SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

SH3-domain alignments in Myotis lucifugus 76_2.0

These alignments are sequences aligned to the 0049867 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                    10        20        30          
                                                                     |         |         |          
d1udla_               ...................................gss---GSSGQKGWFPASHVKLLGPSSERATPAFHP.......
ENSMLUP00000003159  ........irqereqqaaiqlerakskpvafavktnvs---------------------------------.......
ENSMLUP00000006192  ........................llknisgsvtlkil-----------------------PSYRDTIIPQ.......
ENSMLUP00000001660  .................................tkpva---------------------------------.......
ENSMLUP00000010880  ...................mketkgiislkvipnqqnr-----------------------------LPAL.......
ENSMLUP00000010026  arrevesqaqqqlerakhkpvafavrtnvsycgvldee---------------------------------.......
ENSMLUP00000016306  ............lknisgsvtlkilpsyrdtiipqqsg----------------------ISMERHPAHVR.......
ENSMLUP00000002731  ..................................ttqp------------------------------KGR.......
ENSMLUP00000012398  .........................llrsasgsvilki----------------------LPSYQEPHLPR.......
ENSMLUP00000007590  .........................kihdlreqmmnss-------------------ISSGSGSLRTSQKR.......
ENSMLUP00000001366  ..................ilaqsqgaitfkiipsikee---------------------------TPSKEG.......
ENSMLUP00000005694  ...........................sdmhgtltfvl-------------------IPSQQIKPPPAKET.......
ENSMLUP00000016016  ........................ilamsrgtimfkvv----------------------PVSDPPVNSQK.......
ENSMLUP00000013902  ......................................---------------------------------.......
ENSMLUP00000006692  .............................nssshtgtl--------------------------RTRGGTG.......
ENSMLUP00000018425  ......................................---------------------------------.......
ENSMLUP00000002338  ......................................---------------------------------.......
ENSMLUP00000010190  .........................kihdlreqmmnss-------------------MSSGSGSLRTSEKR.......
ENSMLUP00000002296  ......................................---------GWFPASHVKLLGPSSERTTPAFHP.......
ENSMLUP00000013892  ....................................ql---------------------------------.......
ENSMLUP00000016474  .....................................s---------------------PGTSKVTPTEPP.......
ENSMLUP00000004080  ...........................fggfnssdtvt----------------------SPQRAGPLAGG.......
ENSMLUP00000013902  ......................................---------------------------------.......
ENSMLUP00000013066  ...................................ekl---------------------------------.......
ENSMLUP00000002474  ...................................iin----SSGPRPPVPPSPAQPPPGVSPSRLRIGDQefdslpa
ENSMLUP00000010063  ...................................aea-----------------------------PWPQ.......
ENSMLUP00000007412  .....................................p--------------------------PWAPRSY.......
ENSMLUP00000011783  ....................................kd---------------------------------.......
ENSMLUP00000007133  ....................................ql---------------------------------.......
ENSMLUP00000005117  .....................rylqpggeqlainelis------------------------------DGS.......
ENSMLUP00000005919  ....................................tn--------------------------PPASPLQ.......
ENSMLUP00000011432  ....................................qq---------------------PPKHPLRKDVGP.......
ENSMLUP00000001119  ...................................vpm--------------------------------D.......
ENSMLUP00000010330  ...................................rsm-----------------------------PPLD.......
ENSMLUP00000002843  ..................................qrqs-----------PPASPAPQPAPERPPSSPVYEDavsmkae
ENSMLUP00000011946  ....................................gn---------------------------------.......
ENSMLUP00000002942  .............ilaqsqgsitlkiipatqeedrlke--------------------------------S.......
ENSMLUP00000008920  .....................................k---------------------------------.......
ENSMLUP00000000496  ...................................hpp--------------PPPSQYPPAPPP------Aqqrylqh
ENSMLUP00000013320  .....................................p---------------------------PLQPPR.......
ENSMLUP00000017214  ...........................fggfnssdtvt----------------------SPQRAGPLAGG.......
ENSMLUP00000021229  ..................................wapk-------------------------------NY.......
ENSMLUP00000008092  ..................................wapk-------------------------------NY.......
ENSMLUP00000001413  ..................................tgqv---------------------------------.......
ENSMLUP00000013669  ...................................eee---------------------------------.......
ENSMLUP00000002497  .....................................p-------------------PSSTPFWSVLSPKV.......
ENSMLUP00000015970  ...................................stl-------------------YPSTSNLLTNHQHE.......
ENSMLUP00000001413  .....................................a---------------------------------.......
ENSMLUP00000015518  .............................neyklypel---------------------PSYPERVGNSSR.......
ENSMLUP00000013530  ...................................qgd---------------------------------.......
ENSMLUP00000001958  .....................................a---------------------------------.......
ENSMLUP00000011783  .....................................r---------------------------------.......
ENSMLUP00000000207  ....................................sv---------------------------------.......
ENSMLUP00000007093  ..................................agag---------------------------------.......
ENSMLUP00000013066  .....................................p----------------------ARPPPPAQPGE.......
ENSMLUP00000003166  ...............................lypsaev---------------------------QLNNKV.......
ENSMLUP00000007433  .......................fmdklaskklcadde-----------------------------CVYT.......
ENSMLUP00000007981  .....................................a---------------------------------.......
ENSMLUP00000005897  ...............................ssltcdn-----------------------PPDYLRTVFY.......
ENSMLUP00000005860  ....................................pp---------------------------VRGIPQ.......
ENSMLUP00000009512  ....................................gp-----------------------------PTLP.......
ENSMLUP00000002296  ..................................ekse-----------------------------PASE.......
ENSMLUP00000007216  ....................................ar---------------------------------.......
ENSMLUP00000001866  .............................kpqgpgnkq------------------------SPKLITGDS.......
ENSMLUP00000003210  ....................................lq---------------------------------.......
ENSMLUP00000008920  ...................................ikk---------------------------------.......
ENSMLUP00000013622  .................................taeen---------------------------------.......
ENSMLUP00000007577  .....................................v---------------------------------.......
ENSMLUP00000007981  ....................................lh---------------------------------.......
ENSMLUP00000015831  ....................................ap---------------------------------.......
ENSMLUP00000009890  ...................................ygg---------------YKEPAAPVSTQRSAPSGG.......
ENSMLUP00000001358  ....................................ls---------------------------------.......
ENSMLUP00000004195  .....................................e---------------------------------.......
ENSMLUP00000007864  .................................aayan---------------------------------.......
ENSMLUP00000010897  .................................shsqg-------------YGYMHQTSLSSMRSMQHSPN.......
ENSMLUP00000006579  ...................................dpn---------------------------------.......
ENSMLUP00000019391  .....................................d------SQTPPPPLPPDNIPMFDDSPPPPPPPPvdykdee
ENSMLUP00000001358  ...................................alk---------------------------------.......
ENSMLUP00000005860  ..................................rpqt--------------------------------R.......
ENSMLUP00000010009  ..............................niddtakr----------------------------KSGSE.......
ENSMLUP00000016474  ....................................vk---------------------------------.......
ENSMLUP00000008018  ...................................dpn---------------------------------.......
ENSMLUP00000014609  ....................................re---------------------------------.......
ENSMLUP00000009299  ...................................ptf---------------------------------.......
ENSMLUP00000006831  ..................................etgk---------------------------------.......
ENSMLUP00000003954  .....................................k------------------PLPPEPTAAPVSTSE.......
ENSMLUP00000011645  .....................................t--------------------PEPSPALVASVPA.......
ENSMLUP00000012000  ....................................mi---------------------------------.......
ENSMLUP00000013586  ....................................np------------------------------SMP.......
ENSMLUP00000002296  ...................................ytv---------------------------------.......
ENSMLUP00000010009  ..............................spqqpqaq-------------------QRRVTPDRSQASQD.......
ENSMLUP00000007216  ...................................phk-------------------------PPTYQVLE.......
ENSMLUP00000016474  ...................................veg---------------------------------.......
ENSMLUP00000001012  ...................................mdg---------------------------------.......
ENSMLUP00000017975  ....................................qn---------------------------------.......
ENSMLUP00000018941  ....................................ld---------------------------------.......
ENSMLUP00000005582  ...............................srggari---------------------------------.......
ENSMLUP00000017787  ...................................vvp-----------------------SSYPAGLTGG.......
ENSMLUP00000015689  ....................................aq---------------------------------.......
ENSMLUP00000002296  .....................................v---NTSWQKKSAFTRTVSPGSVSPIHGQGQVVE.......
ENSMLUP00000008920  ......................................---------------------------------.......
ENSMLUP00000012000  ....................................ee---------------------------------.......
ENSMLUP00000004960  ....................................hr---------------------------------.......
ENSMLUP00000016474  ................................aakpal--------------------------------S.......
ENSMLUP00000007216  ..................................inwt---------------------------------.......
ENSMLUP00000018941  ..................................pvvq---------------------------------.......
ENSMLUP00000007615  ...................................mnk---------------------------------.......
ENSMLUP00000017501  ....................................vd------------------------------PMV.......
ENSMLUP00000005582  .....................................p----------------------PEPVSSASLRA.......
ENSMLUP00000013066  ..................................iqgg---------------------------------.......
ENSMLUP00000004531  .................................aekkt---------------------PDDKHKQPGFQQ.......
ENSMLUP00000014222  ....................................ee---------------------------------.......
ENSMLUP00000001012  ...................................lsa---------------------------------.......
ENSMLUP00000011016  ......................................YMLDLQKQLGSFPSSYHSNNNQTSVVPVPSASSnvigssa
ENSMLUP00000014075  ....................................eg---------------------------------.......
ENSMLUP00000016089  .................................prkaa--------------------------------T.......
ENSMLUP00000014075  .................................raleg---------------------------------.......
ENSMLUP00000010551  ..................................avaa---------------------------------.......
ENSMLUP00000011784  ...................................lrp---------------------------------.......
ENSMLUP00000016474  ...................................kkp---------------------------------.......
ENSMLUP00000014409  .....................................l---------------------------------.......
ENSMLUP00000013262  .....................................p---------------------------------.......
ENSMLUP00000014923  ....................................iw---------------------------------.......
ENSMLUP00000004002  ....................................tp----------------------------RPVQP.......
ENSMLUP00000020771  ....................................iw---------------------------------.......
ENSMLUP00000007028  .....................................p-----------------------PLPPPEVAEE.......
ENSMLUP00000010009  ................................pvqile---------------------------------.......
ENSMLUP00000018941  ..................................smaa------------------------ARPEPKPFP.......
ENSMLUP00000010822  ........................fndvkvpspsallg-------------------------DNPTPFGN.......
ENSMLUP00000015288  ...................................nkg---------------------------------.......
ENSMLUP00000013669  ....................................vd------------------------------PMV.......
ENSMLUP00000022476  ...................................tkk------------------RRPPPPIPPEEEDNS.......
ENSMLUP00000011542  .................................sealg---------------------------------.......
ENSMLUP00000011542  .................................pdeed------------------------------EQP.......
ENSMLUP00000016384  ...................................qel-----------------------------PPGF.......
ENSMLUP00000005860  .....................................s----LDSAVPIAPPPRQPCSSLGSVMNESRPVV.......
ENSMLUP00000003137  ................................tqqttv-----------------------SSIPSHPSTA.......
ENSMLUP00000016884  ..................................eapa------------------------------APK.......
ENSMLUP00000015858  ..............................rrtkfvsf---------------------------TSRLLD.......
ENSMLUP00000012406  .....................................e---------------------------------.......
ENSMLUP00000009292  .....................................l---------------------------------.......
ENSMLUP00000001413  .....................................v---------------------------------.......
ENSMLUP00000012000  .........................pcptkkgregqat---------------------------------.......
ENSMLUP00000007949  ...................................ept---------------------------------.......
ENSMLUP00000001358  .................................kpvds--------------------------------S.......
ENSMLUP00000005582  ..............................peevlahq------------------------------DLP.......
ENSMLUP00000012019  .....................................m---------------------------------.......
ENSMLUP00000007621  .................................gnppg---------------------------PRRGSK.......
ENSMLUP00000000109  .........................ghhnefdddfedd----------------------------DPLPA.......
ENSMLUP00000012976  ....................................gv---------------------------------.......
ENSMLUP00000010504  ..................................cyds---------------------------------.......
ENSMLUP00000007384  ...................................pkl-------------SPFLSCPPATPADKPPESVT.......
ENSMLUP00000002099  ..................................pdrt--------------------------------S.......
ENSMLUP00000010226  .....................................l---DLQKQLGRFPGTFVGTTEPASPPLSSTSPTttaatmp
ENSMLUP00000001012  ....................................lp-------------------------------QP.......
ENSMLUP00000012000  .....................................p-------------------------KPPEPPSV.......
ENSMLUP00000014043  ....................................eg---------------------------------.......
ENSMLUP00000017916  ............................ppnpsptspl-----------------SPSWPMFSAPSS---Pmptssts
ENSMLUP00000002503  ....................................ie---------------------------------.......
ENSMLUP00000009446  .................................eeveq---------------------------------.......
ENSMLUP00000013179  .................................stdya---------------------------------.......
ENSMLUP00000006973  ...................................hpe---------------------------------.......
ENSMLUP00000013630  .....................................r---------------------------------.......
ENSMLUP00000012141  .....................................t---------------------------------.......
ENSMLUP00000013669  .....................................p-------------------------KPPIPPQV.......
ENSMLUP00000006358  ...............................mslltsp----------------HQPPPPPPASASPSAVPngpqspk
ENSMLUP00000002296  ................................gasnkk---------------------------------.......
ENSMLUP00000006507  ..................................pavg---------------------------------.......
ENSMLUP00000011422  .....................................k---------------------------------.......
ENSMLUP00000008265  .....................................v---------------------------------.......
ENSMLUP00000011428  ....................................ie---------------------------------.......
ENSMLUP00000002679  ....ekeekdfrkkfkydgeirvlysttvvpsltskkw---------------------------------.......
ENSMLUP00000018941  .....................................p-------------------------------PT.......
ENSMLUP00000005860  ....................................pl------------------------------PQP.......
ENSMLUP00000011542  ..................................ipdy--------------------------------S.......
ENSMLUP00000020371  ...............................lsffffn--------------------------------F.......
ENSMLUP00000011542  ................................raslla-----------------------------RYPP.......
ENSMLUP00000000496  ......................................---------------------------------.......
ENSMLUP00000010676  ...................................sgs---------------------------------.......
ENSMLUP00000011698  ..........................tkllanfkkcad---------------------------VECETL.......
ENSMLUP00000009701  .....................................g---------------------------------.......
ENSMLUP00000004596  .....................................s---------------------------------.......
ENSMLUP00000020371  ..............................tdthrskl---------------------------LSTYTT.......
ENSMLUP00000000207  .....................................p---------------------------------.......
ENSMLUP00000014421  ....................................pk---------------------------------.......
ENSMLUP00000013929  ..........................sqasreikqllr-----------------------------EASG.......
ENSMLUP00000003615  ....................................eg---------------------------------.......
ENSMLUP00000019445  .....................................e--------------------------PPYRGPF.......
ENSMLUP00000003921  .....................................l---------------------------------.......
ENSMLUP00000002679  ..................ekkeqeikkkfkltgpievi---------------------------------.......
ENSMLUP00000001797  .....................................s------------PSPGSGSFGEEPPAPQYTGPF.......
ENSMLUP00000007922  .................................pkesq---------------------QEPHAPALPSKP.......
ENSMLUP00000016884  ................................agrdta---------------------------------.......
ENSMLUP00000021898  .............................tnwasgedd---------------------------------.......
ENSMLUP00000018532  ...ekaerefrkkfkfegeiviqtkmmidpnaktrrgg---------------------------------.......
ENSMLUP00000006141  ...ekaerefrkkfkfegeiviqtkmmidpnaktrrgg---------------------------------.......
ENSMLUP00000012243  ....................................hr---------------------------------.......
ENSMLUP00000007949  .....................................p-----------------------VPPALATRPF.......
ENSMLUP00000010409  ....................................gq---------------------------------.......
ENSMLUP00000000120  ....................................yq---------------------------------.......
ENSMLUP00000002448  ....................................et---------------------------------.......
ENSMLUP00000006631  .....................................g---------------------------------.......
ENSMLUP00000013267  ....................................le---------------------PPAAVLGSPPAP.......
ENSMLUP00000002140  .................................gtssm---------------------------------.......
ENSMLUP00000009401  .....................................e--------------------------PPYRGPF.......
ENSMLUP00000011645  .......................erqvqalltkygpgk---------------------------------.......
ENSMLUP00000000142  .......qiscllfiwlpkmevcqeyygippppgalgp---------------------------------.......
ENSMLUP00000013622  .................................aainp--------------------------LPSTQNG.......
ENSMLUP00000002497  ..............................tsrqvdag---------------------------------.......
ENSMLUP00000013669  ...................................apf---------------------------PSADSP.......
ENSMLUP00000008144  ...........................rhtrppdppas-------------------APPDSSS------Ssnsgsqe
ENSMLUP00000004680  .................................nmmkr---------------------------------.......
ENSMLUP00000010492  ....................................va--------------------------PPEPVED.......
ENSMLUP00000011542  ...................................ege---------------------------------.......
ENSMLUP00000000726  .................................ssssn---------------------------------.......
ENSMLUP00000016884  ...............................pqgnprg----------------------------PPLCT.......
ENSMLUP00000002474  ........................hpqplggpepgpya-------------------QPSVNTPLPNLQNG.......
ENSMLUP00000013417  .............slgepppppraslssdtsalsydsv--------------------------------Kytlvvde
ENSMLUP00000012000  .................................qrngi------------PVSPVRPKPIEKSQFI-HNNL.......
ENSMLUP00000001859  ......................................---------------------------------.......
ENSMLUP00000016646  ...............................geagsgt---------------------------------.......
ENSMLUP00000009616  ....................................pg---------------------------------.......
ENSMLUP00000010476  .....................................f---------------------------------.......
ENSMLUP00000003844  ....................................gp--------------------------------F.......
ENSMLUP00000012979  ......eklfrerfeydkeitvintavacsrnsrngif---------------------------------.......
ENSMLUP00000010870  ..................................lsgk---------------------------------.......
ENSMLUP00000004205  .....................................t---------------------------------.......
ENSMLUP00000000726  .........................rtsqntldsdkls-------------------------------GG.......
ENSMLUP00000008845  ...................................ksl-----------PSPSSSPSVQDQGPVPMQPERR.......
ENSMLUP00000012305  ....................................ts---------------RPNPAGGRPKPQPKPKPQ.......
ENSMLUP00000000937  .................................sqgpq---------------------------------.......
ENSMLUP00000002140  ..................................sggc---------------------------------.......
ENSMLUP00000016537  ................................eaqptd---------------------------------.......
ENSMLUP00000015982  ................................eaqptd---------------------------------.......
ENSMLUP00000009378  .....................wflknypgscglprkrd-------------------------WTGSYQIG.......
ENSMLUP00000001358  ..................................vssh-----------------------------CVNK.......
ENSMLUP00000010676  .....................rlhclqpfstqdtrgqp---------------------------------.......
ENSMLUP00000011918  .....................................a---------------------------------.......
ENSMLUP00000006188  .....................................d---------------------------------.......
ENSMLUP00000004439  .....................................f---------------------------------.......
ENSMLUP00000004210  ......................................---------------------------------.......
ENSMLUP00000015169  .........................kyvvalqdnpnpa---------------------------------.......
ENSMLUP00000013320  ......................................---------------------------------.......
ENSMLUP00000000142  ................................agstky---------------------------------.......
ENSMLUP00000006936  .....................................v---------------------------------.......
ENSMLUP00000010147  ...................................ffi---------------------------------.......
ENSMLUP00000009801  ....................................fy---------------------------------.......
ENSMLUP00000018134  ...................lipcvlhvvhkvylfslat---------------------------------.......
ENSMLUP00000016407  .....................................h---------------------------------.......
ENSMLUP00000010152  ......................lavltdypspdisppi---------------------------------.......
ENSMLUP00000009378  ....................................eq---------------------------------.......
ENSMLUP00000020593  .....................................e---------------------------------.......
ENSMLUP00000019238  ...................lipcvlhvvhkvylfslat---------------------------------.......
ENSMLUP00000001358  .........lpprpkpghplyrkymlsvphgianeniv---------------------------------.......
ENSMLUP00000000215  ..................................ditg------------------------------PII.......
ENSMLUP00000004531  ...................................erv---------------------------------.......
ENSMLUP00000001760  ...................................tee---------------------------------.......


                                                                                                    
                                                                                                    
d1udla_               ..............................................................................
ENSMLUP00000003159  ..............................................................................
ENSMLUP00000006192  ..............................................................................
ENSMLUP00000001660  ..............................................................................
ENSMLUP00000010880  ..............................................................................
ENSMLUP00000010026  ..............................................................................
ENSMLUP00000016306  ..............................................................................
ENSMLUP00000002731  ..............................................................................
ENSMLUP00000012398  ..............................................................................
ENSMLUP00000007590  ..............................................................................
ENSMLUP00000001366  ..............................................................................
ENSMLUP00000005694  ..............................................................................
ENSMLUP00000016016  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000006692  ..............................................................................
ENSMLUP00000018425  ..............................................................................
ENSMLUP00000002338  ..............................................................................
ENSMLUP00000010190  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000004080  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000002474  llefykihyldtttliepvsrsrqgsgvnlrqee............................................
ENSMLUP00000010063  ..............................................................................
ENSMLUP00000007412  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000005919  ..............................................................................
ENSMLUP00000011432  ..............................................................................
ENSMLUP00000001119  ..............................................................................
ENSMLUP00000010330  ..............................................................................
ENSMLUP00000002843  psyrgpvsepepvysreatdyreaggqqglaytpeavytsteapghypeeentydeyendl.................
ENSMLUP00000011946  ..............................................................................
ENSMLUP00000002942  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000000496  hhfhqerrggsldindghcglgmgmgsemnatlmhrrhtdpvqlqvagr.............................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000017214  ..............................................................................
ENSMLUP00000021229  ..............................................................................
ENSMLUP00000008092  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000015970  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000015518  ..............................................................................
ENSMLUP00000013530  ..............................................................................
ENSMLUP00000001958  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000007093  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000003166  ..............................................................................
ENSMLUP00000007433  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000005897  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000009512  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000003210  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000007577  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000015831  ..............................................................................
ENSMLUP00000009890  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000004195  ..............................................................................
ENSMLUP00000007864  ..............................................................................
ENSMLUP00000010897  ..............................................................................
ENSMLUP00000006579  ..............................................................................
ENSMLUP00000019391  aalvhyndpyadgdpawapkny........................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000008018  ..............................................................................
ENSMLUP00000014609  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000006831  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000017975  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000017787  ..............................................................................
ENSMLUP00000015689  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000004960  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000007615  ..............................................................................
ENSMLUP00000017501  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000014222  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000011016  mtssglvmtspsnlidlkegsg........................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000016089  ..............................................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000010551  ..............................................................................
ENSMLUP00000011784  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000013262  ..............................................................................
ENSMLUP00000014923  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000020771  ..............................................................................
ENSMLUP00000007028  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000010822  ..............................................................................
ENSMLUP00000015288  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000016384  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000003137  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000012406  ..............................................................................
ENSMLUP00000009292  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000012019  ..............................................................................
ENSMLUP00000007621  ..............................................................................
ENSMLUP00000000109  ..............................................................................
ENSMLUP00000012976  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000010226  mepsvagpappgeaalcleevappasg...................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000014043  ..............................................................................
ENSMLUP00000017916  sdsspirsvagfvwfsvaavvlslawsslhavfsllvnfvpchpnlhllfdrpeeavhedsst...............
ENSMLUP00000002503  ..............................................................................
ENSMLUP00000009446  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000006973  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000012141  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000006358  qqkeplshrfnefmtskpkihcfrslkrglslklgaapedfsnlppeqrrkklqqkvdelnkeiqkemdqreaitkmk
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000006507  ..............................................................................
ENSMLUP00000011422  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000011428  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011698  ..............................................................................
ENSMLUP00000009701  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000013929  ..............................................................................
ENSMLUP00000003615  ..............................................................................
ENSMLUP00000019445  ..............................................................................
ENSMLUP00000003921  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000001797  ..............................................................................
ENSMLUP00000007922  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000021898  ..............................................................................
ENSMLUP00000018532  ..............................................................................
ENSMLUP00000006141  ..............................................................................
ENSMLUP00000012243  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000000120  ..............................................................................
ENSMLUP00000002448  ..............................................................................
ENSMLUP00000006631  ..............................................................................
ENSMLUP00000013267  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009401  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000008144  nkesseeppleegqdtpiytefdedfeesasp..............................................
ENSMLUP00000004680  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000013417  haqlelvslrpcfgdysdesdsatvydncasasspyesaigeeyeeaprprpsaclsedstpdepdvhfskkflnvfm
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000001859  ..............................................................................
ENSMLUP00000016646  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000010476  ..............................................................................
ENSMLUP00000003844  ..............................................................................
ENSMLUP00000012979  ..............................................................................
ENSMLUP00000010870  ..............................................................................
ENSMLUP00000004205  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000008845  ..............................................................................
ENSMLUP00000012305  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000016537  ..............................................................................
ENSMLUP00000015982  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011918  ..............................................................................
ENSMLUP00000006188  ..............................................................................
ENSMLUP00000004439  ..............................................................................
ENSMLUP00000004210  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000006936  ..............................................................................
ENSMLUP00000010147  ..............................................................................
ENSMLUP00000009801  ..............................................................................
ENSMLUP00000018134  ..............................................................................
ENSMLUP00000016407  ..............................................................................
ENSMLUP00000010152  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000020593  ..............................................................................
ENSMLUP00000019238  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000000215  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000001760  ..............................................................................


                                                                                                    
                                                                                                    
d1udla_               ..............................................................................
ENSMLUP00000003159  ..............................................................................
ENSMLUP00000006192  ..............................................................................
ENSMLUP00000001660  ..............................................................................
ENSMLUP00000010880  ..............................................................................
ENSMLUP00000010026  ..............................................................................
ENSMLUP00000016306  ..............................................................................
ENSMLUP00000002731  ..............................................................................
ENSMLUP00000012398  ..............................................................................
ENSMLUP00000007590  ..............................................................................
ENSMLUP00000001366  ..............................................................................
ENSMLUP00000005694  ..............................................................................
ENSMLUP00000016016  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000006692  ..............................................................................
ENSMLUP00000018425  ..............................................................................
ENSMLUP00000002338  ..............................................................................
ENSMLUP00000010190  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000004080  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000010063  ..............................................................................
ENSMLUP00000007412  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000005919  ..............................................................................
ENSMLUP00000011432  ..............................................................................
ENSMLUP00000001119  ..............................................................................
ENSMLUP00000010330  ..............................................................................
ENSMLUP00000002843  ..............................................................................
ENSMLUP00000011946  ..............................................................................
ENSMLUP00000002942  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000017214  ..............................................................................
ENSMLUP00000021229  ..............................................................................
ENSMLUP00000008092  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000015970  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000015518  ..............................................................................
ENSMLUP00000013530  ..............................................................................
ENSMLUP00000001958  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000007093  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000003166  ..............................................................................
ENSMLUP00000007433  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000005897  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000009512  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000003210  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000007577  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000015831  ..............................................................................
ENSMLUP00000009890  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000004195  ..............................................................................
ENSMLUP00000007864  ..............................................................................
ENSMLUP00000010897  ..............................................................................
ENSMLUP00000006579  ..............................................................................
ENSMLUP00000019391  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000008018  ..............................................................................
ENSMLUP00000014609  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000006831  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000017975  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000017787  ..............................................................................
ENSMLUP00000015689  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000004960  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000007615  ..............................................................................
ENSMLUP00000017501  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000014222  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000011016  ..............................................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000016089  ..............................................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000010551  ..............................................................................
ENSMLUP00000011784  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000013262  ..............................................................................
ENSMLUP00000014923  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000020771  ..............................................................................
ENSMLUP00000007028  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000010822  ..............................................................................
ENSMLUP00000015288  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000016384  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000003137  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000012406  ..............................................................................
ENSMLUP00000009292  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000012019  ..............................................................................
ENSMLUP00000007621  ..............................................................................
ENSMLUP00000000109  ..............................................................................
ENSMLUP00000012976  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000010226  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000014043  ..............................................................................
ENSMLUP00000017916  ..............................................................................
ENSMLUP00000002503  ..............................................................................
ENSMLUP00000009446  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000006973  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000012141  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000006358  dvylknpqmgdpasldhklteviqnidklrleaqkfeawlaevegrlpargeqrrqsglydaqpapavnncaqaresr
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000006507  ..............................................................................
ENSMLUP00000011422  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000011428  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011698  ..............................................................................
ENSMLUP00000009701  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000013929  ..............................................................................
ENSMLUP00000003615  ..............................................................................
ENSMLUP00000019445  ..............................................................................
ENSMLUP00000003921  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000001797  ..............................................................................
ENSMLUP00000007922  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000021898  ..............................................................................
ENSMLUP00000018532  ..............................................................................
ENSMLUP00000006141  ..............................................................................
ENSMLUP00000012243  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000000120  ..............................................................................
ENSMLUP00000002448  ..............................................................................
ENSMLUP00000006631  ..............................................................................
ENSMLUP00000013267  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009401  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000008144  ..............................................................................
ENSMLUP00000004680  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000013417  sgrsrsssaesfglfscvingeeq......................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000001859  ..............................................................................
ENSMLUP00000016646  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000010476  ..............................................................................
ENSMLUP00000003844  ..............................................................................
ENSMLUP00000012979  ..............................................................................
ENSMLUP00000010870  ..............................................................................
ENSMLUP00000004205  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000008845  ..............................................................................
ENSMLUP00000012305  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000016537  ..............................................................................
ENSMLUP00000015982  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011918  ..............................................................................
ENSMLUP00000006188  ..............................................................................
ENSMLUP00000004439  ..............................................................................
ENSMLUP00000004210  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000006936  ..............................................................................
ENSMLUP00000010147  ..............................................................................
ENSMLUP00000009801  ..............................................................................
ENSMLUP00000018134  ..............................................................................
ENSMLUP00000016407  ..............................................................................
ENSMLUP00000010152  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000020593  ..............................................................................
ENSMLUP00000019238  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000000215  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000001760  ..............................................................................


                                                              40                         50        6
                                                               |                          |         
d1udla_               ...................................VCQVIAMYDY..AAN........NED.......ELSFSKGQLI
ENSMLUP00000003159  ...................................--YCGALDED..VPV........PST.......AISFDAKDFL
ENSMLUP00000006192  ...................................QVFVKCHFDY..NPY........NDNlipckeaGLKFSKGEIL
ENSMLUP00000001660  ...................................-FAVRTNVSY..SAA........HEDdvpvpgmAISFEAKDFL
ENSMLUP00000010880  ...................................QMFMRAQFDY..DPK........KDNlipckeaGLKFATGDII
ENSMLUP00000010026  ...................................----------..CPV........QGS.......GVNFEAKDFL
ENSMLUP00000016306  ...................................QVFVKCHFDY..NPY........NDNlipckeaGLKFSKGEIL
ENSMLUP00000002731  ...................................QIYVRAQFEY..DPA........KDDlipckeaGIRFRVGDII
ENSMLUP00000012398  ...................................QVFVKCHFDY..DPA........RDSlipckeaGLRFNAGDLL
ENSMLUP00000007590  ...................................SLYPRALFDY..DKT........KDSglpsq..GLNFKFGDIL
ENSMLUP00000001366  ...................................KMFIKALFDY..DPN........EDKaipckeaGLSFKKGDIL
ENSMLUP00000005694  ...................................VIHVKAHFDY..DPS........DDPyvpcrelGLSFQKGDIL
ENSMLUP00000016016  ...................................MVYVRAMTEY..WPQ........EDPtipcaeaGLPFQKGDIL
ENSMLUP00000013902  ...................................--YVQALFDF..DPQ........EDG.......ELGFRRGDFI
ENSMLUP00000006692  ...................................VTLFVALYDY..EAR........TED.......DLSFHKGEKF
ENSMLUP00000018425  ...................................----RAMFDY..DKS........KDSglpsq..GLSFKYGDIL
ENSMLUP00000002338  ...................................----RALFDY..DKT........DCGflsq...ALSFHFGDVL
ENSMLUP00000010190  ...................................SLYVRALFDY..DRT........RDSclpsq..GLSFSYGDIL
ENSMLUP00000002296  ...................................VCQVIAMYDY..AAN........NED.......ELNFSKGQLI
ENSMLUP00000013892  ...................................--VVRAKFNF..QQT........NED.......ELSFTKGDVI
ENSMLUP00000016474  ...................................MCQVIGMYDY..TAQ........NDD.......ELAFSKGQII
ENSMLUP00000004080  ...................................VTTFVALYDY..ESR........TET.......DLSFKKGERL
ENSMLUP00000013902  ...................................-----AKYDF..KAT........ADD.......ELSFKRGDIL
ENSMLUP00000013066  ...................................--PAKAVYDF..KAQ........TSK.......ELSFKKGDTV
ENSMLUP00000002474  ...................................IEYVRALFDF..NGN........DEE.......DLPFKKGDIL
ENSMLUP00000010063  ...................................GSYFVALFDY..QAR........TEE.......DLSFHAGDKL
ENSMLUP00000007412  ...................................LEKVVAIYDY..TKD........KED.......ELSFQEGAII
ENSMLUP00000011783  ...................................--YCKVIFPY..EAQ........NDD.......ELTIKEGDIV
ENSMLUP00000007133  ...................................--IVKARFNF..KQT........NED.......ELSVCKGDII
ENSMLUP00000005117  ...................................VVCAEALWDH..VTM........DDQ.......ELGFKAGDVI
ENSMLUP00000005919  ...................................DNLVIALHSY..EPS........HDG.......DLGFEKGEQL
ENSMLUP00000011432  ...................................MYSYVALYKF..LPQ........ENN.......DLALQPGDRI
ENSMLUP00000001119  ...................................QPCCRALYDF..EPE........NEG.......ELGFKEGDII
ENSMLUP00000010330  ...................................QPSCKALYDF..EPE........NDG.......ELGFHEGDII
ENSMLUP00000002843  ...................................GITAVALYDY..QAA........GDD.......EISFDPDDII
ENSMLUP00000011946  ...................................-ILCKALYSF..QAR........QDD.......ELDLEVGDIV
ENSMLUP00000002942  ...................................KVFMRALFHY..NPR........EDRaipcqeaGLPFQRRQVL
ENSMLUP00000008920  ...................................-EYCRALFAY..EGT........NED.......ELTFKEGDII
ENSMLUP00000000496  ...................................VRWAQALYDF..EAL........EDD.......ELGFRSGEVV
ENSMLUP00000013320  ...................................TGFAQAQFDF..SAQ........DPS.......QLSFRRGDII
ENSMLUP00000017214  ...................................VTTFVALYDY..ESR........TET.......DLSFKKGERL
ENSMLUP00000021229  ...................................IEKVVAIYDY..TKD........KDD.......ELSFMEGAII
ENSMLUP00000008092  ...................................IEKVVAIYDY..TKD........KDD.......ELSFMEGAII
ENSMLUP00000001413  ...................................LHVVQALYPF..SSS........NDE.......ELNFEKGDVM
ENSMLUP00000013669  ...................................-EKYSVIYPY..TAR........DQD.......EMNLERGAVV
ENSMLUP00000002497  ...................................LGIAVARYDF..CAR........DMR.......ELSLLKGDVV
ENSMLUP00000015970  ...................................GRKVRAIYDF..EAA........EDN.......ELTFKAGEII
ENSMLUP00000001413  ...................................----YVKFNY..MAE........RED.......ELSLIKGTKV
ENSMLUP00000015518  ...................................PTEVTALYSF..EGQ........QPG.......DLSFKAGDRI
ENSMLUP00000013530  ...................................--IVVALYPY..DGI........HPD.......DLSFRKGEKM
ENSMLUP00000001958  ...................................-PTVVALYDY..TAN........RSD.......ELTIHRGDII
ENSMLUP00000011783  ...................................--RCQVAFSY..LPQ........NDD.......ELELKVGDII
ENSMLUP00000000207  ...................................-CFVKALYDY..EGQ........TED.......ELSFPEGAII
ENSMLUP00000007093  ...................................-ISARALYDY..QGE........GSD.......EISFDPDDII
ENSMLUP00000013066  ...................................IGEAIAKYNF..NAD........TNV.......ELSLRKGDRV
ENSMLUP00000003166  ...................................ARKVRALYDF..EAV........EDN.......ELTFKHGEII
ENSMLUP00000007433  ...................................ISLSRAQEDY..NAP........DCR.......FINVKKGQQI
ENSMLUP00000007981  ...................................----FVKFAY..VAE........RED.......ELSLVKGSRV
ENSMLUP00000005897  ...................................PETYRVLFDY..QPE........APD.......ELPLRKGDEV
ENSMLUP00000005860  ...................................LPCAKALYNY..EGK........EPG.......DLKFSKGDII
ENSMLUP00000009512  ...................................ARNYRVVYDY..KAQ........NSD.......ELDISAGDIL
ENSMLUP00000002296  ...................................LVNYRALYPF..EAR........SHD.......EMSFNSGDII
ENSMLUP00000007216  ...................................-----LKFDF..QAQ........SPK.......ELTLKKGDIV
ENSMLUP00000001866  ...................................IVSAEAVWDH..VTM........ANR.......ELAFKAGDVI
ENSMLUP00000003210  ...................................MNTYVALYKF..VPQ........ENE.......DLEMRPGDMI
ENSMLUP00000008920  ...................................-RQCKVLFEY..IPQ........NDD.......ELELKVGDII
ENSMLUP00000013622  ...................................LEYVRTLYDF..LGN........DAE.......DLPFKKGEIL
ENSMLUP00000007577  ...................................-KVFRALYTF..EPR........TPD.......ELYFEEGDII
ENSMLUP00000007981  ...................................--VVQTLYPF..SSV........TEE.......ELNFEKGETM
ENSMLUP00000015831  ...................................LPYWTAVFEY..EAA........GED.......ELTLRLGDVV
ENSMLUP00000009890  ...................................GKRYRAVYDY..SAA........DED.......EVSFQDGDTI
ENSMLUP00000001358  ...................................GEWCEALHSF..TAE........TSD.......DLPFRRGERI
ENSMLUP00000004195  ...................................-VRVRALYDY..EGQ........EHD.......ELSFKAGDEL
ENSMLUP00000007864  ...................................-PVWTALFDY..EPN........GQD.......ELALRKGDRV
ENSMLUP00000010897  ...................................LRTYRAMYDY..SAQ........DED.......EVSFRDGDYI
ENSMLUP00000006579  ...................................--LFVALYDF..VAS........GDN.......TLSITKGEKL
ENSMLUP00000019391  ...................................IEKVVAIYDY..TKD........KDD.......ELSFMRVQSF
ENSMLUP00000001358  ...................................GRKAKALYDF..HGD........NED.......ELSFKAGDTI
ENSMLUP00000005860  ...................................PSVYVAIYPY..TPR........KED.......ELELRKGEMF
ENSMLUP00000010009  ...................................MRPARAKFDF..KAQ........TLK.......ELPLQKGDIV
ENSMLUP00000016474  ...................................VVYYRALYPF..ESR........SHD.......EISIQPGDIV
ENSMLUP00000008018  ...................................--LFVALYDF..VAS........GDN.......TLSITKGEKL
ENSMLUP00000014609  ...................................-ERVVALYDF..QAR........SNR.......EVTMKKDDVL
ENSMLUP00000009299  ...................................KCAVKALFDY..KAQ........RDD.......ELTFTKSAII
ENSMLUP00000006831  ...................................-ELVLALYDY..QEK........SPR.......EVTMKKGDIL
ENSMLUP00000003954  ...................................LKKVVALYDY..MPM........NAN.......DLQLRKGDEY
ENSMLUP00000011645  ...................................ATQVVAMYPF..VAR........NSH.......EVSLQAGQPV
ENSMLUP00000012000  ...................................LEQYVVVSNY..KKQ........ENS.......ELSLQAGEVV
ENSMLUP00000013586  ...................................QRTVKALYDY..KAK........QSD.......ELSFCRGALI
ENSMLUP00000002296  ...................................GEEYIALYPY..SSV........EPG.......DLTFSEGEEI
ENSMLUP00000010009  ...................................LFSYQALYSY..IPQ........NDD.......ELELRDGDIV
ENSMLUP00000007216  ...................................YGEAVAQYNF..KGD........LEV.......ELSFRKGERI
ENSMLUP00000016474  ...................................-LQAQALYPW..RAK........KDN.......HLNFNKNDVI
ENSMLUP00000001012  ...................................VPRAKALCNY..RGQ........NPG.......DLRFNKGDVI
ENSMLUP00000017975  ...................................-VLAKALYDN..VAE........SPD.......ELSFRKGDIM
ENSMLUP00000018941  ...................................-RRYLALYTY..KPQ........KSD.......ELELRKGEMY
ENSMLUP00000005582  ...................................-QVFLARYSY..NPF........EGPnenpea.ELPLTAGEYI
ENSMLUP00000017787  ...................................VTIFVALYDY..EAR........TTE.......DLSFKKGERF
ENSMLUP00000015689  ...................................--LARALYDN..TAE........SPQ.......ELSFRQGDVL
ENSMLUP00000002296  ...................................NLKAQALCSW..TAK........KDN.......HLNFSKHDVI
ENSMLUP00000008920  ...................................---YIVEYDY..DAV........HDD.......ELTIRVGEII
ENSMLUP00000012000  ...................................--KYVTVQPY..TSQ........SKD.......EIGFEKGVTV
ENSMLUP00000004960  ...................................-RRAKALLDF..ERH........DDD.......ELGFRKNDII
ENSMLUP00000016474  ...................................GEEFVAMYTY..ESA........EQG.......DLTFQQGDVI
ENSMLUP00000007216  ...................................--PYRAVYQY..RPQ........NED.......ELELREGDRV
ENSMLUP00000018941  ...................................LPCGKALYSY..EGK........EPG.......DLKFNKGDVI
ENSMLUP00000007615  ...................................-GVVYALWSY..EAQ........NSD.......ELSFREGDAI
ENSMLUP00000017501  ...................................LEQYVVVANY..QKQ........ESS.......EISLSVGQVV
ENSMLUP00000005582  ...................................PRCMVAAFDY..NPR........ESSpnmdveaELPFRAGDII
ENSMLUP00000013066  ...................................GEPFQALYNY..TPR........NED.......ELELRESDVI
ENSMLUP00000004531  ...................................SHYFVALYRF..KAL........EKD.......DLDFPPGEKI
ENSMLUP00000014222  ...................................---CIAVGDF..IAQ........QAG.......DLTFKKGEIL
ENSMLUP00000001012  ...................................-NMFVALHSY..SAH........GPD.......ELDLQRGEGI
ENSMLUP00000011016  ...................................SRKARVLYDY..DAA........NSS.......ELSLLADEVI
ENSMLUP00000014075  ...................................-SQVVAIFSY..EAT........QPE.......DLEFLEGDII
ENSMLUP00000016089  ...................................GVRVRALYDY..AGQ........EAD.......ELSFRAGEEL
ENSMLUP00000014075  ...................................-EAHRVLFGF..VPE........TPE.......ELHVQPGNIV
ENSMLUP00000010551  ...................................---AHVVKRY..TAQ........APD.......ELSFEVGDIV
ENSMLUP00000011784  ...................................--AVVTLYPY..TGQ........KDN.......ELSFSEGTVI
ENSMLUP00000016474  ...................................-EIAQVIASY..TAT........GPE.......QLTLAPGQLI
ENSMLUP00000014409  ...................................---VIALYDY..QTN........DPQ.......ELTLQRNDEY
ENSMLUP00000013262  ...................................--QYVGLWDF..KAR........TNE.......ELSFRAGDLF
ENSMLUP00000014923  ...................................----TAVFDY..EVT........GDE.......ELTLRRGDRV
ENSMLUP00000004002  ...................................ALRMQVLFEF..EAR........NPK.......ELTVAPGEVV
ENSMLUP00000020771  ...................................----TAVFDY..EVT........GDE.......ELTLRRGDRV
ENSMLUP00000007028  ...................................KTRVMALYDF..LPR........EPC.......DLALKRAEEY
ENSMLUP00000010009  ...................................YGEAIAKFNF..NGD........TQV.......EMSFRKGERI
ENSMLUP00000018941  ...................................RERYRVVVSY..PPQ........SEA.......EIELKEGDIV
ENSMLUP00000010822  ...................................AKEVIAIKDY..CPN........NFT.......TLKFSKGDHL
ENSMLUP00000015288  ...................................--VIYALWDY..EPQ........NED.......ELPMKEGDCM
ENSMLUP00000013669  ...................................LEQYVVVANY..QKQ........ESS.......EISLSVGQVV
ENSMLUP00000022476  ...................................EEIVVAMYDF..QAT........EAH.......DLRLERGQEY
ENSMLUP00000011542  ...................................NQVYFAVYTF..KAR........NPN.......ELSVSANQRL
ENSMLUP00000011542  ...................................GTYGIALYRF..QAL........EPN.......ELDFEVGDKI
ENSMLUP00000016384  ...................................LYKVEALHDF..EAA........NSD.......ELTLQRGDVV
ENSMLUP00000005860  ...................................CERHRVVVSY..PPQ........SEA.......ELELKEGDIV
ENSMLUP00000003137  ...................................GKIFRAMYDY..MAA........DAD.......EVSFKDGDAI
ENSMLUP00000016884  ...................................LKIFLVRYSY..NPF........EGPnehpet.ELPLTAGEYV
ENSMLUP00000015858  ...................................CPQVQCVHPY..VAQ........QPD.......ELTLELADIL
ENSMLUP00000012406  ...................................---CIAKYNF..HGT........AEQ.......DLPFCKGDVL
ENSMLUP00000009292  ...................................--LARALYNN..DPD........CSD.......ELAFCKGDIL
ENSMLUP00000001413  ...................................--VVVAKFDY..VAQ........QEQ.......ELDIKKNERL
ENSMLUP00000012000  ...................................--SYMTCSAY..QKV........QDS.......EISFPAGVEV
ENSMLUP00000007949  ...................................AFLARALYSY..TGQ........SAE.......ELSFPEGALI
ENSMLUP00000001358  ...................................APHAVILHDF..PAE........QVG.......DLNLTSGEIV
ENSMLUP00000005582  ...................................VRVFVALFDY..DPVsmsp....NPDagee...ELPFREGQIL
ENSMLUP00000012019  ...................................---ARALYDN..VPE........CAE.......ELAFRKGEIL
ENSMLUP00000007621  ...................................DNIVIALYDY..EAI........HHE.......DLSFQKGDQM
ENSMLUP00000000109  ...................................IGHCKAIYPF..DGH........NEG.......TLAMKEGEVL
ENSMLUP00000012976  ...................................-VEAVACFSY..TGR........TAK.......ELTFQRGDVL
ENSMLUP00000010504  ...................................-PQVQCLRAY..KPR........END.......ELALEKADVV
ENSMLUP00000007384  ...................................SRKARAVYPC..EAE........HSS.......ELSFEIGAIF
ENSMLUP00000002099  ...................................LTQVEIIRSF..TAK........QPD.......ELSLQVADVV
ENSMLUP00000010226  ...................................TRKARVLYDY..EAA........DSS.......ELALLADELI
ENSMLUP00000001012  ...................................PPLCRALYNF..DLR........NKDkndnqd.CLTFLKDDII
ENSMLUP00000012000  ...................................EVEYYTIAEF..QSC........ISD.......GISFRGGQKA
ENSMLUP00000014043  ...................................-YQYRALYDY..KKE........REE.......DIDLHLDDIL
ENSMLUP00000017916  ...................................PFRKKALYAC..KAE........HDS.......ELSFIAGTVF
ENSMLUP00000002503  ...................................---AIAKFDY..VGR........TAR.......ELSFKKGASL
ENSMLUP00000009446  ...................................-IEAIAKFDY..VGR........SPR.......ELSFKKGASL
ENSMLUP00000013179  ...................................-NFYQGLWDC..TGA........LSD.......ELSFKRGDVI
ENSMLUP00000006973  ...................................--EFVAIADY..SAT........DET.......QLSFLRGEKI
ENSMLUP00000013630  ...................................-PQVQCVRTY..KAL........QPD.......ELTLEKTDIL
ENSMLUP00000012141  ...................................--KARVLYDF..AAEp.......GNN.......ELTVTEGEII
ENSMLUP00000013669  ...................................EEEYYTIAEF..QTT........IPD.......GISFQAGLKV
ENSMLUP00000006358  ngqlhggaearrsggercwatdfddefddeeplpaIGTCKALYTF..DGQ........NEG.......TISVVEGETL
ENSMLUP00000002296  ...................................PEIAQVTSAY..VAS........GSE.......QLSLAPGQLI
ENSMLUP00000006507  ...................................--AAHVIKRY..TAR........APD.......ELTLEVGDIV
ENSMLUP00000011422  ...................................----------..---........---.......----------
ENSMLUP00000008265  ...................................-RRVKTIYDC..QAD........NED.......ELTFIEGEVI
ENSMLUP00000011428  ...................................---AIAKFDY..VGR........SAR.......ELSFKKGASL
ENSMLUP00000002679  ...................................----------..---........GNR.......ELQVKPGESL
ENSMLUP00000018941  ...................................PPQGKALYDF..EMK........DRDqdqd...CLTFTKDEIL
ENSMLUP00000005860  ...................................PPQCKALYDF..EVKdkea....DKD.......CLPFAKDDVL
ENSMLUP00000011542  ...................................MGQARALMGL..SAQ........LDE.......ELDFREGDVI
ENSMLUP00000020371  ...................................PAIFYAVHAF..EAR........SNC.......ELSLQEYQRV
ENSMLUP00000011542  ...................................EKLFQADRNF..NAA........QDL.......DVSLLEGDLV
ENSMLUP00000000496  ...................................---AIAKFDF..TAS........GED.......ELSFHTGDTL
ENSMLUP00000010676  ...................................--QFCASQAY..EGS........RAD.......ELSVPAGARV
ENSMLUP00000011698  ...................................ISRVLAMRDY..RGP........DCL.......YLNFTKGEEI
ENSMLUP00000009701  ...................................----RALYDF..HSE........NKE.......EINIQQGEDL
ENSMLUP00000004596  ...................................--YYQGLWDC..HGD........QPD.......ELSFQRGDLI
ENSMLUP00000020371  ...................................EELYQAKRKC..NAT........QEY.......DINLLEGELV
ENSMLUP00000000207  ...................................-LTCKVVYSY..KAS........QPD.......ELTIEEHEVL
ENSMLUP00000014421  ...................................-KYAKSKYDF..AAR........NNS.......ELSVQKDSIL
ENSMLUP00000013929  ...................................ILKVRALKDF..WNLh.......DPT.......ALNVRAGDVI
ENSMLUP00000003615  ...................................-FQYRALYPF..RRE........RPE.......DLELLPGDVL
ENSMLUP00000019445  ...................................CGRARVHTDF..TPSpy......DTD.......SLKLKKGDII
ENSMLUP00000003921  ...................................--QVRATQDY..CNNy.......DLT.......SLNVKAGDII
ENSMLUP00000002679  ...................................-HQARACCD-..VKG........GKN.......ELSFKQGEPI
ENSMLUP00000001797  ...................................CGRARVHTDF..TPSpy......DHD.......SLKLQKGDVI
ENSMLUP00000007922  ...................................PCEVKALCHH..LAT........GPG.......QLSFHKGDVL
ENSMLUP00000016884  ...................................GRVFVALFDY..EPLvmsanpeaAEE.......ELAFQKGQLL
ENSMLUP00000021898  ...................................HVVARAEYDF..AAL........SEE.......EISFRAGDML
ENSMLUP00000018532  ...................................----------..---........-GK.......HLGIRRGEIL
ENSMLUP00000006141  ...................................----------..---........-GK.......HLGIRRGEIL
ENSMLUP00000012243  ...................................--AVRALCDH..TAA........GPD.......QLSFQRGEVL
ENSMLUP00000007949  ...................................PCPAHVVFGY..QAG........HED.......ELTITEGEWL
ENSMLUP00000010409  ...................................-VYIEVEYDY..EYE........AKDr......KIVIRQGERY
ENSMLUP00000000120  ...................................--TLRALFQY..KPQ........NVD.......ELTLSPGEYI
ENSMLUP00000002448  ...................................---LQVIYPY..TPQ........NDD.......ELELVPGDFI
ENSMLUP00000006631  ...................................-RQAKAMYSC..QAE........HSH.......ELSFPQGALF
ENSMLUP00000013267  ...................................GQFFRALCDF..TAR........YAD.......ELSVSRGDRL
ENSMLUP00000002140  ...................................----AVIKDY..YAL........KEN.......EICVSQGEVV
ENSMLUP00000009401  ...................................CGRARVHTDF..TPSpy......DTD.......SLKLKKGDII
ENSMLUP00000011645  ...................................--LYQVTSNT..SGS........RTL.......DLSLPRGQIV
ENSMLUP00000000142  ...................................----------..---........---.......FLRLNPGDIV
ENSMLUP00000013622  ...................................PVFAKAVQKR..VPC........AYDkt.....ALALEVGDIV
ENSMLUP00000002497  ...................................LPKMQVIKNY..AGT........PPPaphagp.PLHIQAGDTV
ENSMLUP00000013669  ...................................KDLYVAVANF..EGD........EDA.......S-SFQEGTVF
ENSMLUP00000008144  ...................................IGHCVAIYHF..EGS........SEG.......TISMAEGEDL
ENSMLUP00000004680  ...................................-QKVKTIFPH..TAG........-TN.......QLGFEQGDVI
ENSMLUP00000010492  ...................................RRRVRAILPY..TKVp.......DTD.......EISFLKGDMF
ENSMLUP00000011542  ...................................-RLFVCICEF..TSQ........EPN.......SLPLYRGDLV
ENSMLUP00000000726  ...................................ISTMLVTHDY..TAV........KED.......EINVYQGEVV
ENSMLUP00000016884  ...................................RMTMMAALDY..DPK........DGWaggqakgKLSLKAGDLV
ENSMLUP00000002474  ...................................PIYARVIQKR..VPN........AYDkt.....ALALEVGELV
ENSMLUP00000013417  ...................................EQTHRAIFRF..VPR........HED.......ELELEVDDPL
ENSMLUP00000012000  ...................................KDVYVSIADY..EGD........EET.......-AGFQEGVSM
ENSMLUP00000001859  ...................................-------YNY..DAR........GVD.......ELSLQIGDTV
ENSMLUP00000016646  ...................................-----APSDN..SAL........DED.......EVSFQDEDII
ENSMLUP00000009616  ...................................--KYTVVVDD..EKG........SPN.......TLAVRSGDVV
ENSMLUP00000010476  ...................................--YIRALYDR..LAE........VEH.......ELSFKKDDIL
ENSMLUP00000003844  ...................................CGRARVHTDF..TPSpy......DTD.......SLKIKKGDII
ENSMLUP00000012979  ...................................----------..---........---.......DLPITPGEEL
ENSMLUP00000010870  ...................................GLCARALYDY..QAA........DKT.......EISFDPKNLI
ENSMLUP00000004205  ...................................--QCITKCEH..TRP........KPG.......ELAFHKGDMV
ENSMLUP00000000726  ...................................CELTVVIHDF..TAC........NST.......ELTIRRGQTV
ENSMLUP00000008845  ...................................KATAVALGSF..PVG........EQA.......ELSLRLGEPL
ENSMLUP00000012305  ...................................VPQCKALYAY..DAQ........DTD.......ELSFNANDII
ENSMLUP00000000937  ...................................---LCALYAFtyTAA........DGR.......QVSMAEGDRF
ENSMLUP00000002140  ...................................-ELTVVLQDF..NAG........HSS.......ELTIQVGQTV
ENSMLUP00000016537  ...................................---MRALQDF..E--........EPD.......KLHIQMNDVI
ENSMLUP00000015982  ...................................---MRALQDF..E--........EPD.......KLHIQMNDVI
ENSMLUP00000009378  ...................................RGKCKAWKDY..ERE........EKD.......ELDLRQGESI
ENSMLUP00000001358  ...................................GPRCGAQFEY..IGD........QKD.......VLSFLEGESI
ENSMLUP00000010676  ...................................----------..---........---.......-FHAQAQEAL
ENSMLUP00000011918  ...................................-----VIASF..RGT........VPY.......GLSLEIGDTV
ENSMLUP00000006188  ...................................----------..---........---.......----------
ENSMLUP00000004439  ...................................--YIRTHFEY..EKE........SPY.......GLSFNKGEVF
ENSMLUP00000004210  ...................................----IAIYPH..QPR........TAD.......EIPMEPGDII
ENSMLUP00000015169  ...................................----------..-GE........ESG.......FLSFAKGDLI
ENSMLUP00000013320  ...................................----VALYSF..QAT........ESD.......ELAFNKGDTL
ENSMLUP00000000142  ...................................FGTAKVRYDF..CAR........DRS.......ELNLKEGDIV
ENSMLUP00000006936  ...................................------TCSF..RGS........VPQ.......GLVLEIGETV
ENSMLUP00000010147  ...................................----RSHFEC..EKE........TPQ.......SLAFTRGEIF
ENSMLUP00000009801  ...................................---IRTHFEL..EPS........PPY.......GLGFTRGDVF
ENSMLUP00000018134  ...................................----------..---........--E.......KLKFEKGETV
ENSMLUP00000016407  ...................................--FVVALYDY..VAV........NDR.......DLQMLKGEKL
ENSMLUP00000010152  ...................................----------..---........---.......---FRRGEKL
ENSMLUP00000009378  ...................................----------..---........EGE.......CLTLGEGELI
ENSMLUP00000020593  ...................................----------..---........---.......----------
ENSMLUP00000019238  ...................................----------..---........--E.......KLKFEKGETV
ENSMLUP00000001358  ...................................----------..--S........NPG.......ELSCKRGDGL
ENSMLUP00000000215  ...................................LQTYRAIADY..EKS........SGT.......EMALAMGDVV
ENSMLUP00000004531  ...................................---HRVTRSF..VGNr.......EIG.......QITLKKDQIV
ENSMLUP00000001760  ...................................----------..---........--P.......RIPLQKGEFI


                      0                         70                           80        90           
                      |                          |                            |         |           
d1udla_               NVMNKD.........DP........DWWQGEI..........NG.........VTGLFPSNYVKMTTD-------ssg
ENSMLUP00000003159  HIKEKY.........NN........DWWIGRLvke.......GC.........EIGFIPS---------------plr
ENSMLUP00000006192  QIVNRE.........DP........NWWQASHvke.......GG.........SAGLIPSQFLEEK---------rka
ENSMLUP00000001660  HVKEKF.........NN........DWWIGRLvke.......GC.........EIGFIPS---------------pvk
ENSMLUP00000010880  QIINKD.........DS........NWWQGRVegss......KE.........SAGLIPSPELQE----------wrv
ENSMLUP00000010026  HIKEKY.........SN........DWWIGRLvke.......GG.........DIAFIPS---------------pqr
ENSMLUP00000016306  QIVNRE.........DP........NWWQASHvke.......GG.........SAGLIPSQFLEEK---------rka
ENSMLUP00000002731  QIISKD.........DH........NWWQGKLensk......NG.........TAGLIPSPELQE----------wrv
ENSMLUP00000012398  QIVNQD.........DA........NWWQACHve........GG.........SAGLIPSQLLEEK---------rka
ENSMLUP00000007590  HVINAS.........DD........EWWQARQvtpdge....SD.........EVGVIPS---------------krr
ENSMLUP00000001366  QIMSQD.........DA........MWWQAKHegda......NP.........RAGLIPSKHFQE----------rrl
ENSMLUP00000005694  HVISQE.........DP........NWWQAYR..........DGdednqp...LAGLVPG---------------ksf
ENSMLUP00000016016  QVVDQS.........DA........LWWQARKvsal......GT.........CAGLIPSSHLLKRKQR------efw
ENSMLUP00000013902  HVMDNS.........DP........NWWKGAC..........HG.........QTGMFPRNY-------------...
ENSMLUP00000006692  QILNSS.........EG........DWWEARSlt........TG.........ETGYIPSNYVAPVDSIQAEEWYfgk
ENSMLUP00000018425  HVINAS.........DD........EWWQARRvtldgd....SE.........EMGVIPS---------------krr
ENSMLUP00000002338  HVIDAS.........DE........EWWQARRvhsdse....TD.........DIGFIPS---------------krr
ENSMLUP00000010190  HVINAS.........DD........EWWQARLvtphge....SE.........QIGVIPS---------------kkr
ENSMLUP00000002296  NVLNKD.........DP........DWWQGEI..........NG.........ATGLFPSNYVKMTT--------dsd
ENSMLUP00000013892  HVTRVE.........EG........GWWEGTH..........NG.........RTGWFPSNYVREIKPSEK----pvs
ENSMLUP00000016474  NVLSKE.........DP........DWWKGEV..........GG.........HVGLFPSNYVKLTTDTD-----psq
ENSMLUP00000004080  QIVNNT.........EG........DWWLAHSls........TG.........QTGYIPSNYVAPSDSIQAEEWYfgk
ENSMLUP00000013902  KVLNEEc........DQ........NWYKAEL..........NG.........KDGFIPKNY-------------...
ENSMLUP00000013066  YILRKI.........DQ........NWYEGEH..........HG.........RVGIFPISYVEKLSPPE-----kaq
ENSMLUP00000002474  KIRDKP.........EE........QWWNAEDm.........EG.........KRGMIPVPYVEKYRPVP-----asv
ENSMLUP00000010063  QVLDTS.........HE........GWWFARLlerrgassg.QQ.........LEGYIPSNYVAEDRSLQAEPW-ffg
ENSMLUP00000007412  YVIKKN.........DD........GWYEGVM..........NG.........VTGLFPGNYVE-----------s..
ENSMLUP00000011783  TLINKDci.......DV........GWWEGEL..........NG.........RRGVFPDNFVKLLPP-------dfe
ENSMLUP00000007133  YVTRVE.........EG........GWWEGTL..........NG.........RTGWFPSNYVREIKSSE-----rpl
ENSMLUP00000005117  QVLEAS.........NK........DWWWGRS..........EE.........KEAWFPASFVRLR---------vnq
ENSMLUP00000005919  RVLEQ-.........NG........EWWKAQSlt........TG.........QEGFIPFNFVAKANSLEPEPWFfkn
ENSMLUP00000011432  MLVDDS.........NE........DWWKGKI..........GD.........RVGFFPANFVQRVR--------pge
ENSMLUP00000001119  TLTNQI.........DE........NWYEGML..........HG.........QSGFFPINYVEIL---------...
ENSMLUP00000010330  TLTNQI.........DE........NWYEGML..........HG.........QSGFFPLSYVEVL---------vp.
ENSMLUP00000002843  TNIEMI.........DD........GWWRGLC..........KG.........RYGLFPANYVEL----------...
ENSMLUP00000011946  TIHRKQ.........EE........GWWFGSL..........NG.........KKGHFPAAYVQELP--------sd.
ENSMLUP00000002942  EVVSQD.........DP........TWWQAKRvgdt......NL.........RAGLIPSKQF------------qer
ENSMLUP00000008920  HLISKEtg.......ET........GWWKGEL..........NG.........KEGVFPDNFAVQLNELDKD---fpk
ENSMLUP00000000496  EVLDSS.........NP........SWWTGRL..........HN.........KLGLFPANYVAP----------...
ENSMLUP00000013320  EVLEHL.........DP........HWWRGRF..........CG.........QVGFFPRSYVQPV---------...
ENSMLUP00000017214  QIVNNTrkvdvr...EG........DWWLAHSls........TG.........QTGYIPSNYVAPSDSIQAEEWYfgk
ENSMLUP00000021229  YVIKKN.........DD........GWYEGVC..........NR.........VTGLFPGNYVE-----------s..
ENSMLUP00000008092  YVIKKN.........DD........GWYEGVC..........NR.........VTGLFPGNYVE-----------s..
ENSMLUP00000001413  DVLEKPen.......DP........EWWKCRKi.........NG.........MVGLVPKNYVTIMQNNP-----lts
ENSMLUP00000013669  EVIQKN.........LE........GWWKIRY..........QG.........KEGWAPASYLKKSSG-------eps
ENSMLUP00000002497  KIYTKMs........GN........GWWRGEA..........NG.........KVGWFPSTYVEV----------...
ENSMLUP00000015970  TVLDDS.........DP........NWWKGET..........HQ.........GMGLFPSNFVT-----------ad.
ENSMLUP00000001413  IVMEKC.........SD........GWWRGSY..........NG.........QVGWFPSNYVTEEG--------dsp
ENSMLUP00000015518  TVTSKT.........DSnf......DWWEGRL..........RG.........QTGIFPANYVT-----------m..
ENSMLUP00000013530  KVLEE-.........HG........EWWKAKSls........TK.........REGFIPSNYVAKVNTLETEEWFfkd
ENSMLUP00000001958  RVFYKD.........NE........DWWYGSLg.........KG.........QEGYFPANHV------------a..
ENSMLUP00000011783  EVVGEV.........EE........GWWEGVL..........NG.........KTGMFPSNFIKELSG-------esd
ENSMLUP00000000207  RILNKEnqd......DD........GFWEGEF..........SG.........RIGVFPSVLVEELPA-------sen
ENSMLUP00000007093  TDIEMV.........DE........GWWRGRC..........HG.........HFGLFPANYVN-----------l..
ENSMLUP00000013066  ILLKRV.........DQ........NWYEGKIpg........TN.........RQGIFPVSYVEVVKRN------tak
ENSMLUP00000003166  IVLDDS.........DA........NWWKGEN..........HR.........GIGLFPSNFVTT----------nln
ENSMLUP00000007433  YVYSKLvkene....AG........EFWAGSVygddhede..MG.........TVGYFPRNLVEE----------qhv
ENSMLUP00000007981  TVMEKC.........SD........GWWRGSY..........NG.........QIGWFPSNYVL-----------eev
ENSMLUP00000005897  KVLRKTte.......DE........GWWEGES..........QG.........RRGVFPDNFVLP----------pp.
ENSMLUP00000005860  ILRRQV.........DE........NWYHGEV..........NG.........IHGFFPTNFVQIIKPLPQ----ppp
ENSMLUP00000009512  EVILEG.........ED........GWWTVEQ..........NG.........QRGFVPGSYLE-----------k..
ENSMLUP00000002296  QVDEKTtg.......EP........GWLYGSF..........QG.........KFGWFPCNYVEKMPSSE-----ksv
ENSMLUP00000007216  YIHKEV.........DK........NWLEGEH..........HG.........RLGIFPANYVEVLPAD------eip
ENSMLUP00000001866  KVLDAS.........NK........DWWWGQI..........DD.........EEGWFPASFVRLWV--------nqe
ENSMLUP00000003210  TLLEDS.........NE........DWWKGKI..........QD.........RIGFFPANFVQRV---------qq.
ENSMLUP00000008920  DINDEV.........EE........GWWSGTL..........NN.........KLGLFPSNFVKEL---------eit
ENSMLUP00000013622  VIIEKP.........EE........QWWSARNk.........DG.........RIGMIPVPYVEKL---------vrs
ENSMLUP00000007577  YITDMS.........DT........SWWKGTS..........KG.........RTGLIPSNYVAE----------qae
ENSMLUP00000007981  EVIEKPen.......DP........EWWKCKNa.........RG.........QVGLVPKNYVVVLSD-------gpv
ENSMLUP00000015831  EVLSKDsqvsg....DE........GWWTGQL..........NQ.........RVGIFPSNYVTPRS--------afs
ENSMLUP00000009890  VNVQQI.........DD........GWMYGTVer........TG.........DTGMLPANYVE-----------a..
ENSMLUP00000001358  LILQRL.........DS........DWYKGRL..........RD.........REGIFPAVFVRPCP--------adm
ENSMLUP00000004195  TKIEDEd........EQ........GWCKGRLd.........NG.........QVGLYPANYVEA----------i..
ENSMLUP00000007864  EVLSRDaaisg....DE........GWWAGQV..........GG.........QVGIFPSNYVSR----------ggp
ENSMLUP00000010897  VNVQPI.........DD........GWMYGTVqr........TG.........KTGMLPANYIEF----------v..
ENSMLUP00000006579  RVLGYNq........NG........EWSEVRS..........KN.........GQGWVPSNYITPVNSLEKHSWYhgp
ENSMLUP00000019391  YVIKKN.........DD........GWYEGVY..........NR.........VTGLFPGNYVE-----------s..
ENSMLUP00000001358  TELESV.........DD........DWMSGEL..........MG.........KSGIFPKNYVQV----------...
ENSMLUP00000005860  LVFERC.........QD........GWFKGTSmh........TS.........KIGVFPGNYVAPVTS-------fgr
ENSMLUP00000010009  YIYKQI.........DQ........NWYEGEH..........HG.........RVGIFPRTYIELLPPAE-----kaq
ENSMLUP00000016474  MVDESQtg.......EP........GWLGGEL..........KG.........KTGWFPANYAEKIPENEV----pap
ENSMLUP00000008018  RVLGYNh........NG........EWCEAQT..........KN.........GQGWVPSNYITPVNSLEKHSWYhgp
ENSMLUP00000014609  TLLSSI.........NK........DWWKVEH..........ED.........HQGFVPAVYVRKLAHD------efp
ENSMLUP00000009299  QNVEKQ.........DG........GWWRGDYg.........GK.........KQLWFPSNYVEEM---------vs.
ENSMLUP00000006831  TLLNST.........NK........DWWKVEV..........ND.........RQGFVPAAYVKKLDP-------aq.
ENSMLUP00000003954  FILEES.........NL........PWWRARDk.........NG.........QEGYIPSNYVTE----------ae.
ENSMLUP00000011645  TVLEAPdkkg.....NP........EWSLVEV..........DG.........RRGYVPSSFLARAPSP------apw
ENSMLUP00000012000  DVIEKN.........ES........GWWFVST..........SE.........EQGWVPATYLEA----------qng
ENSMLUP00000013586  HNVSKE.........PG........GWWKGDYg.........TK.........IQHYFPSNYVEDIST-------vdv
ENSMLUP00000002296  LVTQK-.........DG........EWWTGSI..........GD.........RTGIFPSNYVKPKD--------qes
ENSMLUP00000010009  DVMEKC.........DD........GWFVGTSrr........TR.........QFGTFPGNYVKPL---------...
ENSMLUP00000007216  CLIRKV.........NE........NWYEGRIsg........TG.........RQGIFPVSYVQVSR--------epr
ENSMLUP00000016474  TVLEQ-.........QD........MWWFGEV..........QG.........QKGWFPKSYVKLISGP------trk
ENSMLUP00000001012  LLRRQL.........DE........NWYQGEI..........NG.........VSGFFPASSVEVIKQLPQ----ppp
ENSMLUP00000017975  TVLERDtqg......LD........GWWLCSL..........HG.........RQGIVPGNRLKIL---------vgm
ENSMLUP00000018941  CVLEKC.........QD........GWFKGTSlr........SG.........LSGVFPGNYVTPASS-------gtw
ENSMLUP00000005582  YIYGNMd........ED........GFFEGELm.........DG.........RRGLVPSNFVERVSDD------dll
ENSMLUP00000017787  QIINNT.........EG........DWWEARSia........TG.........KNGYIPSNYVAP----------...
ENSMLUP00000015689  RVLQREgagg.....LD........GWCLCSL..........HG.........QQGIVPANRVKLLPDGP-----apk
ENSMLUP00000002296  TVLEQ-.........QE........NWWFGEV..........HG.........GRGWFPKSYVKIIPG-------se.
ENSMLUP00000008920  RNVKKLq........EE........GWLEGEL..........NG.........RRGMFPDNFVKEIK--------ret
ENSMLUP00000012000  EVIRKN.........LE........GWWYIRY..........LG.........KEGWAPASYLKKAK--------ddl
ENSMLUP00000004960  TIISQK.........DE........HCWVGEL..........NG.........LRGWFPAKFVEVLDERSK----ey.
ENSMLUP00000016474  LVTKK-.........DG........DWWTGTV..........GD.........KSGVFPSNYVRL----------kd.
ENSMLUP00000007216  DVMQQC.........DD........GWFVGVSrr........TQ.........KFGTFPGNYVAP----------...
ENSMLUP00000018941  ILRRRV.........DE........HWFHGEL..........RG.........THGFLPASYVQCLRPLP-----ptp
ENSMLUP00000007615  TILRRK.........DEhet.....QWWWARL..........GD.........REGYVPRNLLGLCP--------riq
ENSMLUP00000017501  DIIEKN.........ES........GWWFVST..........AE.........EQGWVPATCLE-----------gqd
ENSMLUP00000005582  TVFGGMd........DD........GFYYGEL..........NG.........QRGLVPSNFLE-----------g..
ENSMLUP00000013066  DVMEKC.........DD........GWFVGTSrr........TK.........FFGTFPGNYVK-----------r..
ENSMLUP00000004531  TVIDDS.........NE........EWWRGKI..........GE.........KVGFFPPNFIIRV---------rs.
ENSMLUP00000014222  LIIEKH.........PD........GWWMAKNa.........KG.........NKGLVPRTYLEPH---------hk.
ENSMLUP00000001012  RVLGKY.........QD........GWLKGVSlv........TG.........RVGIFPNNYVIPI---------frt
ENSMLUP00000011016  TVFSVVgm.......DS........DWLMGER..........GN.........QKGRVPITYLEL----------l..
ENSMLUP00000014075  QVVSMAv........ND........EWLEGEC..........KG.........KFGIFPKAFVEER---------aat
ENSMLUP00000016089  LKMSEEd........EQ........GWCQGQLq.........SG.........RIGLYPANYVE-----------c..
ENSMLUP00000014075  FVLKKG.........SD........NWATVMF..........NG.........QKGLVPCNFLEPV---------elr
ENSMLUP00000010551  SVIDMPpte......DR........SWWRGKR..........GF.........QVGFFPSECVELFTER------pcp
ENSMLUP00000011784  CITRRH.........SD........GWCEGVT..........SE.........GTGFFPGNYVAP----------...
ENSMLUP00000016474  LIRKKN.........PG........GWWEGELqargk.....KR.........QIGWFPANYVKLLSP-------gts
ENSMLUP00000014409  YLLDSS.........EI........HWWRVQDk.........NG.........HEGYVPSSYLVEKSAN------nle
ENSMLUP00000013262  HVARK-.........EE........EWWWATLldae......GGal.......AEGYVPHNYLAERETVESEPWFfgc
ENSMLUP00000014923  QVLSQDcavsg....DE........GWWTGRLp.........GG.........RVGVFPSDYVAP----------prp
ENSMLUP00000004002  EVLDH-.........SK........RWWLVKDq.........TG.........DSGYVPSNILEPLQSG------psg
ENSMLUP00000020771  QVLSQDcavsg....DE........GWWTGRLp.........GG.........RVGVFPSDYVAP----------prp
ENSMLUP00000007028  LILEKH.........DT........HWWKARDr.........WG.........NEGFIPSNYVAE----------nkl
ENSMLUP00000010009  TLLRQV.........DE........NWYEGRIpg........TT.........RQGIFPITYVDVIK--------rpl
ENSMLUP00000018941  FVHKKR.........ED........GWYKGTLqr........NG.........RTGLFPGSFVE-----------s..
ENSMLUP00000010822  YVLDTS.........GG........EWWYAHN..........TT.........EMGYIPSSYVQPL---------n..
ENSMLUP00000015288  TVLRRE.........DEdev.....EWWWARL..........ND.........KEGYVPRNLLGLY---------pr.
ENSMLUP00000013669  DIIEKN.........ES........GWWFVST..........AE.........EQGWVPATCLE-----------gq.
ENSMLUP00000022476  IILEKN.........DV........HWWRARDk.........YG.........SEGYIPSNYVTG----------kks
ENSMLUP00000011542  KILDFKdvtg.....NT........EWWLAEV..........NG.........KKGYVPSNYIRK----------a..
ENSMLUP00000011542  RILGTL.........ED........GWLEGSL..........KG.........RTGIFPYRFVNLCPKTK-----vee
ENSMLUP00000016384  LVVPSDseadq....DA........GWLVGVKe.........SDwlqyrdlatYKGLFPENFTQR----------l..
ENSMLUP00000005860  FVHKKR.........ED........GWFKGTLq.........RN.........KTGLFPGSFVE-----------n..
ENSMLUP00000003137  VNVQAI.........DE........GWMYGTVqr........TG.........RTGMLPANYVE-----------a..
ENSMLUP00000016884  YIFGEMd........ED........GFYEGELe.........DG.........RRGLVPSNLVVQIPDN------dil
ENSMLUP00000015858  NILDKT.........ED........GWIFGERlh........DQ.........ERGWFPSNMTEEI---------lnp
ENSMLUP00000012406  TIVAVTk........DP........NWYKAKNk.........VG.........REGIIPANYVQKREGV------kvg
ENSMLUP00000009292  TILEQHvpe......SE........GWWRCLL..........HG.........RQGLAPANRLQILSGAPA----dsp
ENSMLUP00000001413  WLLDD-.........SK........SWWRVRNs.........VN.........KTGFVPSNYVERK---------ns.
ENSMLUP00000012000  QVLEKL.........ES........GWWYVRF..........GE.........LEGWAPSHYLVLGENEPP----dps
ENSMLUP00000007949  RLLPRAqdgv.....DD........GFWRGEF..........GG.........HVGVFPSLLVEEL---------lgp
ENSMLUP00000001358  YLLEKI.........DT........DWYRGKC..........RN.........QTGVFPANHVKVI---------...
ENSMLUP00000005582  KVFGDKd........AD........GFYRGEG..........GG.........RRGYIPCNMVAEV---------avd
ENSMLUP00000012019  TVIEQNtgg......LE........GWWLCSL..........HG.........RQGIVPGNRVKLL---------igp
ENSMLUP00000007621  AVLEE-.........SG........EWWKARSla........TR.........KEGYIPSNYVA-----------r..
ENSMLUP00000000109  YIIEEDk........GD........GWTRARRq.........NG.........EEGYVPTSYI------------d..
ENSMLUP00000012976  RLHERA.........SD........DWWRGEH..........AG.........TCGLIPHKYITL----------peg
ENSMLUP00000010504  MVTQQS.........SD........GWLEGMRls........DG.........ERGWFPVHQVEFISNP------ev.
ENSMLUP00000007384  EDVQTSr........EP........GWLEGTL..........NG.........KRGLIPQNYVKL----------...
ENSMLUP00000002099  LIYQRV.........SD........GWYEGERlr........DG.........ERGWFPMECAKEI---------tcq
ENSMLUP00000010226  TVYSLPgm.......DP........DWLIGER..........GN.........KKGKVPVTYLEL----------l..
ENSMLUP00000001012  TVISRV.........DE........NWAEGKL..........GD.........KIGIFPILFVEP----------...
ENSMLUP00000012000  VVIDKN.........SG........GWWYVQI..........GE.........KEGWAPASYIDKRKKPN-----lsr
ENSMLUP00000014043  TVNKGSlvalgfs..DGqearpeeiGWLNGYNet........TG.........ERGDFPGTYVEYIG--------rkk
ENSMLUP00000017916  DNVHPSq........EP........GWLEGTL..........NG.........KTGLIPENYVE-----------f..
ENSMLUP00000002503  LLYQRA.........SD........DWWEGRH..........NG.........IDGLIPHQYIVV----------qd.
ENSMLUP00000009446  LLYHRA.........SE........DWWEGRH..........NG.........VDGLIPHQYIVVQ---------dmd
ENSMLUP00000013179  YILSKEyn.......RY........GWWVGEM..........KG.........AIGLVPKAYIME----------my.
ENSMLUP00000006973  LILRQT.........TA........DWWWGER..........AG.........YCGYIPANHL------------...
ENSMLUP00000013630  AVRTRT.........SD........GWLEGVRla........DG.........EKGWVPQAYVEEISSL------sa.
ENSMLUP00000012141  TITNPDv........GG........GWLEAKNs.........KG.........ERGLVPTDYVEILSSDGK----dpf
ENSMLUP00000013669  EVIEKN.........LS........GWWYIQI..........ED.........KEGWAPATFIDKYKK-------tsn
ENSMLUP00000006358  YVIEEDk........GD........GWTRIRRn.........ED.........EEGYVPTSYVEV----------y..
ENSMLUP00000002296  LILKKN.........AS........GWWQGELqargk.....KR.........QKGWFPASHVKLLG--------pss
ENSMLUP00000006507  SVIDMPpkv......LS........TWWRGKH..........GF.........QVGLFPGHCVELIN--------qkv
ENSMLUP00000011422  -----Y.........NN........DWWIGRLvke.......GC.........EVGFIPS---------------pvk
ENSMLUP00000008265  IVTGEE.........DQ........EWWIGHIege.......PE.........RKGVFPVSFVHIL---------s..
ENSMLUP00000011428  LLYHRA.........SE........DWWEGRH..........NG.........IDGLVPHQYIVVQ---------dmd
ENSMLUP00000002679  EVIQNT.........DD........TKVLCRNd.........EG.........KYGYVLRSYL------------...
ENSMLUP00000018941  TVIRRV.........DD........NWAEGML..........GD.........KIGIFPLLYVELN---------ds.
ENSMLUP00000005860  TVIRRV.........DE........NWAEGML..........AD.........KIGIFPISYVEF----------nsa
ENSMLUP00000011542  TIIGVP.........EP........GWFEGEL..........EG.........RRGIFPEGFVELL---------gp.
ENSMLUP00000020371  HILRFCdlsg.....NK........EWWLAEA..........RG.........QKGYVPANYL------------...
ENSMLUP00000011542  GVIKKKdpmg.....SP........NRWLIDN..........GV.........TKGFVYSSFLKPYN--------arr
ENSMLUP00000000496  KILSN-.........QE........EWFKAEL..........GS.........QEGYVPKNFIDI----------q..
ENSMLUP00000010676  RVLEMS.........DR........GWWLCRF..........GG.........RTGLLPSVLL------------q..
ENSMLUP00000011698  SVYVKLage......RE........DLWAGSK..........GK.........DFGYFPRDAVQI----------eev
ENSMLUP00000009701  VIFSENs........LD........GWLQGQNs.........LG.........ETGLFPASYVEIISS-------gts
ENSMLUP00000004596  RILSKE.........HNmy......GWWVGEL..........NS.........LIGIVPKEYL------------t..
ENSMLUP00000020371  AVMEQK.........DPlgst....SRWLVDT..........GI.........IKGYVYSSFLKPYNPA------kaq
ENSMLUP00000000207  EVIEDGd........ME........DWVKARNk.........VG.........QVGYVPEKYLQFP---------tsn
ENSMLUP00000014421  EILDD-.........RK........QWWKVRNa.........NG.........ESGFVPNNILDIVRSTE-----sgl
ENSMLUP00000013929  TVLEQH.........PD........GRWKGHIhesqrg....TD.........RVGYFPPGIVEVV---------s..
ENSMLUP00000003615  VVSRAAlqglgva..EGsercpqnvGWIPGLNer........TR.........QRGDFPGTYVEFLG--------pvt
ENSMLUP00000019445  DIISKP.........PM........GTWMGLL..........NN.........KVGTFKFIYVDVLNEEE-----ekp
ENSMLUP00000003921  TVLEQH.........PD........GRWKGCIhdnrtg....ND.........RVGYFPSSL-------------gea
ENSMLUP00000002679  EIIRLTdn.......PE........GKWLGRTt.........RG.........SYGYIKTTAVQ-----------...
ENSMLUP00000001797  QIIEKP.........PV........GTWLGLL..........NG.........RLGSFKFIYVDVLP--------e..
ENSMLUP00000007922  RVLGPA.........GG........DWLRCSR..........GP.........DTGLVPLAYVTLT---------pt.
ENSMLUP00000016884  RVWGSQd........TH........GFYRGEC..........NG.........QVGNIPGHLVAEVE--------dgl
ENSMLUP00000021898  NLALKA.........EQqprvr...GWLLASLd.........GQ.........TTGLIPANYVKILG--------krr
ENSMLUP00000018532  EVIEFT.........NK........EEMLCRDt.........KG.........KYGYVPRT--------------al.
ENSMLUP00000006141  EVIEFT.........NK........EEMLCRDt.........KG.........KYGYVPRT--------------al.
ENSMLUP00000012243  RVIATV.........DE........DWLRCGR..........DG.........MEGLVP----------------...
ENSMLUP00000007949  EVLEEGd........AD........EWVKARNq.........HS.........EVGFVPERYLN-----------fpd
ENSMLUP00000010409  ILVKKT.........ND........DWWQVKPde........NS.........KAFYVPAQYVKEVT--------rka
ENSMLUP00000000120  FVDPTQqeea.....SE........GWAIGISqr........TG.........CRGFLPENYTERAS--------ecd
ENSMLUP00000002448  FMSPVEqast.....SE........GWVYGTSlt........TG.........GSGLLPENYITKAD--------ecs
ENSMLUP00000006631  SNVYPSv........EP........GWLKATY..........EG.........KTGLVPENYVV-----------f..
ENSMLUP00000013267  YALKE-.........EG........DYIFARRlsg.......QP.........SVGLVPLAYVAK----------ata
ENSMLUP00000002140  QVLAVN.........QQ........NMCLVYQpasdhs....PA.........AEGWVPGSILAPL---------t..
ENSMLUP00000009401  DIISKP.........PM........GTWMGLL..........NN.........KVGTFKFIYVDVLNEEE-----ekp
ENSMLUP00000011645  GLLQNKdtkg.....NS........SRWLVDT..........GG.........HRGYVPAGKLEPY---------q..
ENSMLUP00000000142  ELTKAEa........EQ........NWWEGRNta........TN.........EVGWFPCNRVKPY---------vh.
ENSMLUP00000013622  KVTRMN.........IN........GQWEGEV..........NG.........RKGLFPFTHVKIFDPQNP----d..
ENSMLUP00000002497  ELLRGDa........HS........LFWQGRNla........SG.........EVGFFPSDAVKPCPCV------pkp
ENSMLUP00000013669  EVREKN.........SS........GWWFCQVlsga......PS.........WEGWIPSNYLR-----------k..
ENSMLUP00000008144  SLMEEDk........GD........GWTRVRRk.........QG.........GEGYVPTSYLR-----------v..
ENSMLUP00000004680  TLLVAEe........RD........GWLYGEHdt........SK.........ARGWFPSSYTRLLE--------e..
ENSMLUP00000010492  IVHNEL.........ED........GWMWVTNlr........TD.........EQGLIVEDLVEEVGR-------eed
ENSMLUP00000011542  ILDGAP.........TA........GWLQGRSc.........WG.........ARGFFPSSCVREL---------cls
ENSMLUP00000000726  QILASN.........QQ........NMFLVFRaatdqc....PA.........AEGWIPG---------------fvl
ENSMLUP00000016884  TVYGPVd........DR........GFYYGES..........GG.........HRGLVPAHLLDY----------ms.
ENSMLUP00000002474  KVTKIN.........VN........GQWEGEC..........NG.........KRGHFPFTHVRLLDQQNP----d..
ENSMLUP00000013417  LVELQA.........ED........YWYEAYNmr........TG.........ARGIFPAYYAIE----------vt.
ENSMLUP00000012000  EVLERN.........PN........GWWYCQIldgv......KP.........FKGWVPSNYLE-----------k..
ENSMLUP00000001859  HILET-.........YE........GWYRGYTlrk.......KS.........KKGIFPASYIHLK---------eai
ENSMLUP00000016646  VSVQQI.........GD........SWMYGTVer........TG.........DTGMLPANYVE-----------a..
ENSMLUP00000009616  EVVQEG.........EE........GLWYVRNlt........SS.........KEGWVPASSL------------sml
ENSMLUP00000010476  YVDDTL.........PQgtf.....GSWMAWQl.........DEnaqki....QRGQIPSKYVM-----------dqe
ENSMLUP00000003844  DIICKT.........PM........GMWTGML..........NN.........KVGNFKFIYVDVISEEE-----sap
ENSMLUP00000012979  DVIDVT.........EE........NLVICRNs.........KG.........KYGYV-----------------lie
ENSMLUP00000010870  TASKRE.........NE........P------..........DG.........HFGMFPANYVELI---------...
ENSMLUP00000004205  TILEACe........SK........SWYRAKHha........SG.........QEGLLAAGALRER---------eal
ENSMLUP00000000726  EVLERPhd.......KP........DWCLVRTtdrs......PA.........AEGLVPCG--------------slc
ENSMLUP00000008845  TIISE-.........DG........DWWTVLSeg........SG.........REYSVPSIHVAKI---------s..
ENSMLUP00000012305  DIIKED.........VF........SWPLDIV..........LG.........FTGIGPNCLVE-----------k..
ENSMLUP00000000937  LLIRKT.........NS........DWWLARRlgaps.....TS.........RPIFVPAAYMT-----------ees
ENSMLUP00000002140  ELLERPse.......RP........GWCLVRTters......PP.........QEGLVPSSAL------------cis
ENSMLUP00000016537  TVIEGRa........EN........YWWRGQNtr........TL.........CVGPFPRNVV------------t..
ENSMLUP00000015982  TVIEGRa........EN........YWWRGQNtr........TL.........CVGPFPRNVV------------t..
ENSMLUP00000009378  EIVGFVip.......GL........QWFIGKSac........SG.........EVGFVPTRNI------------dp.
ENSMLUP00000001358  VPNEYV.........NE........EWAGGEP..........RG.........RTRISPLNLVELVEDHP-----tsg
ENSMLUP00000010676  DVLLRH.........PS........GWWLVANe.........DQ.........QTAWFPAPYLEEV---------...
ENSMLUP00000011918  QILEK-.........CD........GWYRGFAlkn.......PN.........IKGIFPSSYVH-----------l..
ENSMLUP00000006188  ------.........SS........GWWKGRL..........HG.........QEGLFPGNYVEKI---------...
ENSMLUP00000004439  RVVDTL.........YNgkl.....GSWLAIRigk.......NHkev......ERGIIP----------------nkn
ENSMLUP00000004210  GVAGNH.........WD........GYSKGVNrk........LG.........RTGLYPSYKVRE----------kie
ENSMLUP00000015169  ILDHDTgeqvm....NS........GWANGINer........TK.........QRGDFPTDCVYVMP--------tvt
ENSMLUP00000013320  KILNMEd........DQ........NWYKAE-..........--.........----------------------l..
ENSMLUP00000000142  KILNKKg........QQ........GWWRGE-..........--.........----------------------i..
ENSMLUP00000006936  QILEK-.........CE........GWYRGVStkk.......PN.........VKGIFPANYIHL----------k..
ENSMLUP00000010147  RVVDTL.........YDgklg....HWLAVRIgn........EL.........EKGLIP----------------nks
ENSMLUP00000009801  HVLDTLypgpgqghaRG........GQWLAVRmgrdlr....EQ.........ERGIIP----------------nqk
ENSMLUP00000018134  KVIEKPgn.......DQ........ERWKCKNa.........WG.........QAGLPP-N--------------yv.
ENSMLUP00000016407  QILKE-.........SG........DWWLA--..........--.........----------------------k..
ENSMLUP00000010152  RVISD-.........EG........GWWKAISls........TG.........RENYIPGICV------------a..
ENSMLUP00000009378  SVKTAD.........GG........SECEGMSlv........TG.........QRGLVPVSALEPLP--------lpf
ENSMLUP00000020593  ------.........-G........GWITGTLcf........PS.........RSGWFPEAYVKPLEEVPVN---pmn
ENSMLUP00000019238  KVIEKPgn.......DQ........ERWKCKNa.........WG.........QAGLV-----------------...
ENSMLUP00000001358  VLLKQA.........EN........NYLECQK..........GK.........VTGRVHLSQMKIIT--------pld
ENSMLUP00000000215  DVVEK-.........--........-------..........--.........----------------------ge.
ENSMLUP00000004531  VQKGDE.........AG........GYVKVYT..........GR.........KVGLFPTDFLEEI---------...
ENSMLUP00000001760  LATRG-.........LR........YWLYGDKilddsfiegvSR.........IRGWFPRNCVEKCP--------cda


                                                                                                    
                                                                                                    
d1udla_               pssg..........................................................................
ENSMLUP00000003159  leniriqqeqkrgrfhggkssgnsssslgemvsgtfratptsaakqkqkvtehippydvv..................
ENSMLUP00000006192  fvrrdwdnsgpfcgtlsskkkkkmmylttrnaefdrhe........................................
ENSMLUP00000001660  lenmrlqheqrakqgkfyssklggnsssslgdivpssrkstppssaididatgldaeendipanhrspkpsansvtsp
ENSMLUP00000010880  asvaqsapseapscspfgkkkkykdkylakhsaifdqldvv.....................................
ENSMLUP00000010026  lesirlkqeqkarrsgnpsslsdignrrspppslakqkqkqaehvppydvv...........................
ENSMLUP00000016306  fvrrdwdnsgpfcgtlsskkkkkmmylttrnaefdrhe........................................
ENSMLUP00000002731  aciamektkqeqqasctwfgkkkkqykdkylakhnavfdqldl...................................
ENSMLUP00000012398  fvkrdleltpnsgtlcgslsgkkkkrmmylttknaefdrhe.....................................
ENSMLUP00000007590  vekkerarlktvkfnsktrgdkgeipddmgskglkhvtsnasdsessylilitdeygcskggqeeyvlsyepvnqqev
ENSMLUP00000001366  alrrpeiivqplkisnrkssgfrrsfrlsrkdkktnktmyeckksdqydtadv.........................
ENSMLUP00000005694  qqqreamkqtieedkepeksgklwcakknkkkrkkvlynanknddydnee............................
ENSMLUP00000016016  wsqpyqphthlkspmsismeee........................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000006692  lgrkdaerqllsfgnprgtfliresettkgayslsirdwddm....................................
ENSMLUP00000018425  verkerarlktvkfnakpgvidskgsfndkrkksfifsrkfpfyknkeqseqetsdpeqhassnasdsessyrgqedf
ENSMLUP00000002338  verrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgptkdranddllsefpdkfg...........
ENSMLUP00000010190  vekkerarlktvkfhartgmiesn......................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000013892  pksgtlks......................................................................
ENSMLUP00000016474  q.............................................................................
ENSMLUP00000004080  i.............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000013066  parppppaqp....................................................................
ENSMLUP00000002474  samiggnqegshpqplggpepgpyaqpsvn................................................
ENSMLUP00000010063  aikradaenqllysgnqtgafliresesekggfalsv.........................................
ENSMLUP00000007412  ..............................................................................
ENSMLUP00000011783  kegnrpkkppppsapvikq...........................................................
ENSMLUP00000007133  spkaikgf......................................................................
ENSMLUP00000005117  eelsenssstqgeeqqedagttrhkhseskqqmrtnviqeimntervy..............................
ENSMLUP00000005919  lsrkdaerqllapgnthgsfliresestagsfslsvrdfdq.....................................
ENSMLUP00000011432  nvwrccqpfsgnkeqgylslkenqicvgvgrskd............................................
ENSMLUP00000001119  ..............................................................................
ENSMLUP00000010330  ..............................................................................
ENSMLUP00000002843  ..............................................................................
ENSMLUP00000011946  ..............................................................................
ENSMLUP00000002942  qlrlhqpplr....................................................................
ENSMLUP00000008920  pkkppppakgpap.................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000017214  i.............................................................................
ENSMLUP00000021229  ..............................................................................
ENSMLUP00000008092  ..............................................................................
ENSMLUP00000001413  glepsppqcdyirpsltgkfagnpwyygkvtrh.............................................
ENSMLUP00000013669  slklgpgspahtgvldldgvsrpqnlggrekepls...........................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000015970  ..............................................................................
ENSMLUP00000001413  l.............................................................................
ENSMLUP00000015518  ..............................................................................
ENSMLUP00000013530  itrkdaerqllapgng..............................................................
ENSMLUP00000001958  ..............................................................................
ENSMLUP00000011783  dl............................................................................
ENSMLUP00000000207  gdapgmreirispspkppgslp........................................................
ENSMLUP00000007093  ..............................................................................
ENSMLUP00000013066  gaedypdppiphsyssdrihslssnkp...................................................
ENSMLUP00000003166  mese..........................................................................
ENSMLUP00000007433  yqeatkevpttdidff..............................................................
ENSMLUP00000007981  d.............................................................................
ENSMLUP00000005897  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000009512  ..............................................................................
ENSMLUP00000002296  sp............................................................................
ENSMLUP00000007216  kphkppt.......................................................................
ENSMLUP00000001866  dgveegpsdvqnghldpnsdclclgrplqnrdqmranvinei....................................
ENSMLUP00000003210  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000013622  sphgkhgnrnsnsygipepahaya......................................................
ENSMLUP00000007577  si............................................................................
ENSMLUP00000007981  lppshvpqisypgpagsgr...........................................................
ENSMLUP00000015831  srcqpggedpscypp...............................................................
ENSMLUP00000009890  ..............................................................................
ENSMLUP00000001358  ksm...........................................................................
ENSMLUP00000004195  ..............................................................................
ENSMLUP00000007864  ppce..........................................................................
ENSMLUP00000010897  ..............................................................................
ENSMLUP00000006579  vsrsaaeyllssling..............................................................
ENSMLUP00000019391  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005860  amtnas........................................................................
ENSMLUP00000010009  pkkl..........................................................................
ENSMLUP00000016474  akpvtdl.......................................................................
ENSMLUP00000008018  vsrnaaeyllssging..............................................................
ENSMLUP00000014609  tlpqrwreepgsitqrqq............................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000006831  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000011645  gwsl..........................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000007216  lrlcdegpqlpaspsmt.............................................................
ENSMLUP00000016474  aaspaplkrvaspaa...............................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000017975  hdkkpagpgpgppalltpp...........................................................
ENSMLUP00000018941  sv............................................................................
ENSMLUP00000005582  t.............................................................................
ENSMLUP00000017787  ..............................................................................
ENSMLUP00000015689  pslsqvppaepgspypape...........................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000012000  parkknlagpve..................................................................
ENSMLUP00000004960  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000018941  p.............................................................................
ENSMLUP00000007615  ..............................................................................
ENSMLUP00000017501  agq...........................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000014222  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000011016  ..............................................................................
ENSMLUP00000014075  dpd...........................................................................
ENSMLUP00000016089  ..............................................................................
ENSMLUP00000014075  iqpqqqpqddasp.................................................................
ENSMLUP00000010551  glkgdadgllcgvpapqgvssltsa.....................................................
ENSMLUP00000011784  ..............................................................................
ENSMLUP00000016474  kv............................................................................
ENSMLUP00000014409  tyewynksisrdkaekllldt.........................................................
ENSMLUP00000013262  isrlealhrlq...................................................................
ENSMLUP00000014923  ag............................................................................
ENSMLUP00000004002  rqspalrapmlrlssrp.............................................................
ENSMLUP00000020771  ag............................................................................
ENSMLUP00000007028  ..............................................................................
ENSMLUP00000010009  vknrvdyidlpysspsrsata.........................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000010822  ..............................................................................
ENSMLUP00000015288  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000022476  nn............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000011542  tvvl..........................................................................
ENSMLUP00000016384  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000003137  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000012406  tklslmpwfhgkitreqaerllcpp.....................................................
ENSMLUP00000009292  cppflrp.......................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000012000  gkepdavtakskqkegksdslekiekrvqalnt.............................................
ENSMLUP00000007949  lgpsessdpeqmlpspspp...........................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005582  tp............................................................................
ENSMLUP00000012019  vqetsssqdqptsglmh.............................................................
ENSMLUP00000007621  ..............................................................................
ENSMLUP00000000109  ..............................................................................
ENSMLUP00000012976  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000010226  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000012000  rtstltrpkvpppapp..............................................................
ENSMLUP00000014043  is............................................................................
ENSMLUP00000017916  ..............................................................................
ENSMLUP00000002503  ..............................................................................
ENSMLUP00000009446  d.............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000006973  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000012141  scgns.........................................................................
ENSMLUP00000013669  asrpnflaplpnema...............................................................
ENSMLUP00000006358  ..............................................................................
ENSMLUP00000002296  e.............................................................................
ENSMLUP00000006507  pqsvtnsvpkpv..................................................................
ENSMLUP00000011422  ldslrllqeqklrqnrlsssksgdnsssslgdvvtgtrrptppasafeldpleledeeaelgepggsaktsvssvttp
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000011428  d.............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005860  a.............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000011542  shsd..........................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011698  fipeeiqiptkesdflc.............................................................
ENSMLUP00000009701  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000020371  kkv...........................................................................
ENSMLUP00000000207  sllsmlq.......................................................................
ENSMLUP00000014421  gradppythti...................................................................
ENSMLUP00000013929  ..............................................................................
ENSMLUP00000003615  ..............................................................................
ENSMLUP00000019445  krptrrkrkgrppqpksvedlldrinlk..................................................
ENSMLUP00000003921  ivkragsragaeqsspq.............................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000001797  ..............................................................................
ENSMLUP00000007922  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000021898  g.............................................................................
ENSMLUP00000018532  ..............................................................................
ENSMLUP00000006141  ..............................................................................
ENSMLUP00000012243  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000010409  lmppvkqaaglpnnsm..............................................................
ENSMLUP00000000120  ..............................................................................
ENSMLUP00000002448  ..............................................................................
ENSMLUP00000006631  ..............................................................................
ENSMLUP00000013267  emfadqpwyfsgisrtqaqqlllspanvpgaflirpsessqgdyslsvraq...........................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009401  krptrrkrkgrppqpksvedlldrinlk..................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000002497  v.............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000008144  ..............................................................................
ENSMLUP00000004680  ..............................................................................
ENSMLUP00000010492  p.............................................................................
ENSMLUP00000011542  sq............................................................................
ENSMLUP00000000726  g.............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000013417  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000001859  vegrgqdetvipg.................................................................
ENSMLUP00000016646  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000010476  fsrrlsmsevkdds................................................................
ENSMLUP00000003844  rkiktrrrsgre..................................................................
ENSMLUP00000012979  hl............................................................................
ENSMLUP00000010870  ..............................................................................
ENSMLUP00000004205  sadpklslmpwfhgkisgqeavqllqppe.................................................
ENSMLUP00000000726  iahs..........................................................................
ENSMLUP00000008845  ..............................................................................
ENSMLUP00000012305  ..............................................................................
ENSMLUP00000000937  icsqs.........................................................................
ENSMLUP00000002140  h.............................................................................
ENSMLUP00000016537  ..............................................................................
ENSMLUP00000015982  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000001358  tnvfst........................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011918  ..............................................................................
ENSMLUP00000006188  ..............................................................................
ENSMLUP00000004439  r.............................................................................
ENSMLUP00000004210  tvkypt........................................................................
ENSMLUP00000015169  m.............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000006936  ..............................................................................
ENSMLUP00000010147  raeqmasvqnaqrdna..............................................................
ENSMLUP00000009801  raeqlasleaaqral...............................................................
ENSMLUP00000018134  ..............................................................................
ENSMLUP00000016407  ..............................................................................
ENSMLUP00000010152  ..............................................................................
ENSMLUP00000009378  hqwflknyp.....................................................................
ENSMLUP00000020593  pmnplnpvtsm...................................................................
ENSMLUP00000019238  ..............................................................................
ENSMLUP00000001358  ehlrsrpndp....................................................................
ENSMLUP00000000215  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000001760  ..............................................................................


                                                               
                                                               
d1udla_               .........................................
ENSMLUP00000003159  .........................................
ENSMLUP00000006192  .........................................
ENSMLUP00000001660  hskekrmpffkktehtppydvv...................
ENSMLUP00000010880  .........................................
ENSMLUP00000010026  .........................................
ENSMLUP00000016306  .........................................
ENSMLUP00000002731  .........................................
ENSMLUP00000012398  .........................................
ENSMLUP00000007590  nytrpviilgpmkdrinddlisefpdkfg............
ENSMLUP00000001366  .........................................
ENSMLUP00000005694  .........................................
ENSMLUP00000016016  .........................................
ENSMLUP00000013902  .........................................
ENSMLUP00000006692  .........................................
ENSMLUP00000018425  ilsyepvsrqeinytrpviilgpmkdrinddlisefpdkfg
ENSMLUP00000002338  .........................................
ENSMLUP00000010190  .........................................
ENSMLUP00000002296  .........................................
ENSMLUP00000013892  .........................................
ENSMLUP00000016474  .........................................
ENSMLUP00000004080  .........................................
ENSMLUP00000013902  .........................................
ENSMLUP00000013066  .........................................
ENSMLUP00000002474  .........................................
ENSMLUP00000010063  .........................................
ENSMLUP00000007412  .........................................
ENSMLUP00000011783  .........................................
ENSMLUP00000007133  .........................................
ENSMLUP00000005117  .........................................
ENSMLUP00000005919  .........................................
ENSMLUP00000011432  .........................................
ENSMLUP00000001119  .........................................
ENSMLUP00000010330  .........................................
ENSMLUP00000002843  .........................................
ENSMLUP00000011946  .........................................
ENSMLUP00000002942  .........................................
ENSMLUP00000008920  .........................................
ENSMLUP00000000496  .........................................
ENSMLUP00000013320  .........................................
ENSMLUP00000017214  .........................................
ENSMLUP00000021229  .........................................
ENSMLUP00000008092  .........................................
ENSMLUP00000001413  .........................................
ENSMLUP00000013669  .........................................
ENSMLUP00000002497  .........................................
ENSMLUP00000015970  .........................................
ENSMLUP00000001413  .........................................
ENSMLUP00000015518  .........................................
ENSMLUP00000013530  .........................................
ENSMLUP00000001958  .........................................
ENSMLUP00000011783  .........................................
ENSMLUP00000000207  .........................................
ENSMLUP00000007093  .........................................
ENSMLUP00000013066  .........................................
ENSMLUP00000003166  .........................................
ENSMLUP00000007433  .........................................
ENSMLUP00000007981  .........................................
ENSMLUP00000005897  .........................................
ENSMLUP00000005860  .........................................
ENSMLUP00000009512  .........................................
ENSMLUP00000002296  .........................................
ENSMLUP00000007216  .........................................
ENSMLUP00000001866  .........................................
ENSMLUP00000003210  .........................................
ENSMLUP00000008920  .........................................
ENSMLUP00000013622  .........................................
ENSMLUP00000007577  .........................................
ENSMLUP00000007981  .........................................
ENSMLUP00000015831  .........................................
ENSMLUP00000009890  .........................................
ENSMLUP00000001358  .........................................
ENSMLUP00000004195  .........................................
ENSMLUP00000007864  .........................................
ENSMLUP00000010897  .........................................
ENSMLUP00000006579  .........................................
ENSMLUP00000019391  .........................................
ENSMLUP00000001358  .........................................
ENSMLUP00000005860  .........................................
ENSMLUP00000010009  .........................................
ENSMLUP00000016474  .........................................
ENSMLUP00000008018  .........................................
ENSMLUP00000014609  .........................................
ENSMLUP00000009299  .........................................
ENSMLUP00000006831  .........................................
ENSMLUP00000003954  .........................................
ENSMLUP00000011645  .........................................
ENSMLUP00000012000  .........................................
ENSMLUP00000013586  .........................................
ENSMLUP00000002296  .........................................
ENSMLUP00000010009  .........................................
ENSMLUP00000007216  .........................................
ENSMLUP00000016474  .........................................
ENSMLUP00000001012  .........................................
ENSMLUP00000017975  .........................................
ENSMLUP00000018941  .........................................
ENSMLUP00000005582  .........................................
ENSMLUP00000017787  .........................................
ENSMLUP00000015689  .........................................
ENSMLUP00000002296  .........................................
ENSMLUP00000008920  .........................................
ENSMLUP00000012000  .........................................
ENSMLUP00000004960  .........................................
ENSMLUP00000016474  .........................................
ENSMLUP00000007216  .........................................
ENSMLUP00000018941  .........................................
ENSMLUP00000007615  .........................................
ENSMLUP00000017501  .........................................
ENSMLUP00000005582  .........................................
ENSMLUP00000013066  .........................................
ENSMLUP00000004531  .........................................
ENSMLUP00000014222  .........................................
ENSMLUP00000001012  .........................................
ENSMLUP00000011016  .........................................
ENSMLUP00000014075  .........................................
ENSMLUP00000016089  .........................................
ENSMLUP00000014075  .........................................
ENSMLUP00000010551  .........................................
ENSMLUP00000011784  .........................................
ENSMLUP00000016474  .........................................
ENSMLUP00000014409  .........................................
ENSMLUP00000013262  .........................................
ENSMLUP00000014923  .........................................
ENSMLUP00000004002  .........................................
ENSMLUP00000020771  .........................................
ENSMLUP00000007028  .........................................
ENSMLUP00000010009  .........................................
ENSMLUP00000018941  .........................................
ENSMLUP00000010822  .........................................
ENSMLUP00000015288  .........................................
ENSMLUP00000013669  .........................................
ENSMLUP00000022476  .........................................
ENSMLUP00000011542  .........................................
ENSMLUP00000011542  .........................................
ENSMLUP00000016384  .........................................
ENSMLUP00000005860  .........................................
ENSMLUP00000003137  .........................................
ENSMLUP00000016884  .........................................
ENSMLUP00000015858  .........................................
ENSMLUP00000012406  .........................................
ENSMLUP00000009292  .........................................
ENSMLUP00000001413  .........................................
ENSMLUP00000012000  .........................................
ENSMLUP00000007949  .........................................
ENSMLUP00000001358  .........................................
ENSMLUP00000005582  .........................................
ENSMLUP00000012019  .........................................
ENSMLUP00000007621  .........................................
ENSMLUP00000000109  .........................................
ENSMLUP00000012976  .........................................
ENSMLUP00000010504  .........................................
ENSMLUP00000007384  .........................................
ENSMLUP00000002099  .........................................
ENSMLUP00000010226  .........................................
ENSMLUP00000001012  .........................................
ENSMLUP00000012000  .........................................
ENSMLUP00000014043  .........................................
ENSMLUP00000017916  .........................................
ENSMLUP00000002503  .........................................
ENSMLUP00000009446  .........................................
ENSMLUP00000013179  .........................................
ENSMLUP00000006973  .........................................
ENSMLUP00000013630  .........................................
ENSMLUP00000012141  .........................................
ENSMLUP00000013669  .........................................
ENSMLUP00000006358  .........................................
ENSMLUP00000002296  .........................................
ENSMLUP00000006507  .........................................
ENSMLUP00000011422  sphgkrisffkktehvppydvv...................
ENSMLUP00000008265  .........................................
ENSMLUP00000011428  .........................................
ENSMLUP00000002679  .........................................
ENSMLUP00000018941  .........................................
ENSMLUP00000005860  .........................................
ENSMLUP00000011542  .........................................
ENSMLUP00000020371  .........................................
ENSMLUP00000011542  .........................................
ENSMLUP00000000496  .........................................
ENSMLUP00000010676  .........................................
ENSMLUP00000011698  .........................................
ENSMLUP00000009701  .........................................
ENSMLUP00000004596  .........................................
ENSMLUP00000020371  .........................................
ENSMLUP00000000207  .........................................
ENSMLUP00000014421  .........................................
ENSMLUP00000013929  .........................................
ENSMLUP00000003615  .........................................
ENSMLUP00000019445  .........................................
ENSMLUP00000003921  .........................................
ENSMLUP00000002679  .........................................
ENSMLUP00000001797  .........................................
ENSMLUP00000007922  .........................................
ENSMLUP00000016884  .........................................
ENSMLUP00000021898  .........................................
ENSMLUP00000018532  .........................................
ENSMLUP00000006141  .........................................
ENSMLUP00000012243  .........................................
ENSMLUP00000007949  .........................................
ENSMLUP00000010409  .........................................
ENSMLUP00000000120  .........................................
ENSMLUP00000002448  .........................................
ENSMLUP00000006631  .........................................
ENSMLUP00000013267  .........................................
ENSMLUP00000002140  .........................................
ENSMLUP00000009401  .........................................
ENSMLUP00000011645  .........................................
ENSMLUP00000000142  .........................................
ENSMLUP00000013622  .........................................
ENSMLUP00000002497  .........................................
ENSMLUP00000013669  .........................................
ENSMLUP00000008144  .........................................
ENSMLUP00000004680  .........................................
ENSMLUP00000010492  .........................................
ENSMLUP00000011542  .........................................
ENSMLUP00000000726  .........................................
ENSMLUP00000016884  .........................................
ENSMLUP00000002474  .........................................
ENSMLUP00000013417  .........................................
ENSMLUP00000012000  .........................................
ENSMLUP00000001859  .........................................
ENSMLUP00000016646  .........................................
ENSMLUP00000009616  .........................................
ENSMLUP00000010476  .........................................
ENSMLUP00000003844  .........................................
ENSMLUP00000012979  .........................................
ENSMLUP00000010870  .........................................
ENSMLUP00000004205  .........................................
ENSMLUP00000000726  .........................................
ENSMLUP00000008845  .........................................
ENSMLUP00000012305  .........................................
ENSMLUP00000000937  .........................................
ENSMLUP00000002140  .........................................
ENSMLUP00000016537  .........................................
ENSMLUP00000015982  .........................................
ENSMLUP00000009378  .........................................
ENSMLUP00000001358  .........................................
ENSMLUP00000010676  .........................................
ENSMLUP00000011918  .........................................
ENSMLUP00000006188  .........................................
ENSMLUP00000004439  .........................................
ENSMLUP00000004210  .........................................
ENSMLUP00000015169  .........................................
ENSMLUP00000013320  .........................................
ENSMLUP00000000142  .........................................
ENSMLUP00000006936  .........................................
ENSMLUP00000010147  .........................................
ENSMLUP00000009801  .........................................
ENSMLUP00000018134  .........................................
ENSMLUP00000016407  .........................................
ENSMLUP00000010152  .........................................
ENSMLUP00000009378  .........................................
ENSMLUP00000020593  .........................................
ENSMLUP00000019238  .........................................
ENSMLUP00000001358  .........................................
ENSMLUP00000000215  .........................................
ENSMLUP00000004531  .........................................
ENSMLUP00000001760  .........................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0049867 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Arthrobacter arilaitensis Re117
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus sp.
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Roseburia hominis A2-183
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium perfringens ATCC 13124
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Exiguobacterium sp. AT1b
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Bacillus sp. JS
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella intermedia 17
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Sphingobacterium sp. 21
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Cellulophaga algicola DSM 14237
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Methylacidiphilum infernorum V4
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Deferribacter desulfuricans SSM1
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Pelobacter propionicus DSM 2379
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Achromobacter xylosoxidans A8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Magnetococcus marinus MC-1
NoYes   Ruegeria sp. TM1040
NoYes   Rhodospirillum rubrum F11
NoYes   Starkeya novella DSM 506
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Pelagibacterium halotolerans B2
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bartonella tribocorum CIP 105476
NoYes   Haemophilus parasuis SH0165
NoYes   Vibrio anguillarum 775
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Marinomonas mediterranea MMB-1
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Enterobacter sp. R4-368
NoYes   Pseudomonas entomophila L48
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Methanococcus vannielii SB
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Clostridium thermocellum DSM 1313
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium sp. SY8519
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Thermoanaerobacter sp. X513
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Haemophilus parasuis ZJ0906
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Pantoea ananatis PA13
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas mendocina NK-01
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]