HYV
ENSTGUP00000012721  ..GRVKLMVNL....DCIrincnaskgPETLY....AGQ.......KLNDNE...W...................HTV
ENSTGUP00000001856  ..TEVSFSFDV....GNG.........PVEIVvr..SPN.......PLNDDQ...W...................HRV
ENSTGUP00000001856  ..GNLQIRYNL....GGTke.......PYNIDi...DHR.......NMANGQ...P...................HTV
ENSTGUP00000012350  ..GQVTVKLNN....GIRdf.......STSVT....LKQ.......SLCDGR...W...................HRI
ENSTGUP00000013256  ..GKLWFQLDC....GSG.........PGILGi...SGR.......AVNDGS...W...................HSV
ENSTGUP00000001271  ..---------....---.........---LR....SPK.......FRQTGS...N...................CTL
ENSTGUP00000005001  ..KEITFSIDV....GNG.........PTEATvq..SPT.......ALNDNQ...W...................HYV
ENSTGUP00000013952  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000003772  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000011887  ..---------....---.........-----....---.......------...-...................F--
ENSTGUP00000002105  ..GRLRFSYNL....GGG.........TYKLT....TAK.......KVSDGQ...F...................HTA
ENSTGUP00000005926  ..GAVSLVINL....GSG.........AFEALvep.VNG.......KFNDNA...W...................HDV
ENSTGUP00000003312  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000006486  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000017417  ..---------....---.........-----....---.......------...W...................---
ENSTGUP00000002833  ..GQINVSIAQ....PGKk........KLEFA....AGH.......RLNDGF...W...................HSV
ENSTGUP00000005052  ..---------....---.........-----....---.......------...-...................H--
ENSTGUP00000000988  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000012350  ..GRLIFMFNA....GHQ.........KIRIK....SQE.......KYNDGR...W...................HNV
ENSTGUP00000012758  ..GKTLTFFNY....DYKgd.......FQTVTfe..G-Peir....KIFYGS...F...................HKL
ENSTGUP00000005462  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000006169  ..NEIRLHYRS....GSH.........RSHTEv...FPY.......ILADDK...W...................HRL
ENSTGUP00000002833  ..GSLQLRYQL....GTS.........PYVFTl...TNK.......PVTDGR...P...................HRV
ENSTGUP00000010134  ..GHVRVSYDP....GTH.........PSSAIy...SAE.......TINDGQ...F...................HTV
ENSTGUP00000013027  ..ASKVLSFFN....KDArge......VQTVTfdndDVK.......KIFYGS...F...................HKV
ENSTGUP00000012212  ..NCLIVTSLK....SKGk........GFQHC....VKY.......DFQPRK...W...................YMI
ENSTGUP00000017145  ..GKIEIQFKN....EFG.........TKVTS....GGK.......AINDGL...W...................HIV
ENSTGUP00000009339  ..GIPVLKMSH....GSG.........SVVLQfp..SHL.......NVADKK...W...................HRL
ENSTGUP00000012283  ..GVPSLTVSH....SSG.........ELFLQls..QKV.......NVADRR...W...................HNI
ENSTGUP00000010839  ..GKVIAAGNS....DAGef.......QASVI....PKK.......PLSDGR...W...................HTI
ENSTGUP00000009346  ..GLLVVSYNL....GDG.........NYSVSl...PSY.......HIDNGE...W...................HHI
ENSTGUP00000011096  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000004439  ..GYLHLSVQV....NNQ.........PQALLh...IPH.......NVSDGE...W...................HSV
ENSTGUP00000009346  ..GIPVLKMSH....GSG.........SVVLQfp..SHL.......NVADKK...W...................HRL
ENSTGUP00000013113  qmKSVEFSYKG....ADGrhq......TASFL....HLP.......FLFDSQ...W...................HKL
ENSTGUP00000003411  ..GQQQIIFYYte..PGSpss......YPAAT....FTV.......PTLLNQ...W...................TRF
ENSTGUP00000007370  ..---------....---.........HHSPY....LPV.......FRADGQ...W...................HHF
ENSTGUP00000010839  ..GRFVFSLGS....GEK.........QIKVK....TNI.......KYNDGQ...W...................HTV
ENSTGUP00000000911  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014074  ..GKTLTFFNY....DYKgd.......FQTVTfe..G-Peir....KIFYGS...F...................HKL
ENSTGUP00000012721  ..GRIQLQFSV....DCA.........ETTVV....TDK.......QVNDSS...W...................HFL
ENSTGUP00000003983  ..----LSYST....GER.........DRELA....VTV.......GSELGL...WvgghflsfplqqeaqgwlhHCV
ENSTGUP00000013002  ..ENKALEYNA....VGLtrdav....RVVFRsa..RVS.......DLFDRS...W...................HKI
ENSTGUP00000000499  ..GDLQIRYKL....DSHqdp......DVF-Si...SFK.......SMADGQ...L...................QHV
ENSTGUP00000009339  ..GLLVVSYNL....GDG.........NYSVSl...PSY.......HIDNGE...W...................HHI
ENSTGUP00000005926  ..GKIGVKFNV....GTD.........DIAIEe...MNA.......IINDGK...Y...................HVV
ENSTGUP00000005377  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000013614  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000015460  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002977  ..GILNIFLRT....GIVft.......QVDLW....LGL.......SYCDGK...W...................NEV
ENSTGUP00000011574  ..SRAAAVLAV....GSA.........QHRLA....APN.......VVVPGK...W...................LHL
ENSTGUP00000013208  ..EEKTLLFTT....TSLing......TQVITfatpHVK.......TLFDEG...W...................HQI
ENSTGUP00000003385  ..PRYFFSLKT....DRArk.......VTTIA....AHR.......SYLPNQ...W...................VHL
ENSTGUP00000002977  ..GRPYFLFDP....QKKgsav.....A--VTptndGGK.......VYNDNS...W...................HQV
ENSTGUP00000000499  ..GRIKINLHK....TGRv........LSDIA....TGA.......GLNNGQ...W...................HSV
ENSTGUP00000005001  ..GNLQVRYKL....SKD.........GLLIFti..DSG.......NFANRE...L...................HHV
ENSTGUP00000012283  ..GFFSVNFSL....GDK.........NHSLRm...RTL.......RINNGQ...W...................VLL
ENSTGUP00000003494  ..GKIIVYVG-....--H.........KRSVY....FDY.......NVHDGQ...W...................HNM
ENSTGUP00000000911  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000006192  ..DKLHFLFWSqeraGGW.........QTRVTf...PNV.......SLSDNQ...W...................HTL
ENSTGUP00000009636  ..YHSTKKVKQ....QFIimalen...TVV-Sr...LAI.......NLCDKK...E...................HSV
ENSTGUP00000002624  ..---------....---.........-----....--F.......DFKPQK...W...................YMV
ENSTGUP00000000797  ..GVPQLGYSCq...GSS.........SGNLS....SSR.......FVSDGE...W...................HSV
ENSTGUP00000013145  ..GRVVYSYNL....GSG.........TATII....SKP.......LDLTLN...V...................HII
ENSTGUP00000003828  ..SYVQFEVYS....GLSq........VASLKm...SQS.......RVSDGE...W...................HHI
ENSTGUP00000008611  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000015228  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000012725  ..GKIGVVFNI....GTV.........DISIKe...EST.......PVNDGK...Y...................HVV
ENSTGUP00000002105  ..GKVHYISDA....GVA.........GKVERni..PEV.......YVADGQ...W...................HSV
ENSTGUP00000013146  ..GTLKVVINL....GERi........SVPLMhr..KYF.......TCSDGR...W...................HFT
ENSTGUP00000010269  ..---------....---.........-----....---.......----G-...-...................---
ENSTGUP00000010196  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000007726  ..---------....---.........-----....--K.......KIFYGS...F...................HKV
ENSTGUP00000004439  ..GKLTMLAL-....--N.........SMKLL....GKH.......SVNDGN...F...................YLI
ENSTGUP00000017145  ..DSQKITVTI....GNI.........IIAQL....ESK.......KLCTPK...K...................VQV
ENSTGUP00000008485  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002833  ..RDVAFIFDI....GNGde.......NLTVR....SVV.......PWNDDE...W...................HQV
ENSTGUP00000007830  ..GLLSFMVSR....GSGr........STSLLl...DQL.......QLSDGK...W...................HDL
ENSTGUP00000013892  ..DSQKITVTI....GNI.........IVAQL....ESK.......KLCTPK...K...................VQV
ENSTGUP00000004439  ..SKLLFQLQS....GNS.........FYRLTla..SSV.......PVSDGK...W...................HRV
ENSTGUP00000007218  ..GQLSIEMS-....--P.........TDTVT....FPG.......NVVDGR...R...................HLI
ENSTGUP00000008492  ..GWVSIG---....---.........-----....---.......------...-...................---
ENSTGUP00000001272  ..---------....---.........SAVLR....TSV.......FLPTDE...E...................HLC
ENSTGUP00000007218  ..GILHAELKR....EDV.........GYPLLl...KGL.......RVVDGQ...W...................HKW
ENSTGUP00000003750  ..CRLVFLLRQ....DPSegksyk...PAEFHw...KLN.......QVCDKE...W...................HHY
ENSTGUP00000005281  ..CRLVFLLRK....DFD.........QADTF....RPAefhwkldQICDKE...W...................HYY
ENSTGUP00000000714  ..SHISVVLHYtal.GSY.........ITYIAkaa.VLK.......YLDEST...W...................VHI
ENSTGUP00000012350  ..GFLYLRYDF....GFSng.......PILLEdsm.KKA.......RINDAK...F...................HEI
ENSTGUP00000004160  ..GHLEFRFDL....GKG.........PALLR....SRE.......PVPLDT...W...................VSV
ENSTGUP00000003982  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002535  ..---------....---.........----S....---.......------...-...................---
ENSTGUP00000013650  ..CRISFLYWPll..ESArp.......VKFLW....KLE.......QVCDDE...W...................HHY
ENSTGUP00000002531  ..---------....---.........----S....---.......------...-...................---
ENSTGUP00000014137  ..SKLLFQLQS....GNS.........FYRLTla..SSV.......PVSDGK...W...................HRV
ENSTGUP00000010869  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000006581  ..RKVAVYTG-....--G.........KQPVS....FDY.......CVHNEQ...W...................HSF
ENSTGUP00000002535  ..----L----....---.........-----....---.......------...-...................---
ENSTGUP00000002531  ..----L----....---.........-----....---.......------...-...................---
ENSTGUP00000007218  ..SSLLVDIRT....GNGie.......GVSFL....SPQ.......PVTDGA...W...................HSV
ENSTGUP00000001266  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000016883  ..GRPEFRFDA....GSG.........MATIR....HPT.......ALRLGE...Y...................HTV
ENSTGUP00000012350  ..GAVVLNAS-....--G.........TKIQS....PDR.......NYNDGK...T...................HFI
ENSTGUP00000013146  ..GFTQLRYNL....GDR.........TVILQtl..QKV.......HTNGNT...W...................HLL
ENSTGUP00000012110  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000004798  ..GEGSVEFYSr...GNA.........MMKWK....ASF.......SPPGPY...W...................THV
ENSTGUP00000001382  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000012350  ..DNLVYIYNL....GGQ.........DVEIPlda.KPV.......STWPSH...F...................SII
ENSTGUP00000012081  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000000911  ..---------....---.........EKAVL....SSP.......DLYSEE...W...................SCV
ENSTGUP00000002977  ..KETMFYYRT....VNGlqp......PIKVM....TLG.......RILVKK...W...................IHL
ENSTGUP00000010839  ..GHTVFRYKL....HSEt........PEEVE....AKK.......TVNDGT...Y...................QQV
ENSTGUP00000012486  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010913  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010839  ..GSVTAKIR-....---.........DKEIK....LEK.......IYEDGS...M...................HYV
ENSTGUP00000001856  ..---------....---.........-----....---.......-LNDGQ...W...................HEV
ENSTGUP00000010839  ..GYLTCVYNL....GGG.........DGEVRvq..SLV.......TQSDTEeavM...................DQV
ENSTGUP00000011307  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000005592  ..---------....---.........QWMIL....PLP.......EILDRF...W...................FQI
ENSTGUP00000003709  ..AVLRYLKSD....GRL.........NSVIF....SNI.......QLADGK...P...................HAV
ENSTGUP00000000097  ..-------S-....---.........-----....---.......------...-...................---
ENSTGUP00000010913  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000014278  ..KVLVRYLRE....DNK.........VHSVNl...QHA.......QVADGQ...S...................HSV
ENSTGUP00000012086  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000012081  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000010276  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000001099  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000002570  ..---------....---.........-----....-GD.......LIVEGQ...W...................HHL
ENSTGUP00000013145  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000009567  ..GYVHIQMHL....VRGd........DLAVK....TSF.......SLPLKQ...W...................FRL
ENSTGUP00000010913  ..-------K-....---.........-----....---.......------...-...................---
ENSTGUP00000002371  ..---------....---.........-----....---.......------...-...................---
ENSTGUP00000012081  ..-R-------....---.........-----....---.......------...-...................---


                                   110                                                              
                                     |                                                              
d1dyka1               KIVRVK.........Q................EGILYV..........DD.......................A....
ENSTGUP00000016927  ------.........-................------..........--.......................-....
ENSTGUP00000003709  ------.........-................------..........--.......................-....
ENSTGUP00000010031  ------.........-................------..........--.......................-....
ENSTGUP00000001099  TLVLNPd........N................SFEILV..........DQ.......................T....
ENSTGUP00000011992  ------.........-................------..........--.......................-....
ENSTGUP00000014278  ------.........-................------..........--.......................-....
ENSTGUP00000014987  KITYYQ.........K................TLTVLI..........NN.......................G....
ENSTGUP00000002371  ------.........-................------..........--.......................-....
ENSTGUP00000000385  AVRYSR.........G................RLTVMT..........DV.......................Ed...
ENSTGUP00000007869  VLDMDE.........G................TLSFMV..........DG.......................Q....
ENSTGUP00000003849  VLDMDD.........G................TLSFIV..........DG.......................Q....
ENSTGUP00000003292  TLSVRP.........R................RVGIFL..........DY.......................Eag..
ENSTGUP00000015979  ------.........-................------..........--.......................-....
ENSTGUP00000016008  ------.........-................------..........--.......................-....
ENSTGUP00000000111  ------.........-................------..........--.......................-....
ENSTGUP00000014546  -V----.........-................------..........--.......................-....
ENSTGUP00000006031  ------.........-................-----V..........DN.......................Nl...
ENSTGUP00000003669  ------.........-................------..........--.......................-....
ENSTGUP00000005348  ------.........-................------..........--.......................-....
ENSTGUP00000008609  ------.........-................------..........--.......................-....
ENSTGUP00000017060  ------.........-................------..........--.......................-....
ENSTGUP00000009828  ------.........-................------..........--.......................-....
ENSTGUP00000014507  ------.........-................------..........--.......................-....
ENSTGUP00000010199  LLDLNK.........H................NLTFYI..........NG.......................Q....
ENSTGUP00000005117  ------.........-................------..........--.......................-....
ENSTGUP00000008110  ------.........-................------..........--.......................-....
ENSTGUP00000004907  ------.........-................------..........--.......................-....
ENSTGUP00000010725  VIMILK.........D................KFQVTV..........NK.......................K....
ENSTGUP00000005437  ------.........-................------..........--.......................-....
ENSTGUP00000013465  QILCET.........D................HFKVAV..........ND.......................A....
ENSTGUP00000000911  ------.........-................------..........--.......................-....
ENSTGUP00000010911  ------.........-................------..........--.......................-....
ENSTGUP00000010725  IIFCDA.........Y................QFKVAV..........NG.......................Vh...
ENSTGUP00000008902  CITWTTrd.......G................MWEAFQ..........DG.......................Gk...
ENSTGUP00000007890  ------.........-................------..........--.......................-....
ENSTGUP00000002179  KAVRDG.........Q................SGKVTV..........DD.......................Yg...
ENSTGUP00000013613  ------.........-................------..........--.......................-....
ENSTGUP00000009917  ELLAMD.........Q................ILSLSI..........DG.......................Gs...
ENSTGUP00000002689  ------.........-................------..........--.......................-....
ENSTGUP00000002179  TLFRDG.........V................NGWLRM..........DN.......................Na...
ENSTGUP00000011992  TLFVQE.........D................RAQLYV..........GC.......................Ek...
ENSTGUP00000013892  SVEELE.........H................SISVKI..........AK.......................E....
ENSTGUP00000004653  AVSLSA.........S................HLLLHV..........DC.......................Nr...
ENSTGUP00000005148  AISVEK.........K................SVTMIV..........DC.......................Nkk..
ENSTGUP00000006286  ------.........-................------..........--.......................-....
ENSTGUP00000001570  ELVMLN.........Q................TLNLVV..........DK.......................Ga...
ENSTGUP00000008379  ------.........-................------..........--.......................-....
ENSTGUP00000006159  ALSVQK.........K................NVTLVL..........DC.......................Kkk..
ENSTGUP00000012721  KVTRNL.........R................QVTISV..........DG.......................Il...
ENSTGUP00000009636  SVEELE.........S................NLIIKV..........NR.......................D....
ENSTGUP00000005001  LIERFN.........K................QVNFTV..........DK.......................H....
ENSTGUP00000001754  ------.........-................------..........--.......................-....
ENSTGUP00000001756  ------.........-................------..........--.......................-....
ENSTGUP00000001267  ------.........-................------..........--.......................-....
ENSTGUP00000000484  LIEHFN.........N................QVNFTV..........DK.......................H....
ENSTGUP00000007830  QLRYYN.........KpkvstlgvvqgpskdkVAILTI..........DEcdasvalqfgseignys......C....
ENSTGUP00000002179  RVSRTA.........K................NGILQV..........DK.......................Qk...
ENSTGUP00000001495  QLHYYN.........KpavgrlgvpqgpseqkVAVVTV..........DDcdtamalrfgprlgnys......C....
ENSTGUP00000010031  TVQITG.........E................NYNLYV..........GC.......................Dl...
ENSTGUP00000017400  QANKSK.........H................HISLII..........DG.......................Nl...
ENSTGUP00000007223  SLEVDG.........N................YARLVL..........DR.......................Vh...
ENSTGUP00000010276  QANKSK.........H................HISLII..........DG.......................Nl...
ENSTGUP00000005926  DFQRDG.........R................SGTISV..........NT.......................L....
ENSTGUP00000004461  ------.........-................------..........--.......................-....
ENSTGUP00000015340  ------.........-................------..........--.......................-....
ENSTGUP00000000813  ------.........-................------..........--.......................-....
ENSTGUP00000002366  EILCEH.........P................RFRIFV..........DG.......................Hql..
ENSTGUP00000016735  CASWESat.......G................IAEFWL..........NG.......................K....
ENSTGUP00000002833  HIERLG.........H................YVNLTL..........DG.......................E....
ENSTGUP00000003828  QVQYYN.........KpnigrlgiphgpsgekVAVVTV..........DDcdtavavrfgslignyt......C....
ENSTGUP00000013533  ------.........H................YWELSI..........DR.......................Y....
ENSTGUP00000001271  ------.........-................------..........--.......................-....
ENSTGUP00000010605  CVAWTTrd.......G................KWSAYQ..........DG.......................Eq...
ENSTGUP00000001337  AVTWTCrd.......G................AWKVYI..........DG.......................Klsd.
ENSTGUP00000005926  RVVRRG.........K................GLKLMV..........DD.......................Qq...
ENSTGUP00000013493  ------.........-................------..........--.......................-....
ENSTGUP00000005001  NINARR.........H................RITLTL..........DN.......................D....
ENSTGUP00000012721  VITRDNs........N................THSLKV..........DT.......................K....
ENSTGUP00000005926  MISRDTn........N................LHTVKI..........DT.......................K....
ENSTGUP00000012721  DIQRDG.........R................SGTISV..........NS.......................R....
ENSTGUP00000000499  KAERNV.........K................EASLQI..........DQ.......................Lpq..
ENSTGUP00000012721  RVVRRG.........K................SLKLIV..........DD.......................D....
ENSTGUP00000001856  NAERNV.........K................QASLQV..........DQ.......................Lpl..
ENSTGUP00000001856  NVTRNG.........R................DIVLQL..........DH.......................Ypp..
ENSTGUP00000012350  AVIRDA.........N................VVQLDV..........DS.......................E....
ENSTGUP00000013256  FLELNR.........N................FTSLSL..........DD.......................Sy...
ENSTGUP00000001271  SFWYYNygesvga..A................ELQLLV..........DG.......................Lgqp.
ENSTGUP00000005001  RAERNL.........K................ETSLQV..........DN.......................Lpk..
ENSTGUP00000013952  ------.........-................------..........--.......................-....
ENSTGUP00000003772  ------.........-................------..........--.......................-....
ENSTGUP00000011887  ------.........-................------..........--.......................-....
ENSTGUP00000002105  IARRAG.........M................AASLTV..........DScsedqepgy..............C....
ENSTGUP00000005926  KVTRNL.........Rqhsgighamvnklhc.SVTISV..........DG.......................Il...
ENSTGUP00000003312  ----R-.........-................------..........--.......................-....
ENSTGUP00000006486  ------.........-................------..........--.......................-....
ENSTGUP00000017417  ------.........-................------..........--.......................-....
ENSTGUP00000002833  HLVARE.........G................SAVVTI..........DD.......................D....
ENSTGUP00000005052  ------.........-................------..........--.......................-....
ENSTGUP00000000988  ------.........-................------..........--.......................-....
ENSTGUP00000012350  IFIRGK.........N................IGRLII..........DG.......................Lr...
ENSTGUP00000012758  HVVISK.........T................TAKIIV..........DC.......................K....
ENSTGUP00000005462  ------.........-................------..........--.......................-....
ENSTGUP00000006169  SLAISA.........S................HLILHV..........DC.......................Nk...
ENSTGUP00000002833  NITRLH.........R................TLYTQV..........DY.......................L....
ENSTGUP00000010134  ELVTFD.........Q................MVNLSI..........DG.......................Gs...
ENSTGUP00000013027  HIVVTS.........S................NVKIYI..........DC.......................S....
ENSTGUP00000012212  SIVHIYnrwrn....S................EIRCYV..........NG.......................Ql...
ENSTGUP00000017145  SVEELE.........H................SISVKI..........AK.......................E....
ENSTGUP00000009339  EVRTNG.........Q................AVRFTL..........DGcsaaalseiegvgrwlstedrtnC....
ENSTGUP00000012283  KIINDG.........K................AMKLIL..........DN.......................Cm...
ENSTGUP00000010839  AVSQKE.........N................TVQLEV..........GT.......................Q....
ENSTGUP00000009346  TLERNE.........N................EFTLRLye........GG.......................Gk...
ENSTGUP00000011096  ------.........-................------..........--.......................-....
ENSTGUP00000004439  EVTLAR.........A................VILNLL..........DS.......................S....
ENSTGUP00000009346  EVRTNGq........V................NIYLLA..........NAvtglikrtgrpqpfvlgsvqev.E....
ENSTGUP00000013113  MIIVEA.........N................SVTLFI..........DC.......................I....
ENSTGUP00000003411  AISVEE.........E................EVVLYL..........DC.......................Eehe.
ENSTGUP00000007370  CVTWQQen.......G................TWAIYA..........DG.......................Krra.
ENSTGUP00000010839  VFSTDG.........K................NARLVV..........DG.......................L....
ENSTGUP00000000911  ------.........-................------..........--.......................-....
ENSTGUP00000014074  HVVISK.........T................TAKIII..........DC.......................K....
ENSTGUP00000012721  MVSRNH.........L................RTVLVL..........DG.......................E....
ENSTGUP00000003983  TWASPE.........G................RASLWL..........NG.......................A....
ENSTGUP00000013002  ALSIQS.........K................AVSLYI..........DC.......................K....
ENSTGUP00000000499  KINREE.........E................TLFVEV..........NQ.......................N....
ENSTGUP00000009339  TLERNE.........N................EFTLRLye........GG.......................Gk...
ENSTGUP00000005926  RFTRSG.........G................NATLQV..........DN.......................W....
ENSTGUP00000005377  ------.........-................------..........--.......................-....
ENSTGUP00000013614  ------.........-................------..........--.......................-....
ENSTGUP00000015460  ------.........-................------..........--.......................-....
ENSTGUP00000002977  TMSKEG.........S................VISATM..........NE.......................Lr...
ENSTGUP00000011574  CGTWSSen.......G................SAALWA..........QG.......................El...
ENSTGUP00000013208  RLLVAE.........D................FVTLYI..........DG.......................Q....
ENSTGUP00000003385  AATYDG.........R................LMRLYV..........NG.......................Aqv..
ENSTGUP00000002977  IATRTQ.........A................LGNITV..........DG.......................Qy...
ENSTGUP00000000499  SLSVKR.........S................RISVRV..........DN.......................D....
ENSTGUP00000005001  KINREG.........R................ELVIQV..........DQ.......................V....
ENSTGUP00000012283  TMERYN.........N................EFTLRV..........NS.......................Gggd.
ENSTGUP00000003494  AINIRG.........Q................TVTLFT..........SC.......................Gkrr.
ENSTGUP00000000911  ------.........-................------..........--.......................-....
ENSTGUP00000006192  ILAVSG.........Q................SFSLTV..........DC.......................Sipk.
ENSTGUP00000009636  DVLVKK.........D................HLSLRV..........DG.......................Kag..
ENSTGUP00000002624  TIVHIYnrwkn....S................ELRCYV..........NG.......................El...
ENSTGUP00000000797  FLEVKN.........N................SVRLLI..........DG.......................Lg...
ENSTGUP00000013145  HLGRNL.........Q................KGWLKV..........DD.......................Qk...
ENSTGUP00000003828  LVELKSakdgkdlk.Y................LAVMSL..........DY.......................Gm...
ENSTGUP00000008611  ------.........-................------..........--.......................-....
ENSTGUP00000015228  ------.........-................------..........--.......................-....
ENSTGUP00000012725  RFTRNG.........G................NATLQV..........DS.......................W....
ENSTGUP00000002105  LLEKNG.........S................ATILSV..........DR.......................Ths..
ENSTGUP00000013146  TVVQNQ.........T................CIKVYL..........DE.......................Elil.
ENSTGUP00000010269  ------.........-................------..........--.......................-....
ENSTGUP00000010196  ------.........-................------..........--.......................-....
ENSTGUP00000007726  HVAVSH.........S................KVKLYV..........DC.......................K....
ENSTGUP00000004439  TLKIEP.........N................KMELFQ..........SS.......................H....
ENSTGUP00000017145  GLLVTK.........Q................ELELAV..........DS.......................Htdr.
ENSTGUP00000008485  ------.........-................------..........--.......................-....
ENSTGUP00000002833  KAELNV.........K................LARLRV..........DK.......................Lpw..
ENSTGUP00000007830  QLELRDvhsgrdsr.Y................VITLTL..........DF.......................Gl...
ENSTGUP00000013892  GLLVTK.........Q................ELELAV..........DS.......................Htdr.
ENSTGUP00000004439  MVSMVEplsqs....S................RWYMDI..........DS.......................Krdt.
ENSTGUP00000007218  ALSFQGg........S................VGALQS..........DS.......................F....
ENSTGUP00000008492  ------.........-................------..........--.......................-....
ENSTGUP00000001272  QIR---.........-................------..........--.......................-....
ENSTGUP00000007218  EVVVHSt........V................QLKLWH..........GS.......................Ceagv
ENSTGUP00000003750  VVNVEF.........P................AVSLYV..........DG.......................V....
ENSTGUP00000005281  VVNVEF.........P................VVTLYM..........DG.......................Ttye.
ENSTGUP00000000714  LITLDE.........S................IIEFYM..........DG.......................I....
ENSTGUP00000012350  SIIYHNs........K................KMILVV..........DR.......................Rh...
ENSTGUP00000004160  RLERSG.........R................KGVLRV..........NG.......................Gp...
ENSTGUP00000003982  ------.........-................------..........--.......................-....
ENSTGUP00000002535  ------.........-................------..........--.......................-....
ENSTGUP00000013650  ALNLEF.........P................TVTLYV..........DG.......................Vsyd.
ENSTGUP00000002531  ------.........-................------..........--.......................-....
ENSTGUP00000014137  MVSMVEplsqs....S................RWYMDI..........DS.......................Krdt.
ENSTGUP00000010869  ------.........-................------..........--.......................-....
ENSTGUP00000006581  AIGIGD.........K................TVSLFA..........EC.......................Gnk..
ENSTGUP00000002535  ------.........-................------..........--.......................-....
ENSTGUP00000002531  ------.........-................------..........--.......................-....
ENSTGUP00000007218  SVSMEEpaals....S................RWLLRL..........DG.......................Av...
ENSTGUP00000001266  ------.........-................------..........--.......................-....
ENSTGUP00000016883  RLLRNL.........T................WGSLGL..........DG.......................Hp...
ENSTGUP00000012350  ITSVTP.........E................RYELTV..........DD.......................K....
ENSTGUP00000013146  NAGRVG.........N................EGYLDL..........DG.......................I....
ENSTGUP00000012110  ------.........-................------..........--.......................-....
ENSTGUP00000004798  LFTWRSr........E................GLKVYV..........NG.......................S....
ENSTGUP00000001382  ------.........-................----F-..........--.......................-....
ENSTGUP00000012350  KIERIG.........R................HGKMFLtvpslsstaeE-.......................Kf...
ENSTGUP00000012081  ------.........-................------..........--.......................-....
ENSTGUP00000000911  RL----.........-................------..........--.......................-....
ENSTGUP00000002977  SVQVHH.........T................RISFFL..........NG.......................Weddn
ENSTGUP00000010839  FFAVAW.........S................AAR---..........NL.......................Ya...
ENSTGUP00000012486  ------.........-................------..........--.......................-....
ENSTGUP00000010913  ------.........-................------..........--.......................-....
ENSTGUP00000010839  TVIKTG.........N................RIHMMV..........DD.......................E....
ENSTGUP00000001856  RFLAKE.........N................FAVLTI..........DG.......................D....
ENSTGUP00000010839  TFERIYqyaklryikA................ATSISP..........DY.......................Es...
ENSTGUP00000011307  ------.........-................------..........--.......................-....
ENSTGUP00000005592  TASWEEg........S................------..........--.......................-....
ENSTGUP00000003709  ILWLSGlqqgl....S................TVELYL..........DC.......................L....
ENSTGUP00000000097  ------.........-................------..........--.......................-....
ENSTGUP00000010913  ------.........-................------..........--.......................-....
ENSTGUP00000014278  IVRLSGlrrdt....L................SVELYV..........DC.......................K....
ENSTGUP00000012086  ------.........-................---VQV..........DE.......................D....
ENSTGUP00000012081  ------.........P................------..........--.......................-....
ENSTGUP00000010276  -----K.........R................KGTIIV..........DG.......................Qd...
ENSTGUP00000001099  ------.........-................------..........--.......................-....
ENSTGUP00000002570  VLVMSKgmlkn....S................TAALYL..........DG.......................Q....
ENSTGUP00000013145  ------.........-................------..........DG.......................Npp..
ENSTGUP00000009567  DLSFKG.........G................QVSLLL..........NY.......................K....
ENSTGUP00000010913  ------.........-................------..........--.......................-....
ENSTGUP00000002371  ------.........-................------..........--.......................-....
ENSTGUP00000012081  ------.........-................------..........--.......................-....


                      120                                                130             140       1
                        |                                                  |               |        
d1dyka1               ..SSQTI.......SPKK..A................................DILDVVGI......LYVGGLPINYT
ENSTGUP00000016927  ..-----.......----..-................................--------......-----------
ENSTGUP00000003709  ..-----.......----..-................................--------......-----------
ENSTGUP00000010031  ..-----.......----..-................................--------......-----------
ENSTGUP00000001099  ..VVNSG.......N---..-................................--------......-----------
ENSTGUP00000011992  ..-----.......----..-................................--------......-----------
ENSTGUP00000014278  ..-----.......----..-................................--------......-----------
ENSTGUP00000014987  ..-----.......----..-................................--------......-----------
ENSTGUP00000002371  ..-----.......----..-................................--------......-----------
ENSTGUP00000000385  ..KNEWK.......NCID..I................................AGVQLPTG......YFFGA------
ENSTGUP00000007869  ..Y----.......----..-................................--------......-----------
ENSTGUP00000003849  ..Y----.......----..-................................--------......-----------
ENSTGUP00000003292  ..EISFY.......NVSD..R................................SHIYTFTD......KFSGNLRPLFF
ENSTGUP00000015979  ..-----.......----..-................................--------......-----------
ENSTGUP00000016008  ..-----.......----..-................................--------......-----------
ENSTGUP00000000111  ..-----.......----..-................................--------......-----------
ENSTGUP00000014546  ..-----.......----..-................................--------......-----------
ENSTGUP00000006031  ..LHNGE.......VNGS..F................................PQCNNAPK......YQIGE------
ENSTGUP00000003669  ..-----.......----..-................................--------......-----------
ENSTGUP00000005348  ..-----.......----..-................................--------......-----------
ENSTGUP00000008609  ..-----.......----..-................................--------......-----------
ENSTGUP00000017060  ..-----.......----..-................................--------......-----------
ENSTGUP00000009828  ..-----.......----..-................................--------......-----------
ENSTGUP00000014507  ..-----.......----..-................................--------......-----------
ENSTGUP00000010199  ..-----.......----..-................................--------......-----------
ENSTGUP00000005117  ..-----.......----..-................................--------......-----------
ENSTGUP00000008110  ..-----.......----..-................................--------......-----------
ENSTGUP00000004907  ..-----.......----..-................................--------......---G-------
ENSTGUP00000010725  ..-----.......----..-................................--------......-----------
ENSTGUP00000005437  ..-----.......----..-................................--------......-----------
ENSTGUP00000013465  ..HLLQY.......NFRE..K................................RLNEV-TK......LCIGG------
ENSTGUP00000000911  ..-----.......----..-................................--------......-----------
ENSTGUP00000010911  ..-----.......----..-................................--------......-----------
ENSTGUP00000010725  ..T----.......----..-................................--------......-----------
ENSTGUP00000008902  ..LGTGE.......NLAP..W................................HPIKPGGV......LILGQEQDTVG
ENSTGUP00000007890  ..-----.......----..-................................--------......-----------
ENSTGUP00000002179  ..ARTGK.......SPGK..M................................RQLNINGD......LYVGGMKEIAL
ENSTGUP00000013613  ..-----.......----..-................................--------......-----------
ENSTGUP00000009917  ..PKTIT.......NLSK..Q................................STLNFDSP......LYVGGMPVKNN
ENSTGUP00000002689  ..-----.......----..-................................--------......-----------
ENSTGUP00000002179  ..PVTGK.......SQGQ..Y................................SKITFQTP......FYIGGAPSVYW
ENSTGUP00000011992  ..MENAE.......LDIP..I................................QNIFTRDLassar.LRI--------
ENSTGUP00000013892  ..AVMSI.......NSPG..T................................LFKQSQGFletk..VYIAGLPRRVG
ENSTGUP00000004653  ..IYERV.......IDPP..E................................TNLTPESN......LWLG-------
ENSTGUP00000005148  ..ATKPL.......DRSD..K................................TVVDTNGI......TVFG-------
ENSTGUP00000006286  ..-----.......----..-................................--------......-----------
ENSTGUP00000001570  ..PKSLG.......KLQK..Q................................SSVSLNTP......LYIGGIPTSTG
ENSTGUP00000008379  ..-----.......----..-................................--------......-----------
ENSTGUP00000006159  ..ITKFL.......DRSE..H................................PIIDVNGI......IVFG-------
ENSTGUP00000012721  ..TTTGY.......TQED..Y................................TMLGSDDF......FYVGGSPSTAD
ENSTGUP00000009636  ..AVMKI.......AVSG..N................................LFTLDKGVyhln..LTVGGIPFKTK
ENSTGUP00000005001  ..TQHFR.......TKGD..S................................DHLDIDYE......LSFGGIPVPGK
ENSTGUP00000001754  ..-----.......----..-................................--------......-----------
ENSTGUP00000001756  ..-----.......----..-................................--------......-----------
ENSTGUP00000001267  ..-----.......----..-................................--------......-----------
ENSTGUP00000000484  ..THHFH.......AKGE..F................................SYLDLDYE......LSFGGIPVPGK
ENSTGUP00000007830  ..AAEGV.......QTSS..K................................KSLDLTGP......LLLGGVPNLPE
ENSTGUP00000002179  ..PVEGM.......AEGA..F................................TQIKCSSE......IFIGGVPNYDD
ENSTGUP00000001495  ..AAQGT.......QTGS..K................................KSLDLTGP......LLLGGVPTLPE
ENSTGUP00000010031  ..I-DSF.......ILEEpfY................................EQLKAESSr.....LYVA-------
ENSTGUP00000017400  ..VHTDN.......PYVH..S................................TSADTNNP......IYVGGYPADVK
ENSTGUP00000007223  ..TASGT.......APGT..L................................RTLNLDNH......VFFGGHIRQQG
ENSTGUP00000010276  ..VHTDN.......PYVH..S................................TSADTNNP......IYVGGYPADVK
ENSTGUP00000005926  ..RTPYT.......APGE..S................................EILDLDDD......LYLGGLPENKA
ENSTGUP00000004461  ..-----.......----..-................................--------......-----------
ENSTGUP00000015340  ..-----.......----..-................................--------......-----------
ENSTGUP00000000813  ..-----.......----..-................................--------......-----------
ENSTGUP00000002366  ..F----.......----..-................................--------......-----------
ENSTGUP00000016735  ..PWPRK.......GLQR..G................................YTVGATAS......ILLGQEQDSFG
ENSTGUP00000002833  ..VKRFR.......CRGT..F................................DQLDLETE......VFFGGVIDHDK
ENSTGUP00000003828  ..AAQGT.......QTGS..K................................KSLDLTG-......PLLGGVPNLPE
ENSTGUP00000013533  ..DNHPD.......PAFG..V................................ARIDVLKD......AMLGKD-----
ENSTGUP00000001271  ..-----.......----..-................................--------......-----------
ENSTGUP00000010605  ..RGAGE.......NLAS..W................................HSIRPQGI......IILGQEQDTLG
ENSTGUP00000001337  ..GGSGL.......SVGSk.I................................PGILGGGA......LVLGQEQDQKG
ENSTGUP00000005926  ..AVTGQ.......MAGD..H................................TRLEFHN-......IETGIITERR-
ENSTGUP00000013493  ..-----.......----..-................................--------......-----------
ENSTGUP00000005001  ..AATAS.......HATT..V................................SRMYSGNT......YYFGGCPDNFT
ENSTGUP00000012721  ..VVTQV.......ING-..A................................KNLDLKGD......LYIAGLAQGMY
ENSTGUP00000005926  ..-ITTQ.......STAG..A................................RNLDLKSD......LYIGGVAKEMF
ENSTGUP00000012721  ..RTPFT.......ASGE..S................................EILDLEGD......MYLGGLPENRA
ENSTGUP00000000499  ..RSQSA.......PPDG..H................................IRLQLNSQ......LFVG-------
ENSTGUP00000012721  ..VAEGT.......MVGD..H................................TRLEFHN-......IETGIMTEKR-
ENSTGUP00000001856  ..EVRKA.......PTEG..H................................TRLELYSQ......LYVGA------
ENSTGUP00000001856  ..TSYSL.......PATS..D................................IQFNSPKA......LFLGKVIEIGK
ENSTGUP00000012350  ..VNHVV.......GPLN..P................................KATDHREP......VFIGGVPESLL
ENSTGUP00000013256  ..VERRK.......APLY..F................................QTLGTDSS......VYFGAQVQVDN
ENSTGUP00000001271  ..TVLWR.......TYYN..E................................GNQWLKAV......IQLGRLPHPFQ
ENSTGUP00000005001  ..KVLEA.......PAEG..H................................FRLQLNSQ......LFVG-------
ENSTGUP00000013952  ..-----.......----..-................................--------......-----------
ENSTGUP00000003772  ..-----.......----..-................................--------......-----------
ENSTGUP00000011887  ..-----.......----..-................................--------......-----------
ENSTGUP00000002105  ..TVSSV.......AVST..D................................WTLDVQPNr.....VTVGGIRSVEP
ENSTGUP00000005926  ..TTTGY.......TQED..Y................................TMLGSDDF......FYVGGSPSTAD
ENSTGUP00000003312  ..-----.......----..-................................--------......-----------
ENSTGUP00000006486  ..-----.......----..-................................--------......-----------
ENSTGUP00000017417  ..-----.......----..-................................--------......-----------
ENSTGUP00000002833  ..DGAEF.......RVAH..P................................FQLRTGSQ......YFFGGCPKPAS
ENSTGUP00000005052  ..-----.......----..-................................--------......-----------
ENSTGUP00000000988  ..-----.......----..-................................--------......-----------
ENSTGUP00000012350  ..VLEES.......FDGN..A................................NSWQVTKP......LYIGGVAPGKA
ENSTGUP00000012758  ..EVGEK.......TINA..A................................GNISSDGI......EVLGRMVRSRG
ENSTGUP00000005462  ..-----.......----..-................................--------......-----------
ENSTGUP00000006169  ..IYERV.......VEKP..F................................MDLPLGTT......FWLG-------
ENSTGUP00000002833  ..PIMEQ.......QFSL..F................................VDSKLDSPkn....LYLGRVMETGV
ENSTGUP00000010134  ..PMTMD.......NSGK..H................................YTLNSEAP......LYVGGMPVDVN
ENSTGUP00000013027  ..EIMEK.......PIKE..A................................GNITTDGY......EILGKLLKGDR
ENSTGUP00000012212  ..VSYGD.......MAWH..V................................NTNDSYDK......CFLGS------
ENSTGUP00000017145  ..AVMSI.......NSPG..T................................LFKQSQGFletk..VYIAGLPRRVG
ENSTGUP00000009339  ..QVLGS.......VPRR..A................................RYLNVNPV......LQLGGVKESLP
ENSTGUP00000012283  ..NVSVR.......DDGR..Vtkkisqmdlsvceasgeivgsqsmg.......KLFSGHQP......LQLGGVKKTLP
ENSTGUP00000010839  ..SNYTT.......VLQP..S................................PPRRVYQP......LYFGKIPANLD
ENSTGUP00000009346  ..REITK.......AAGI..Y................................KEIVIDPSs.....LVLGNT-----
ENSTGUP00000011096  ..-----.......----..-................................--------......-----------
ENSTGUP00000004439  ..CVESC.......LNKT..S................................AKIDNEPVmfafqsTYLGGLPVGNS
ENSTGUP00000009346  ..AEMGA.......AGAS..W................................VYLNVNPV......LQLGGVKESLP
ENSTGUP00000013113  ..KIESL.......NIKP..K................................GKINTDGF......AVLGKLKNNPQ
ENSTGUP00000003411  ..RVRFE.......RSPD..E................................MELEEGSG......LFVAQ------
ENSTGUP00000007370  ..S--ASglcpv..GPSA..P................................QAIFGQGT......FIIGQDQDSLG
ENSTGUP00000010839  ..RSQHR.......KLVT..N................................SAINIRPP......VYVGGLPPLKR
ENSTGUP00000000911  ..-----.......----..-................................--------......-----------
ENSTGUP00000014074  ..EVGEK.......TINA..A................................GNISSDGI......EVLG-------
ENSTGUP00000012721  ..AKPGE.......VRPQ..R................................QYMNIVSD......LFIGGVPLDIR
ENSTGUP00000003983  ..AGQAQ.......SVQK..G................................YVSRAGGT......LLLGKARDALL
ENSTGUP00000013002  ..LVQVL.......PIEE..R................................ENIDIQGK......TVIGKRLY---
ENSTGUP00000000499  ..ERMKF.......ILSS..G................................TELNAIKS......LTLGKILENSD
ENSTGUP00000009339  ..REITK.......AAGI..Y................................KEIVIDPSs.....LVLGNTYPFNQ
ENSTGUP00000005926  ..PIIER.......YPAG..NndnerlaiarqripyrlgrvvdewlldkgrqlTIFNSQAT......IKIGG------
ENSTGUP00000005377  ..-----.......----..-................................--------......-----------
ENSTGUP00000013614  ..-----.......----..-................................--------......-----------
ENSTGUP00000015460  ..-----.......----..-................................---N----......-----------
ENSTGUP00000002977  ..EQALE.......--PR..V................................QQLQVNSP......VYVGGIPPEIQ
ENSTGUP00000011574  ..AASAW.......DVAG..A................................HTIPDGGI......LQLGQEKNGCC
ENSTGUP00000013208  ..EIETK.......PLHP..V................................LGIYISGL......TQIGKYS----
ENSTGUP00000003385  ..ATSGE.......QVGS..I................................FSLLTLKCkv....LMLGG------
ENSTGUP00000002977  ..TGSSL.......ATSG..S................................TIIGENTG......VFVGGLPQGYT
ENSTGUP00000000499  ..VTTSA.......HAFI..P................................LQIYS-DV......FYFGGCPSSGN
ENSTGUP00000005001  ..LKLKH.......NFSE..I................................DFKAIKS-......LTLGKVTDSLS
ENSTGUP00000012283  ..QEVTS.......VLGV..N................................RWFEMDWAs.....IVLGNRLP---
ENSTGUP00000003494  ..VHADL.......HFKK..D................................EALDPHGS......FLFGK------
ENSTGUP00000000911  ..-----.......----..-................................--------......--------V--
ENSTGUP00000006192  ..DVVVE.......TPFP..A................................SLSVRRAS......FYLG-------
ENSTGUP00000009636  ..ESELS.......ISEL..E................................DSLSILESslqstkTYVGGLRDVPV
ENSTGUP00000002624  ..ASYGE.......ITWF..V................................NTSDTFDK......CFLGS------
ENSTGUP00000000797  ..NASLQ.......LPGT..C................................GISQGRRD......LIFGGLRQSLQ
ENSTGUP00000013145  ..NKTVT.......SPGR..L................................VGLNVFSQ......FYLGGYREYTP
ENSTGUP00000003828  ..YQSTV.......QIGN..Q................................LPGLKMKS......IIVGGVSGDQ-
ENSTGUP00000008611  ..-----.......----..-................................--------......-----------
ENSTGUP00000015228  ..-----.......----..-................................--------......-----------
ENSTGUP00000012725  ..PVNEH.......YPTG..NtdserfqmvkqkipfkynrpveewlqekgrqlTIFNTQAQ......IAIGG------
ENSTGUP00000002105  ..RDILH.......ATQD..F................................GGLNVLT-......ISLGGAPSSQP
ENSTGUP00000013146  ..FEDID.......PQRK..Y................................TALNYGGI......CYFGGFEIGKE
ENSTGUP00000010269  ..-----.......----..-................................--------......-----------
ENSTGUP00000010196  ..-----.......----..-................................--------......-----------
ENSTGUP00000007726  ..KTAEK.......PINT..L................................GSVSSAGF......IMLGKVTRTRG
ENSTGUP00000004439  ..YLGFI.......STPA..L................................TIQNKDT-......LYIGGLPDSKE
ENSTGUP00000017145  ..SNSEQ.......LSTL..H................................QAMMANVV......TYLGGLPDVPL
ENSTGUP00000008485  ..-----.......----..-................................--------......-----------
ENSTGUP00000002833  ..VVRPF.......PPQS..F................................VRLEFDRP......LYVG-------
ENSTGUP00000007830  ..YQDTV.......VVGN..E................................LHGLKVKH......LHVGGVL----
ENSTGUP00000013892  ..SNSEQ.......LSTL..H................................QAMMANVV......TYLGGLPDVPL
ENSTGUP00000004439  ..STSTA.......AAGS..L................................NFLREETD......IYVAD------
ENSTGUP00000007218  ..VELGQ.......LPAQ..A................................--LGAGSE......VFIGGHPNPGS
ENSTGUP00000008492  ..-----.......----..-................................--------......-----------
ENSTGUP00000001272  ..-----.......----..-................................--------......-----------
ENSTGUP00000007218  clQSSPV.......PPGT..A................................VIPQAFLN......LYIGGAEHPMA
ENSTGUP00000003750  ..SYDPF.......PVTE..D................................YPLHPSKIetq...LVVGACWQVFS
ENSTGUP00000005281  ..PYLVT.......NDWP..I................................HPSHIAMQ......LTVGACWQGGE
ENSTGUP00000000714  ..PVLGG.......IKSLkgE................................AIADGPGI......VRIG-------
ENSTGUP00000012350  ..IKSVD.......NERT..-................................--AMPFTD......IYIGGAPADIL
ENSTGUP00000004160  ..AVTGE.......S---..-................................--------......-----------
ENSTGUP00000003982  ..-----.......----..-................................--------......-----------
ENSTGUP00000002535  ..-----.......----..-................................--------......-----------
ENSTGUP00000013650  ..PALIH.......DNGL..I................................HPPRPEPS......LMIGACWAEEK
ENSTGUP00000002531  ..-----.......----..-................................--------......-----------
ENSTGUP00000014137  ..ATSTA.......AAGS..L................................NFLREETD......IYVAD------
ENSTGUP00000010869  ..-----.......----..-................................--------......-----------
ENSTGUP00000006581  ..YYSSE.......VLSE..V................................GTFDSEAV......FTLG-------
ENSTGUP00000002535  ..-----.......----..-................................--------......-----------
ENSTGUP00000002531  ..-----.......----..-................................--------......-----------
ENSTGUP00000007218  ..NVTLQ.......GSAG..S................................LDFLKNN-......-----------
ENSTGUP00000001266  ..-----.......----..-................................--------......-----------
ENSTGUP00000016883  ..AV---.......----..-................................--------......-----------
ENSTGUP00000012350  ..KQSKK.......NPAK..D................................RAGKSPDSikk...FYFGGSPL---
ENSTGUP00000013146  ..NITQK.......ASPG..M................................NALDTHSD......FFVGGVSSLNL
ENSTGUP00000012110  ..-----.......----..-................................--------......-----------
ENSTGUP00000004798  ..LSTAD.......PDGKv.F................................YDYGDAGS......ELLGG------
ENSTGUP00000001382  ..-----.......----..-................................--------......-----------
ENSTGUP00000012350  ..IKKGE.......VLGP..G................................SLLNLEPEnav...FYVGGVPPGFK
ENSTGUP00000012081  ..-----.......----..-................................------GS......GFFGR------
ENSTGUP00000000911  ..-----.......----..-................................--------......-----------
ENSTGUP00000002977  taFDSRT.......LMGT..V................................ADADADGT......LQIG-------
ENSTGUP00000010839  ..LPKFC.......VKAN..I................................QVFNF-TE......YYLGGVPSFLR
ENSTGUP00000012486  ..-----.......P---..-................................--------......-----------
ENSTGUP00000010913  ..-----.......----..-................................--------......-----------
ENSTGUP00000010839  ..SKAID.......SPRS..S................................SSQESNRP......IKFGG------
ENSTGUP00000001856  ..EASAV.......RTNS..P................................LQVKTGEK......YFFGGFPVQMN
ENSTGUP00000010839  ..PRSAS.......SGDS..D................................MLLNLDPSsvv...FYVGGYPPDFR
ENSTGUP00000011307  ..-----.......----..D................................KVIPGNGR......LVLG-------
ENSTGUP00000005592  ..-----.......----..-................................--------......-----------
ENSTGUP00000003709  ..QV---.......----..-................................--------......-----------
ENSTGUP00000000097  ..-----.......----..-................................--------......-----------
ENSTGUP00000010913  ..-----.......----..-................................--------......-----------
ENSTGUP00000014278  ..Q----.......----..-................................--------......-----------
ENSTGUP00000012086  ..KVQTQ.......RLPS..D................................QPVSVKK-......LFVGGTSSPFQ
ENSTGUP00000012081  ..-----.......----..-................................--------......-----------
ENSTGUP00000010276  ..LVAVN.......ALGD..G................................STLDVEGK......LYVGGLPLDYV
ENSTGUP00000001099  ..-----.......----..-................................--------......-----------
ENSTGUP00000002570  ..LVNIV.......K---..-................................--------......-----------
ENSTGUP00000013145  ..VQHRL.......SVSH..H................................TSQINFGS......IFLGKVPVHEE
ENSTGUP00000009567  ..LTNSLiaeefvnFRED..F................................YYDDTGGY......FVLGGS-----
ENSTGUP00000010913  ..-----.......----..-................................--------......-----------
ENSTGUP00000002371  ..-----.......----..-................................-------D......-----------
ENSTGUP00000012081  ..-----.......----..-................................--------......-----------


                      50                      160       170                        180              
                       |                        |         |                          |              
d1dyka1               TR...............RIGPVTYSLDGCVRNLHMEQ....APV.DL.......DQ.PT....SSFHVG..T-.--cf
ENSTGUP00000016927  --...............--------------------....---.--.......--.--....------..--.--ge
ENSTGUP00000003709  --...............--------------------....---.--.......--.--....------..--.--yq
ENSTGUP00000010031  --...............--------------------....---.--.......--.--....------..--.--kp
ENSTGUP00000001099  --...............--------------------....---.--.......--.--....------..--.--ll
ENSTGUP00000011992  --...............--------------------....---.--.......--.--....------..--.--wk
ENSTGUP00000014278  --...............--------------------....---.--.......--.--....------..--.--fi
ENSTGUP00000014987  --...............--------------------....---.--.......--.--....------..--.--ft
ENSTGUP00000002371  --...............--------------------....---.--.......--.--....------..--.--im
ENSTGUP00000000385  --...............--------------------....---.--.......--.--....------..--.--sa
ENSTGUP00000007869  --...............--------------------....---.--.......--.--....------..--.--lg
ENSTGUP00000003849  --...............--------------------....---.--.......--.--....------..--.--mg
ENSTGUP00000003292  --...............--------------------....---.--.......--.--....------..--.--lg
ENSTGUP00000015979  --...............--------------------....---.--.......--.--....------..--.--ng
ENSTGUP00000016008  --...............--------------------....---.--.......--.--....------..--.--dy
ENSTGUP00000000111  --...............-----------C--------....---.--.......--.--....------..--.--lk
ENSTGUP00000014546  --...............--------------------....---.--.......--.--....------..--.--kg
ENSTGUP00000006031  --...............--------------------....---.--.......--.--....------..--.--ri
ENSTGUP00000003669  --...............--------------------....---.--.......--.--....------..--.--hf
ENSTGUP00000005348  --...............--------------------....---.--.......--.--....------..--.--ng
ENSTGUP00000008609  --...............--------------------....---.--.......--.--....------..--.--al
ENSTGUP00000017060  --...............--------------------....---.--.......--.--....------..--.--gf
ENSTGUP00000009828  --...............--------------------....---.--.......--.--....------..--.--gf
ENSTGUP00000014507  --...............------VDFEG---------....---.--.......--.--....------..--.--tf
ENSTGUP00000010199  --...............--------------------....---.--.......--.--....------..--.--qq
ENSTGUP00000005117  --...............--------------------....---.--.......--.--....------..--.--vl
ENSTGUP00000008110  --...............--------------------....---.--.......--.--....------..--.--yh
ENSTGUP00000004907  --...............--------------------....---.--.......--.--....------..--.--nl
ENSTGUP00000010725  --...............--------------------....---.--.......--.--....------..--.--hl
ENSTGUP00000005437  --...............--------------------....---.--.......--.--....------..--.--nh
ENSTGUP00000013465  --...............--------------------....---.--.......--.--....------..--.--di
ENSTGUP00000000911  --...............--------------------....---.--.......--.--....------..--.--qc
ENSTGUP00000010911  --...............--------------------....---.--.......--.--....------..--.--vk
ENSTGUP00000010725  --...............--------------------....---.--.......--.--....------..--.--le
ENSTGUP00000008902  --...............GRFDATQAFVGEMSQFNIWD....RVL.RA.......ED.IM....NIANCS..--.--in
ENSTGUP00000007890  --...............--------------------....---.--.......--.--....------..--.--ye
ENSTGUP00000002179  H-...............TNRQYLRGLVGCISHL----....---.--.......--.--....------..--.--t.
ENSTGUP00000013613  --...............--------------------....---.--.......--.--....------..--.--ay
ENSTGUP00000009917  IAalrq...........SPGQNGTSFHGCIRNLYINS....ELQ.DF.......RN.VP....LQVGIL..PG.C-..
ENSTGUP00000002689  --...............--------------------....---.--.......--.--....------..--.--ry
ENSTGUP00000002179  LV...............RATGTNRGFQGCVQSLSING....KII.DM.......RP.--....------..--.--wp
ENSTGUP00000011992  --...............AKGGVNDNFQGLLQNVRF--....---.--.......--.--....------..--.--vf
ENSTGUP00000013892  GA...............LVKQINPRLDGCIR------....---.--.......--.--....------..--.--aw
ENSTGUP00000004653  --...............QRNRKHGFFKGVIQDVKI--....---.--.......--.--....------..--.--if
ENSTGUP00000005148  --...............TRILDEEVFEGEIQQLLI--....---.--.......--.--....------..--.--ia
ENSTGUP00000006286  --...............--------------------....---.--.......--.--....------..--.--gp
ENSTGUP00000001570  LSslrq...........GADKTPNGFHGCIHDVRINN....ELQ.DF.......KDlPQ....QSLGVL..PG.C-..
ENSTGUP00000008379  --...............--------------------....---.--.......--.--....------..--.--rq
ENSTGUP00000006159  --...............TRILDEEVFEGDIQQLLI--....---.--.......--.--....------..--.--va
ENSTGUP00000012721  L-...............PGSPVSNNFMGCLKEVVY--....---.--.......--.--....------..--.--..
ENSTGUP00000009636  D-...............LIVPINPRLDGCMRA-----....---.--.......--.--....------..--.--wn
ENSTGUP00000005001  --...............PGTFQRKNFHGCIENLYYNG....VNIiDLakrr...KP.QI....YTGNVT..FS.C-se
ENSTGUP00000001754  --...............-------------N------....---.--.......--.--....------..--.--tv
ENSTGUP00000001756  --...............-------------N------....---.--.......--.--....------..--.--tv
ENSTGUP00000001267  --...............--------------------....---.--.......--.--....------..--.--vv
ENSTGUP00000000484  --...............SGTLSRRNFHGCLENIYYN-....---.--.......--.--....------..--.--..
ENSTGUP00000007830  --...............NFPITHRDFVGCMRDLFIDS....KRI.DL.......AS.YI....ANNGTA..AG.C-ha
ENSTGUP00000002179  VK...............KNSGILRPFSGSIQKIILND....RTI.DV.......KQ.--....------..--.--df
ENSTGUP00000001495  S-...............-FPIRSRHFVGCMRHLHIDQ....RPV.DM.......SA.--....------..--.--fi
ENSTGUP00000010031  --...............KGSTRENHFRGLLQNIQL--....---.--.......--.--....------..--.--if
ENSTGUP00000017400  Q-...............NCLTSKSSFRGCLRNLVLTKgqhtELF.DF.......SR.AF....DLRGVFp.HS.CP..
ENSTGUP00000007223  TRhg.............RSPQVSNGFRGCMDSIVLNG....QEL.PLnskprnyAH.ME....ESVDVT..PG.C-ll
ENSTGUP00000010276  Q-...............NCLTSKSSFRGCLRNLVLTKgqhtELF.DF.......SR.AF....DLRGVFp.HS.CP..
ENSTGUP00000005926  GLvfptev.........WTALLNYGYVGCIRDLFIDG....QSK.DIrqm....AE.IQ....STAGVK..PS.C-..
ENSTGUP00000004461  --...............--------------------....---.--.......--.--....------..--.--ss
ENSTGUP00000015340  --...............--------------------....---.--.......--.--....------..--.--gg
ENSTGUP00000000813  --...............--------------------....---.--.......--.--....------..--.--qf
ENSTGUP00000002366  --...............--------------------....---.--.......--.--....------..--.--df
ENSTGUP00000016735  --...............GGFDLYNSFSGELTDVYLWD....AGL.SP.......E-.--....------..--.--km
ENSTGUP00000002833  Q-...............-HLTYRQNFRGCVENIMFN-....---.--.......--.--....------..--.--..
ENSTGUP00000003828  --...............DFPVHNRQFIGCMRNLSIDS....KPI.DM.......AG.FI....ANNGTL..PG.C-aa
ENSTGUP00000013533  --...............--------------------....---.--.......--.--....------..--.--dk
ENSTGUP00000001271  --...............--------------------....---.--.......--.--....------..--.--fr
ENSTGUP00000010605  --...............GRFDATQAFVGELAQFGVWD....HML.AP.......AE.IL....ALANCT..--.--sh
ENSTGUP00000001337  --...............EGFNPAESFVGSISQLNIWN....HVL.SP.......QQ.VE....------..--.--sl
ENSTGUP00000005926  --...............YLSSVPSNFIGHLQSLTFN-....---.--.......--.--....------..--.--..
ENSTGUP00000013493  --...............--------------------....---.--.......--.--....------..--.--tg
ENSTGUP00000005001  DS...............QCLNPITGFQGCMRLIFI--....---.--.......--.--....------..--.--d.
ENSTGUP00000012721  SNlp.............KLVASRDGFQGCLASVDLN-....---.--.......--.--....------..--.--..
ENSTGUP00000005926  KSlp.............KLVHAKEGFQGCLASVDLN-....---.--.......--.--....------..--.--..
ENSTGUP00000012721  GLilptel.........WTAMLNYGYVGCIRDLFIDG....RSK.NIrql....AE.AQ....NAAGVK..SS.C-sr
ENSTGUP00000000499  --...............GTASRQKGFLGCIRSLRLNG....MAL.DLe......ER.AK....ITPGVE..PG.CPgh
ENSTGUP00000012721  --...............YISVIPSSFIGHLQSLMFN-....---.--.......--.--....------..--.--..
ENSTGUP00000001856  --...............--AGGQRGFLGCIRSLRMNG....VTL.DLe......ER.AK....VTPGVK..PG.C-sg
ENSTGUP00000001856  IDqd.............IYKYNTPGFTGCLSRVQFN-....---.--.......--.--....------..--.--..
ENSTGUP00000012350  T-...............SSLTTRNSFIGCIRNFMIDE....KPV.SF.......SK.AA....LVSGAVsiNT.C-pa
ENSTGUP00000013256  VRsltdk..........RTTQVLSGFQGCLDSVVLNN....NEL.PL.......Q-.--....------..--.--nk
ENSTGUP00000001271  FS...............--------------------....---.--.......--.--....------..--.--le
ENSTGUP00000005001  --...............GAASRRKGFLGCIRSLHLN-....---.--.......--.--....------..--.--..
ENSTGUP00000013952  --...............--------------------....---.--.......--.--....------..--.--dt
ENSTGUP00000003772  --...............------------M-------....---.--.......--.--....------..--.--sd
ENSTGUP00000011887  --...............--------------------....---.--.......--.--....------..--.--km
ENSTGUP00000002105  ILqr.............RGQVESHDFVGCIMEFAVNG....RPL.EP.......SQ.AL....AAQGIL..DQ.CPrl
ENSTGUP00000005926  L-...............PGSPVSNNFMGCLKEVVYKN....ND-.--.......--.--....------..--.--vr
ENSTGUP00000003312  --...............--------------------....---.--.......--.--....------..--.--ay
ENSTGUP00000006486  --...............--------------------....---.--.......--.--....------..--.--tk
ENSTGUP00000017417  --...............--------------------....---.--.......--.--....------..--.--hk
ENSTGUP00000002833  VT...............GCRSNQTAFHGCLQMLNV--....---.--.......--.--....------..--.--d.
ENSTGUP00000005052  --...............--------------------....---.--.......--.--....------..--.--kd
ENSTGUP00000000988  --...............--------------------....---.--.......--.--....------..--.--gt
ENSTGUP00000012350  VKn..............IQINSVYSFSGCLSNLQLNG....RSL.TS.......--.--....------..--.--as
ENSTGUP00000012758  --...............--------------------....---.--.......--.--....------..--.--pr
ENSTGUP00000005462  --...............--------------------....---.--.......--.--....------..--.--sy
ENSTGUP00000006169  --...............QRNTAHGYFKGIMQDVQL--....---.--.......--.--....------..--.--lv
ENSTGUP00000002833  IDpe.............IQRYNTPGFSGCLSGVKFN-....---.--.......--.--....------..--.--..
ENSTGUP00000010134  SAafrl...........WQLLNGTSFHG---------....---.--.......--.--....------..--.--..
ENSTGUP00000013027  --...............--------------------....---.--.......--.--....------..--.--ks
ENSTGUP00000012212  -S...............ETADANRVFCGQLGAVYVFT....---.--.......--.--....------..--.--ea
ENSTGUP00000017145  GA...............LVKQINPRLDGCIR------....---.--.......--.--....------..--.--aw
ENSTGUP00000009339  YS...............YPQLLHKHFSGCLRNFILDTq...KVY.DL.......QF.PA....ESLNSF..PG.C-tl
ENSTGUP00000012283  YR...............DSQRHFRGFVGCIRNVIVDS....KVY.DL.......QH.PA....ESLNSA..PG.C-vl
ENSTGUP00000010839  T-...............LWLPVEDPFFGCLRNITIND....KHV.ST.......RR.IS....EIHGSVnlHG.CPe.
ENSTGUP00000009346  --...............YPFNQNKSFQGCMKDVRFNN....YRL.PLdthgkelVS.VL....SAQGIK..EG.C-..
ENSTGUP00000011096  --...............--------------------....---.--.......--.--....------..--.--sp
ENSTGUP00000004439  NPlqnt...........FNTHSAPSFVGCLQDVEIDL....NVI.TP.......EN.VSsg..SSLNVR..TG.C-..
ENSTGUP00000009346  YS...............YPQLLHKHFSGCLRNFILDT....QVY.DL.......QF.PA....ESLNSF..PG.C-tl
ENSTGUP00000013113  IS...............--------------------....---.--.......--.--....------..--.--vp
ENSTGUP00000003411  --...............AGGADPDKYQGVIADLKLRG....DPR.--.......--.--....------..--.--aa
ENSTGUP00000007370  --...............GTFRAKESFSGNITDLHIWQ....KAL.SP.......EH.IEkv..RSCG--..--.--vv
ENSTGUP00000010839  Q-...............--NMPMKSFKGCLRNFKMNG....KAM.N-.......--.--....------..--.--tp
ENSTGUP00000000911  --...............------------L-------....---.--.......--.--....------..--.--yg
ENSTGUP00000014074  --...............--------------------....---.--.......--.--....------..--.--r.
ENSTGUP00000012721  PAaltl...........DGVLSEPPFQGFILDL----....---.--.......--.--....------..--.--k.
ENSTGUP00000003983  --...............--GTFSNGFGGWLSRVNLWS....RVL.SA.......AE.L-....------..--.--ra
ENSTGUP00000013002  --...............--------------------....---.--.......--.--....------..--.--ds
ENSTGUP00000000499  VDee.............IIKANSQGFVGCLSSVQFN-....---.--.......--.--....------..--.--..
ENSTGUP00000009339  NK...............SFQVSLCLAVGCMKDVRFNN....YRL.PLdthgkelVS.VL....SAQGIK..EG.C-..
ENSTGUP00000005926  --...............--KERGHPFQGQLSGLYYN-....---.--.......--.--....------..--.--..
ENSTGUP00000005377  --...............--------------------....---.--.......--.--....------..--.--ar
ENSTGUP00000013614  --...............--------------------....---.--.......--.--....------..--.--sp
ENSTGUP00000015460  --...............--------------------....---.--.......--.--....------..--.--fq
ENSTGUP00000002977  GFy..............RELGLEQGFGGCMKDVKFTRg...AVV.NL.......AS.VS....------..--.--ss
ENSTGUP00000011574  VG...............GGFDESLAFSGKLTGFNLWD....RVL.SA.......AE.VT....A-----..--.--qs
ENSTGUP00000013208  --...............--------------------....---.--.......--.--....------..--.--gk
ENSTGUP00000003385  --...............--NALNQNYRGYMEHFSLWR....TAR.SQ.......KE.IL....------..--.--ld
ENSTGUP00000002977  IVrkdeg..........MKRIVQKGICGCLSDIFLKK....V--.--.......--.--....------..--.--ht
ENSTGUP00000000499  IS...............ECNTSFGGFQGCMQHI----....---.--.......--.--....------..--.--s.
ENSTGUP00000005001  LDpe.............VSKANAYGFTGCLSSVQYN-....---.--.......--.--....------..--.--..
ENSTGUP00000012283  --...............--SHSESDFQGCMRDVQLDG....QPL.LVegrstefGL.IL....RRQGVT..MG.C-..
ENSTGUP00000003494  --...............-ISQHAVQFEGAI-------....---.--.......--.--....------..--.--cq
ENSTGUP00000000911  --...............--------------------....---.--.......--.--....------..--.--aq
ENSTGUP00000006192  --...............NRRRRKGVFTGLLKQLVL--....---.--.......--.--....------..--.--lp
ENSTGUP00000009636  TS...............--TPVTASYHGCM-TLKLSN....TAL.DL.......DE.AL....YKHSDItsHS.CPpv
ENSTGUP00000002624  -S...............ETADANRVFCGQMTSVYLFS....EA-.--.......--.--....------..--.--l.
ENSTGUP00000000797  S-...............--QRVARGFRGCLDVVAING....REV.VLlpgkgqsKE.VL....EEVGIR..QC.C-..
ENSTGUP00000013145  ELlp.............KGPRFKNGFQGCIFDVQV--....---.--.......--.--....------..--.--..
ENSTGUP00000003828  --...............--VSVQQGFYGCMQGVRMGE....TST.NI.......AT.LNmkqaIKINVR..EG.C-..
ENSTGUP00000008611  --...............--------------------....---.--.......--.--....------..--.--de
ENSTGUP00000015228  --...............--------------------....---.--.......--.--....------..--.--la
ENSTGUP00000012725  --...............--KDRGRLFQGQLSGLYYNG....LKV.L-.......--.--....------..--.--nm
ENSTGUP00000002105  F-...............--KSTAAGFNGCISYIKYGG....ESL.PF.......S-.--....------..--.--gk
ENSTGUP00000013146  VNiv.............TIGLFQKEFIGKIKDVVL--....---.--.......--.--....------..--.--f.
ENSTGUP00000010269  --...............--------------------....---.--.......--.--....------..--.--pi
ENSTGUP00000010196  --...............--------------------....---.--.......--.--....------..--.--vi
ENSTGUP00000007726  P-...............--------------------....---.--.......--.--....------..--.--rs
ENSTGUP00000004439  T-...............--DRNGRYFKGCIQDVRVNN....QPL.EF.......--.--....------..--.--fp
ENSTGUP00000017145  --...............GATPVTAFYNGCM-EVKVNS....RQL.DL.......DE.AI....SKHNDIrsHS.CPr.
ENSTGUP00000008485  --...............--------------------....---.--.......--.--....------..--.--ek
ENSTGUP00000002833  --...............AAEYKMRPFLGCLRALRMNG....VTL.NLe......GK.AN....ETEGVR..VN.C-tg
ENSTGUP00000007830  --...............GSGEVQNGLRGCIQGVRLGD....SIT.GIvl.....PK.PS....HALRVE..AG.C-sv
ENSTGUP00000013892  --...............GATPVTAFYNGCM-EVKVNS....RQL.DL.......DE.AI....SKHNDIrsHS.CPr.
ENSTGUP00000004439  --...............KAFDSLDGLRGCMSTIEISG....IYL.S-.......--.--....------..--.--yf
ENSTGUP00000007218  A-...............--ELWGGYFKGCLQDIQLNN....HQI.QF.......FQ.VE....------..--.--nd
ENSTGUP00000008492  --...............--------------------....---.--.......--.--....------..--.--vi
ENSTGUP00000001272  --...............--------------------....---.--.......--.--....------..--.--fh
ENSTGUP00000007218  N-...............-NTRSQQGFVGCLEDLQVDA....EAV.LP.......AD.LP....------..--.--lg
ENSTGUP00000003750  SVeacpadssaeqhss.GELRMAQFFRGSLAGLMIR-....---.--.......--.--....------..--.--sg
ENSTGUP00000005281  V-...............TKPRFAQYFHGSLAGLTIR-....---.--.......--.--....------..--.--pg
ENSTGUP00000000714  --...............AGINGSSRYTGFMQDVRLYE....R--.--.......--.--....------..--.--kt
ENSTGUP00000012350  HSrlfy...........SHLAGSIGFKGCMKGFQFQK....KDF.NL.......LE.EP....GTLGIS..YG.CPe.
ENSTGUP00000004160  --...............--------------------....---.--.......--.--....------..--.--p.
ENSTGUP00000003982  --...............--------------------....---.--.......--.--....------..--.--gh
ENSTGUP00000002535  --...............--------------------....---.--.......--.--....------..--.--sp
ENSTGUP00000013650  TKektkgsenatdsvqgDPLSIHHYFHGYLAGFTV--....---.--.......--.--....------..--.--rp
ENSTGUP00000002531  --...............--------------------....---.--.......--.--....------..--.--sp
ENSTGUP00000014137  --...............KAFDSLDGLRGCMSTIEISG....IYL.S-.......--.--....------..--.--yf
ENSTGUP00000010869  --...............--------------------....---.--.......--.--....------..--.--ta
ENSTGUP00000006581  --...............RMNSHSVSFEGVICQ-----....---.--.......--.--....------..--.--ld
ENSTGUP00000002535  --...............--------------------....---.--.......--.--....------..--.--av
ENSTGUP00000002531  --...............--------------------....---.--.......--.--....------..--.--av
ENSTGUP00000007218  --...............VSVVLAENFTGCLGRVQIGG....IFL.PF.......--.--....------..--.--pp
ENSTGUP00000001266  --...............--------------------....---.--.......--.--....------..--.--ss
ENSTGUP00000016883  --...............--------------------....---.--.......--.--....------..--.--ng
ENSTGUP00000012350  --...............--RTQQANFTGCISNAYFTR....---.--.......--.--....------..--.--ld
ENSTGUP00000013146  VNpm.............AIENEPTGFTGCIREIVINN....REL.NLtv.....TD.PK....GGANIG..DC.--dg
ENSTGUP00000012110  --...............--------------------....---.--.......--.--....------..--.--lr
ENSTGUP00000004798  --...............TEGTARRSVSGAFDEFVIWE....RAL.SP.......RE.VR....------..--.--qy
ENSTGUP00000001382  --...............--------------------....---.--.......--.--....------..--.--hn
ENSTGUP00000012350  L-...............PPSLNLPGFIGCLELATLND....DVI.SL.......YN.FK....HVYNI-..--.--dt
ENSTGUP00000012081  --...............--SWQSGDVVGCMIN-----....---.--.......--.--....------..--.--ld
ENSTGUP00000000911  --...............--------------------....---.--.......--.--....------..--.--iy
ENSTGUP00000002977  --...............QSFTGLEQFVGRMQDFRFYS....VAL.TN.......RD.IL....------..--.--ev
ENSTGUP00000010839  E-...............QFNISTPPFRGCMKNV----....---.--.......--.--....------..--.--k.
ENSTGUP00000012486  --...............--------------------....---.--.......--.--....------..--.--an
ENSTGUP00000010913  --...............------------M-------....---.--.......--.--....------..--.--vd
ENSTGUP00000010839  --...............------DNFEGCISNIFI--....---.--.......--.--....------..--.--e.
ENSTGUP00000001856  DS...............DHSLFEHSFQGCMQSIHVDD....QLV.DL.......HA.VE....------..--.--qg
ENSTGUP00000010839  P-...............PDNLNYPRYEGCIELNSLNE....HIV.SL.......YN.--....------..--.--f.
ENSTGUP00000011307  --...............SSSNEVSSLNGDIYNFRLWN....FTM.NA.......Q-.--....------..--.--tl
ENSTGUP00000005592  --...............--------------------....---.--.......--.--....------..--.--da
ENSTGUP00000003709  --...............--------------------....---.--.......--.--....------..--.--ga
ENSTGUP00000000097  --...............--------------------....---.--.......--.--....------..--.--gk
ENSTGUP00000010913  --...............SFRINGQPVQGMFENFNIDG....LFF.PV.......VS.--....------..--.--fs
ENSTGUP00000014278  --...............--------------------....---.--.......--.--....------..--.--md
ENSTGUP00000012086  I-...............SPLRNIPPFEGCIWNLVINA....TPM.DF.......AQ.PV....SFENAD..IGrCP..
ENSTGUP00000012081  --...............--------------------....---.--.......--.--....------..--.--si
ENSTGUP00000010276  PK...............NLGNVSHSIPACIGSMTING....NQV.DN.......ES.PV....SIF---..--.--av
ENSTGUP00000001099  --...............---------------I----....---.--.......--.--....------..--.--ff
ENSTGUP00000002570  --...............--------------------....---.--.......--.--....------..--.--lh
ENSTGUP00000013145  VN...............RCAGKIYGYKGCIRDFQVNH....KEL.FIi......DE.AL....EGRNVE..NC.--nv
ENSTGUP00000009567  --...............GYVNGIEAFFGPVKYY----....---.--.......--.--....------..--.--rl
ENSTGUP00000010913  --...............--------------------....---.--.......--.--....------..--.--rs
ENSTGUP00000002371  --...............--------------------....---.--.......--.--....------..--.--iy
ENSTGUP00000012081  --...............--------------------....---.--.......--.--....------..--.--vh


                                                                                                    
                                                                                                    
d1dyka1               a.............................................................................
ENSTGUP00000016927  hlrnalwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktgyirvvmyegkkimadsgpiydktyaggrlglfv
ENSTGUP00000003709  dsssfyvvmwkqteqtywqatpfravaepgiqlkavksktgpgehlrnslwhtgdtndqvrllwkdprnvgwkdkvsy
ENSTGUP00000010031  traygysgvslkvvnsttgtgehlrnalwhtgntpgqvrtlwhdpknigwkdytayrwhlihrpktglikvlvyegkq
ENSTGUP00000001099  ndmsppvnppreiedpn.............................................................
ENSTGUP00000011992  qitqsywdstptkaqgysglsikvvnsttgpgehlrnalwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktg
ENSTGUP00000014278  fsyqdsasfyvvmwkqteqtywqatpfravaepglqlkavksstgpgehlrnalwhtghtpdhvrllwkdprnvgwrd
ENSTGUP00000014987  pdkedyefcakvedmvlpsqgyfgisaatggladdhdvlsfltfqlte..............................
ENSTGUP00000002371  fgpdkcgedyklhfifrhknpktgeydekhavrpdvdlkkfyldkkthlytlvlkpddtfeilidqtvvskgsllenm
ENSTGUP00000000385  gtgdlsdnhdiismklfql...........................................................
ENSTGUP00000007869  vafrglkgkklypivsavwghceitmryingldpeplplmdlcrrsir..............................
ENSTGUP00000003849  vafrglkgkklypvvsavwghceirmcylngldpeplplmdlcrravr..............................
ENSTGUP00000003292  aflggrnaeplv..................................................................
ENSTGUP00000015979  grywavtspqrtplcvdhklsrvrvyldyegeevsfydaenmkhiftfnvafkekvfplfsvcst.............
ENSTGUP00000016008  eggwvafynadsmapiftftaafserifp.................................................
ENSTGUP00000000111  kfdfeywafhkgeripirieddpdrigvfldyeagilsfynvsngmahlhtfcckftepvypalrlwegsi.......
ENSTGUP00000014546  klekvgvfldydkgllifynaddmswlytfrerfpgklcsyfspgqshangknvqplrin..................
ENSTGUP00000006031  rvildmedktlafergyeflgvafrglpkvclypavsavygntevtlvylgkp.........................
ENSTGUP00000003669  weikmtspvygtdmmvgigtsdvnldkyrhtfcsllgkdedswglsytgllhhkgdktnfssrfgqgsiigvhldtwh
ENSTGUP00000005348  eigvyldyevgqvsfyavssrqriftfpvasfsgervfpyfclwvck...............................
ENSTGUP00000008609  nslhlytfditfgqpvcptftvwnkcltiitglpipd.........................................
ENSTGUP00000017060  wviacvdgqdylactnpwtcltvtgclskigiflnipakqvsfydvfravalytfsiaegssqegkflpffstglaas
ENSTGUP00000009828  qcfkrgihywevelqqgsfcgigvcygsmerqgpesrlgrnskswciewlnskisswhndvekclpntkatkigvllh
ENSTGUP00000014507  hvntatdddyagfifgyqdsssfyvvmwkqmeqtywqanpfravaepg..............................
ENSTGUP00000010199  gppafeniegvfmpalslnrnvqvtlhtglev..............................................
ENSTGUP00000005117  ldydnnalsfydpanslhlhtfevsfilpvcptftiwnkslmilsglpa.............................
ENSTGUP00000008110  mygkhigslnllvrvrnkraidtqvwslsgnrgnvwqqahvpinppgpfqiifegvrgtsyegdiaiddvtlkkgdc.
ENSTGUP00000004907  qaplgydkfsyswrskkgtkfhqsigkhyssgygqgdvlgfyislpedtetakslpdtykdkalikfksylyfeekdf
ENSTGUP00000010725  llynhrislekidtlgiygkvqiktiefvs................................................
ENSTGUP00000005437  kdaasvrathpipaacgiyyfevkivskgrdgymgiglsaqgvnmnrlpgwdkhsygyhgddghsfcssgtgqpygpt
ENSTGUP00000013465  altsvl........................................................................
ENSTGUP00000000911  ltffyhmygagtgllsvylkkegddeeiplwrrtgeqsiswlrglieyesdtnyqiifeairgvsirsdtaiddilfq
ENSTGUP00000010911  ffiemlsdkfrvklpdghevcfpnrhgyhninyisivgglkiisfk................................
ENSTGUP00000010725  ykhrfkqlekisivevtgdvhlldvr....................................................
ENSTGUP00000008902  mpgniipwvdnnvdvfggatkw........................................................
ENSTGUP00000007890  flhsgmtpdiritvpprrigilldyencrlaffnadiaqhlhtfnshfqhyvhpcfaletpgilrihtgittpp....
ENSTGUP00000002179  ..............................................................................
ENSTGUP00000013613  cfsfyyhmygqhigslnvylrlkgqtaienplwsssgnkgqhwnqarvninpptsfqlifegirgpgiegdiaiddvs
ENSTGUP00000009917  ..............................................................................
ENSTGUP00000002689  dkefrflhagqpqpvelikapaeigvlldfaggellfydpdscailfshrqaflepvypvfavahqs...........
ENSTGUP00000002179  lgkalsgadvgecssg..............................................................
ENSTGUP00000011992  gttletilrnkgcs................................................................
ENSTGUP00000013892  n.............................................................................
ENSTGUP00000004653  ipngyitqcpnlnrtc..............................................................
ENSTGUP00000005148  dpraafdycehyspdc..............................................................
ENSTGUP00000006286  tfttgdvigccvnlinntcfytknghslgiaftdlppnlyptvglqtpgevvdanfgqhpfvfdiedymrewr.....
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000008379  knlssitklqilddidissveitkrvls..................................................
ENSTGUP00000006159  dpraaleycehyspdc..............................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000009636  w.............................................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000001754  vcnskedgvwgeedrkaefpfqhgdkieicisfdeteatvklpeaefkfpnrlgmekieylavegdfkvkaikf....
ENSTGUP00000001756  vcnskedgvwgeedrkaefpfqhgdkieicisfdeteatvklpeaefkfpnrlgmekieylavegdfkvkaikf....
ENSTGUP00000001267  vagmiifyyhmygahigsliiyqrttlkhekillnltgnqgnywqrkaltmsgdgdddfqvvfegiagegpkdgiald
ENSTGUP00000000484  ..............................................................................
ENSTGUP00000007830  kh............................................................................
ENSTGUP00000002179  tfginlanaahpcvtspc............................................................
ENSTGUP00000001495  an............................................................................
ENSTGUP00000010031  dtsiedvlrkkgc.................................................................
ENSTGUP00000017400  ..............................................................................
ENSTGUP00000007223  t.............................................................................
ENSTGUP00000010276  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000004461  pgslnvyvkvnggpqgnpiwnvsgvvtegwvkaelaistfwphfyqvifesvslkghpgyiavdevrvlahpc.....
ENSTGUP00000015340  yvklfpaslsqedmhgdseynimfgpdicgpgtkkvhvifnykgknvlinkdircq......................
ENSTGUP00000000813  syfmfsrdghspgtlsayvwvtgglvgsavwnasgshgrqwhqaelavslfwpseyqvlfeavvsserrgylglddil
ENSTGUP00000002366  yhrietlsaidtikingdlqltkl......................................................
ENSTGUP00000016735  raaflslrlppallawnglsyevkgdvvvkpr..............................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000003828  q.............................................................................
ENSTGUP00000013533  awaiteggitkgatvgvlldltrrtltfsinedqqgpvafenleglffpavslnrnvqvtlhtglpvpe.........
ENSTGUP00000001271  fhyhmfgkevyklsvfqrtvsnakgwllwykfgnqenrwirqtlfissskpfq.........................
ENSTGUP00000010605  lqgnviqwddqavevfgga...........................................................
ENSTGUP00000001337  atscpeelqkgnvlawpdflpgvvgrvkidyk..............................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000013493  kkshnkqfdsygeeftmhdtigcyldtekgqikfskngkdlglafeipphirnqalfaacvlknaelkfnfgeedfkf
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000012721  l.............................................................................
ENSTGUP00000000499  c.............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000001856  h.............................................................................
ENSTGUP00000001856  ..............................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000013256  r.............................................................................
ENSTGUP00000001271  kislgvyegvsaiddirfenc.........................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000013952  yclsfwyfmygdnvyrlrvsisdehgqekiifkkegnygnnwnygqvtlnetshfkvifdafkrrgrsdiavddtglt
ENSTGUP00000003772  vhvtehlarigilldynsgrllffnaerglvlfairhkftdaahpafalekagmltlctgmelpd.............
ENSTGUP00000011887  ellcehqqirvlldgrqlcdfthriqplslvkalrisgdvkltkv.................................
ENSTGUP00000002105  e.............................................................................
ENSTGUP00000005926  l.............................................................................
ENSTGUP00000003312  sgnlyhngeqtltlssftqgdfitcvldmeartisfgkngeepklafedvdaaelypcvmfyssnpgekvkicdmqmr
ENSTGUP00000006486  ftqpllpgfmiwfggltvttglqvp.....................................................
ENSTGUP00000017417  dqetllhkdkplkvgvfmelekktvsfysiadkeillhtfeintshplypafwly.......................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000005052  qetllhkdkplkvgvfmelekktvsfysiadkeillhtfeintshplypafwly........................
ENSTGUP00000000988  lkiklryqkpdeydqvlwtlsghqanywkegrvllhksvkhyqvviegeigkgtggiavddikidnh...........
ENSTGUP00000012350  qt............................................................................
ENSTGUP00000012758  dnsaplqlqmfdiicatswanrdkcce...................................................
ENSTGUP00000005462  aydgnrvrkwnvtttnygkswaagdivsclidldegtiafclngislgtafdnitrgagmayfpaislsfkesvafnf
ENSTGUP00000006169  mpq...........................................................................
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000010134  ..............................................................................
ENSTGUP00000013027  atleiqnfdivcspvwtsrdrccd......................................................
ENSTGUP00000012212  l.............................................................................
ENSTGUP00000017145  n.............................................................................
ENSTGUP00000009339  td............................................................................
ENSTGUP00000012283  md............................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000009346  ..............................................................................
ENSTGUP00000011096  etywqlhhvslnvtskfrvvfqgvkgsglsngglsiddinlsetqc................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000009346  td............................................................................
ENSTGUP00000013113  feiqwmvihcdplrpq..............................................................
ENSTGUP00000003411  erqce.........................................................................
ENSTGUP00000007370  eqdlvfgwssn...................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000000911  ptlpgnlqfclrfyyalygffkmsgilavyifeenhvvqekiwsvldspkgvwtqaeisfkkpmpckvvfvswcksfw
ENSTGUP00000014074  ..............................................................................
ENSTGUP00000012721  ..............................................................................
ENSTGUP00000003983  lalcragqptgdviawgqtpmallggvllqp...............................................
ENSTGUP00000013002  vpiefdlqrmviycdsrhaeletcc.....................................................
ENSTGUP00000000499  ..............................................................................
ENSTGUP00000009339  ..............................................................................
ENSTGUP00000005926  ..............................................................................
ENSTGUP00000005377  skphshpcwkegdtigflldlqekqmifylngnqlpaekqvfssavsgffaaasfmsyqqcefnfgakpfkyp.....
ENSTGUP00000013614  sdkliiwlkeddgtgnirkmrkiqtfqadsdsnwkiahvtlnaqkkfrylfqglkgnpssssggiaiddvtltetpc.
ENSTGUP00000015460  kgidcggayikllsssndlnllgtffdkhlklimfgpnrggehytlhf..............................
ENSTGUP00000002977  avrvnldgclstd.................................................................
ENSTGUP00000011574  agdscgtrgnvvgwgv..............................................................
ENSTGUP00000013208  eetvqfdiqklriycdpeqnnr........................................................
ENSTGUP00000003385  m.............................................................................
ENSTGUP00000002977  py............................................................................
ENSTGUP00000000499  ..............................................................................
ENSTGUP00000005001  ..............................................................................
ENSTGUP00000012283  ..............................................................................
ENSTGUP00000003494  fdiypsakaahhyckylkkqc.........................................................
ENSTGUP00000000911  lispkttvpisgclsfyyqlkqessivftvylrdmsgfyeeiwktdsalnadwalaevdfnapypmevifevafnsak
ENSTGUP00000006192  gadatprmc.....................................................................
ENSTGUP00000009636  ..............................................................................
ENSTGUP00000002624  ..............................................................................
ENSTGUP00000000797  ..............................................................................
ENSTGUP00000013145  ..............................................................................
ENSTGUP00000003828  ..............................................................................
ENSTGUP00000008611  velsyskngqelgvafkiskevldgrplfphvlchncavefnfgqkeepy............................
ENSTGUP00000015228  gekvgklrvflankkttpvweenkgkdekwrtgkieifqgaettnsitfesergkgktgeigvdnvmlisgpc.....
ENSTGUP00000012725  aaennpniking..................................................................
ENSTGUP00000002105  hslatpsktdpsvkigcrgpdvcasnp...................................................
ENSTGUP00000013146  ..............................................................................
ENSTGUP00000010269  gnpvwntsitatwsraelaistfwpnfyqvvfevvtsghsgyvaidevkvlghpct......................
ENSTGUP00000010196  tedqgeewregriilpsydmeyrivfeglirsghsgelalddirlg................................
ENSTGUP00000007726  gsvpfqlqslqilcssvgaeqdrcc.....................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017145  ..............................................................................
ENSTGUP00000008485  vgklrvflankkttpvweenkgkdekwrtgkveifqgaettnsitfesergkgktgeigvdnvmlisgpc........
ENSTGUP00000002833  ..............................................................................
ENSTGUP00000007830  pspcdsnpc.....................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000004439  e.............................................................................
ENSTGUP00000007218  slpeelnrtqtgnlvngcisdd........................................................
ENSTGUP00000008492  aedfdpreaynhgrlgrndrscclqwngqnyvawfggfecaihqpffhtigvfleysekaltfygvkdsk........
ENSTGUP00000001272  ywvsqmsktlmvglqklsedtvtniwqvsgelqnqwnintitinstekfevifsgmvetqgqgesvaidditfsegc.
ENSTGUP00000007218  essparpgcdrtew................................................................
ENSTGUP00000003750  klenkkvidclytc................................................................
ENSTGUP00000005281  kiesqkvisclqac................................................................
ENSTGUP00000000714  qaeiye........................................................................
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000004160  ..............................................................................
ENSTGUP00000003982  gwrqthitlrgvgiksvifrgekgkgrtgdiglddvvlrrgrc...................................
ENSTGUP00000002535  tfqatnscslvlychlhgsatsnlsisyvtnstkhlmrerigdlgscwvrervdfnvtdpfkvliegvagsggtvaid
ENSTGUP00000013650  gslesrevieclyac...............................................................
ENSTGUP00000002531  tfqatnscslvlychlhgsatsnlsisyvtnstkhlmrerigdlgscwvrervdfnvtdpfkvliegvagsggtvaid
ENSTGUP00000014137  e.............................................................................
ENSTGUP00000010869  eitfavnpndvtvhlpghqftfpnrlnlsvfdyldtqgdftlqslsw...............................
ENSTGUP00000006581  iipsaeasanyckyvkqqc...........................................................
ENSTGUP00000002535  ahkdevvelwqsperssegwhqlvaypgrimdqfqlifsltqpptcgaevalddimfrnc..................
ENSTGUP00000002531  ahkdevvelwqsperssegwhqlvaypgrimdqfqlifsltqpptcgaevalddimfrnc..................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000001266  srneenkw......................................................................
ENSTGUP00000016883  t.............................................................................
ENSTGUP00000012350  qevevedfqkysekvqaslygcpve.....................................................
ENSTGUP00000013146  tdcgytvc......................................................................
ENSTGUP00000012110  aelavstfwpneyqvifeaevsdgrngyiaiddiqvlsypc.....................................
ENSTGUP00000004798  ft............................................................................
ENSTGUP00000001382  thdvtspryeqdsghdsgsedtffdssqpctlvtlgmkkffipatpaapkdpasrilplpsclgicldcdrgrvgfyd
ENSTGUP00000012350  ..............................................................................
ENSTGUP00000012081  dksiiftlngellit...............................................................
ENSTGUP00000000911  qiattsdaspdparlnlylrqegesfdrllwstsepsdswliasldltngtnkyklvlegemrqdksasiavfeikit
ENSTGUP00000002977  fsgkf.........................................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000012486  nlpqegdvvgitydhvelnvylngknmhcpasgirgtvypvvyvddsaildcqfsefyhtpppgfe............
ENSTGUP00000010913  mnehtmmftlngeillddsgselafkdfevadgflpvcslgpsqvgrmnfgk..........................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000001856  elgsfanvtidmcaiidrc...........................................................
ENSTGUP00000010839  ..............................................................................
ENSTGUP00000011307  anlscdvkgnivdwenefwsiptsa.....................................................
ENSTGUP00000005592  iiafdnvslsld..................................................................
ENSTGUP00000003709  ie............................................................................
ENSTGUP00000000097  ynppdipkrftgnlsvlgsqgshlg.....................................................
ENSTGUP00000010913  agikvrfllgg...................................................................
ENSTGUP00000014278  ssv...........................................................................
ENSTGUP00000012086  ..............................................................................
ENSTGUP00000012081  sfringqpvqgmfenfstegfffpvvslsagvkvrfllggrhgefkflppagya........................
ENSTGUP00000010276  n.............................................................................
ENSTGUP00000001099  dnfiicteravaddwasdgwg.........................................................
ENSTGUP00000002570  yihsspsgsgsanppvvstvyayigtppaqrqlsslvwrlgpthfleevlpapgvstiyel.................
ENSTGUP00000013145  p.............................................................................
ENSTGUP00000009567  n.............................................................................
ENSTGUP00000010913  ncymvcageslspgqgrnnngleigclvdaasglltftangkelgtyyqvepstklfpavfaq...............
ENSTGUP00000002371  fdnfiicsekevadrwaadswg........................................................
ENSTGUP00000012081  esvkrsncymvwggdaiansqrsgrsnvdieigcfvdlatgmvsftangrelgtcyqvepntklfpatfl........


                                                                                               
                                                                                               
d1dyka1               .........................................................................
ENSTGUP00000016927  fsqemvffsdlkyecr.........................................................
ENSTGUP00000003709  rwflqhrpqigyirarfyegsdlvadsgvtidttmrggrlgvfcfsqeniiwsnlkyrcndt...........
ENSTGUP00000010031  vmvdsgpiydttfaggrlglfvfsqemvyfsdlkyecr...................................
ENSTGUP00000001099  .........................................................................
ENSTGUP00000011992  yir......................................................................
ENSTGUP00000014278  ktsyrwqlahrpqvgyir.......................................................
ENSTGUP00000014987  .........................................................................
ENSTGUP00000002371  ip.......................................................................
ENSTGUP00000000385  .........................................................................
ENSTGUP00000007869  .........................................................................
ENSTGUP00000003849  .........................................................................
ENSTGUP00000003292  .........................................................................
ENSTGUP00000015979  .........................................................................
ENSTGUP00000016008  .........................................................................
ENSTGUP00000000111  .........................................................................
ENSTGUP00000014546  .........................................................................
ENSTGUP00000006031  .........................................................................
ENSTGUP00000003669  gtltffknrkcigvaatklqnkkfypmvcstaakssmkvirscasrtslqylccfrl................
ENSTGUP00000005348  .........................................................................
ENSTGUP00000008609  .........................................................................
ENSTGUP00000017060  epdtepleilp..............................................................
ENSTGUP00000009828  ceggfviftavgekhnliykfkaqftealypafwlfssd..................................
ENSTGUP00000014507  .........................................................................
ENSTGUP00000010199  .........................................................................
ENSTGUP00000005117  .........................................................................
ENSTGUP00000008110  .........................................................................
ENSTGUP00000004907  vdkaekslkqapgsqiiffkngvsqgvafkdifegvyfpaislykgctvsinfgpyfky..............
ENSTGUP00000010725  .........................................................................
ENSTGUP00000005437  fttgdvigccvnlinntcfytknghslgiaftdlpsnlyptvglqtpgeivdanfgqqpfvfdiedymrewra
ENSTGUP00000013465  .........................................................................
ENSTGUP00000000911  agpc.....................................................................
ENSTGUP00000010911  .........................................................................
ENSTGUP00000010725  .........................................................................
ENSTGUP00000008902  .........................................................................
ENSTGUP00000007890  .........................................................................
ENSTGUP00000002179  .........................................................................
ENSTGUP00000013613  ivegec...................................................................
ENSTGUP00000009917  .........................................................................
ENSTGUP00000002689  .........................................................................
ENSTGUP00000002179  .........................................................................
ENSTGUP00000011992  .........................................................................
ENSTGUP00000013892  .........................................................................
ENSTGUP00000004653  .........................................................................
ENSTGUP00000005148  .........................................................................
ENSTGUP00000006286  .........................................................................
ENSTGUP00000001570  .........................................................................
ENSTGUP00000008379  .........................................................................
ENSTGUP00000006159  .........................................................................
ENSTGUP00000012721  .........................................................................
ENSTGUP00000009636  .........................................................................
ENSTGUP00000005001  .........................................................................
ENSTGUP00000001754  .........................................................................
ENSTGUP00000001756  .........................................................................
ENSTGUP00000001267  dltfsre..................................................................
ENSTGUP00000000484  .........................................................................
ENSTGUP00000007830  .........................................................................
ENSTGUP00000002179  .........................................................................
ENSTGUP00000001495  .........................................................................
ENSTGUP00000010031  .........................................................................
ENSTGUP00000017400  .........................................................................
ENSTGUP00000007223  .........................................................................
ENSTGUP00000010276  .........................................................................
ENSTGUP00000005926  .........................................................................
ENSTGUP00000004461  .........................................................................
ENSTGUP00000015340  .........................................................................
ENSTGUP00000000813  llnypc...................................................................
ENSTGUP00000002366  .........................................................................
ENSTGUP00000016735  .........................................................................
ENSTGUP00000002833  .........................................................................
ENSTGUP00000003828  .........................................................................
ENSTGUP00000013533  .........................................................................
ENSTGUP00000001271  .........................................................................
ENSTGUP00000010605  .........................................................................
ENSTGUP00000001337  .........................................................................
ENSTGUP00000005926  .........................................................................
ENSTGUP00000013493  p........................................................................
ENSTGUP00000005001  .........................................................................
ENSTGUP00000012721  .........................................................................
ENSTGUP00000005926  .........................................................................
ENSTGUP00000012721  .........................................................................
ENSTGUP00000000499  .........................................................................
ENSTGUP00000012721  .........................................................................
ENSTGUP00000001856  .........................................................................
ENSTGUP00000001856  .........................................................................
ENSTGUP00000012350  .........................................................................
ENSTGUP00000013256  .........................................................................
ENSTGUP00000001271  .........................................................................
ENSTGUP00000005001  .........................................................................
ENSTGUP00000013952  kgkc.....................................................................
ENSTGUP00000003772  .........................................................................
ENSTGUP00000011887  .........................................................................
ENSTGUP00000002105  .........................................................................
ENSTGUP00000005926  .........................................................................
ENSTGUP00000003312  gtprdllpgdpicspv.........................................................
ENSTGUP00000006486  .........................................................................
ENSTGUP00000017417  .........................................................................
ENSTGUP00000002833  .........................................................................
ENSTGUP00000005052  .........................................................................
ENSTGUP00000000988  .........................................................................
ENSTGUP00000012350  .........................................................................
ENSTGUP00000012758  .........................................................................
ENSTGUP00000005462  gsrplryplve..............................................................
ENSTGUP00000006169  .........................................................................
ENSTGUP00000002833  .........................................................................
ENSTGUP00000010134  .........................................................................
ENSTGUP00000013027  .........................................................................
ENSTGUP00000012212  .........................................................................
ENSTGUP00000017145  .........................................................................
ENSTGUP00000009339  .........................................................................
ENSTGUP00000012283  .........................................................................
ENSTGUP00000010839  .........................................................................
ENSTGUP00000009346  .........................................................................
ENSTGUP00000011096  .........................................................................
ENSTGUP00000004439  .........................................................................
ENSTGUP00000009346  .........................................................................
ENSTGUP00000013113  .........................................................................
ENSTGUP00000003411  .........................................................................
ENSTGUP00000007370  .........................................................................
ENSTGUP00000010839  .........................................................................
ENSTGUP00000000911  dcglvalddvslslgsc........................................................
ENSTGUP00000014074  .........................................................................
ENSTGUP00000012721  .........................................................................
ENSTGUP00000003983  .........................................................................
ENSTGUP00000013002  .........................................................................
ENSTGUP00000000499  .........................................................................
ENSTGUP00000009339  .........................................................................
ENSTGUP00000005926  .........................................................................
ENSTGUP00000005377  .........................................................................
ENSTGUP00000013614  .........................................................................
ENSTGUP00000015460  .........................................................................
ENSTGUP00000002977  .........................................................................
ENSTGUP00000011574  .........................................................................
ENSTGUP00000013208  .........................................................................
ENSTGUP00000003385  .........................................................................
ENSTGUP00000002977  .........................................................................
ENSTGUP00000000499  .........................................................................
ENSTGUP00000005001  .........................................................................
ENSTGUP00000012283  .........................................................................
ENSTGUP00000003494  .........................................................................
ENSTGUP00000000911  ggyvalddisfspvyc.........................................................
ENSTGUP00000006192  .........................................................................
ENSTGUP00000009636  .........................................................................
ENSTGUP00000002624  .........................................................................
ENSTGUP00000000797  .........................................................................
ENSTGUP00000013145  .........................................................................
ENSTGUP00000003828  .........................................................................
ENSTGUP00000008611  .........................................................................
ENSTGUP00000015228  .........................................................................
ENSTGUP00000012725  .........................................................................
ENSTGUP00000002105  .........................................................................
ENSTGUP00000013146  .........................................................................
ENSTGUP00000010269  .........................................................................
ENSTGUP00000010196  .........................................................................
ENSTGUP00000007726  .........................................................................
ENSTGUP00000004439  .........................................................................
ENSTGUP00000017145  .........................................................................
ENSTGUP00000008485  .........................................................................
ENSTGUP00000002833  .........................................................................
ENSTGUP00000007830  .........................................................................
ENSTGUP00000013892  .........................................................................
ENSTGUP00000004439  .........................................................................
ENSTGUP00000007218  .........................................................................
ENSTGUP00000008492  .........................................................................
ENSTGUP00000001272  .........................................................................
ENSTGUP00000007218  .........................................................................
ENSTGUP00000003750  .........................................................................
ENSTGUP00000005281  .........................................................................
ENSTGUP00000000714  .........................................................................
ENSTGUP00000012350  .........................................................................
ENSTGUP00000004160  .........................................................................
ENSTGUP00000003982  .........................................................................
ENSTGUP00000002535  dlilsqgc.................................................................
ENSTGUP00000013650  .........................................................................
ENSTGUP00000002531  dlilsqgc.................................................................
ENSTGUP00000014137  .........................................................................
ENSTGUP00000010869  .........................................................................
ENSTGUP00000006581  .........................................................................
ENSTGUP00000002535  .........................................................................
ENSTGUP00000002531  .........................................................................
ENSTGUP00000007218  .........................................................................
ENSTGUP00000001266  .........................................................................
ENSTGUP00000016883  .........................................................................
ENSTGUP00000012350  .........................................................................
ENSTGUP00000013146  .........................................................................
ENSTGUP00000012110  .........................................................................
ENSTGUP00000004798  .........................................................................
ENSTGUP00000001382  agrmkclyecevdcsglmypafalmgsaav...........................................
ENSTGUP00000012350  .........................................................................
ENSTGUP00000012081  .........................................................................
ENSTGUP00000000911  sgyc.....................................................................
ENSTGUP00000002977  .........................................................................
ENSTGUP00000010839  .........................................................................
ENSTGUP00000012486  .........................................................................
ENSTGUP00000010913  .........................................................................
ENSTGUP00000010839  .........................................................................
ENSTGUP00000001856  .........................................................................
ENSTGUP00000010839  .........................................................................
ENSTGUP00000011307  .........................................................................
ENSTGUP00000005592  .........................................................................
ENSTGUP00000003709  .........................................................................
ENSTGUP00000000097  .........................................................................
ENSTGUP00000010913  .........................................................................
ENSTGUP00000014278  .........................................................................
ENSTGUP00000012086  .........................................................................
ENSTGUP00000012081  .........................................................................
ENSTGUP00000010276  .........................................................................
ENSTGUP00000001099  .........................................................................
ENSTGUP00000002570  .........................................................................
ENSTGUP00000013145  .........................................................................
ENSTGUP00000009567  .........................................................................
ENSTGUP00000010913  .........................................................................
ENSTGUP00000002371  .........................................................................
ENSTGUP00000012081  .........................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046423 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma mobile 163K
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus proteolyticus MRP
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Ruminococcus sp.
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Eubacterium eligens ATCC 27750
NoYes   Clostridium difficile 630
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Elusimicrobium minutum Pei191
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Nitratiruptor sp. SB155-2
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax citrulli AAC00-1
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Pusillimonas sp. T7-7
NoYes   Bordetella avium 197N
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Hyphomicrobium sp. MC1
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Salmonella bongori NCTC 12419
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Methylophaga sp. JAM1
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Nanoarchaeum equitans Kin4-M
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Metallosphaera cuprina Ar-4
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta concilii GP6
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanocorpusculum labreanum Z
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus marisnigri JR1
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus vulcanius M7
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma apis B31
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes