SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Trypsin-like serine proteases alignments in Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

These alignments are sequences aligned to the 0034885 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1a5ia_                           ..................................................................
gi|62201369|gb|AAH93474|        mlifllqrgsvgaaslpstndvs...........................................
gi|71895773|ref|NP_001025685|   mlifllqrgsvgaaslpstndvs...........................................
gi|301620776|gb|XP_002939747|   etfllllafvsptivsttpapps...........................................
gi|45708911|gb|AAH67937|        lcvvlsilhhqayggp..................................................
gi|47575768|ref|NP_001001228|   lcvvlsilhhqayggp..................................................
gi|301620758|gb|XP_002939739|   lsllraalllslgflgvseavaq...........................................
gi|301623566|gb|XP_002941080|   ld................................................................
gi|301620778|gb|XP_002939748|   ylsfalifihhqvvtvvettsa............................................
gi|49670651|gb|AAH75423|        ld................................................................
gi|52345790|ref|NP_001004941|   ld................................................................
gi|49522964|gb|AAH75293|        etfllllafvsptivsttpapps...........................................
gi|54020930|ref|NP_001005710|   etfllllafvsptivsttpapps...........................................
gi|59808136|gb|AAH89741|        dd................................................................
gi|62752849|ref|NP_001015792|   dd................................................................
gi|301621490|gb|XP_002940084|   gsdekncn..........................................................
gi|301628802|gb|XP_002943535|   dd................................................................
gi|111307978|gb|AAI21657|       gadglsceptvnyp....................................................
gi|118403542|ref|NP_001072819|  gadglsceptvnyp....................................................
gi|163916428|gb|AAI57199|       gadglsceptvnyp....................................................
gi|159155191|gb|AAI54713|       v.................................................................
gi|163915041|ref|NP_001106508|  v.................................................................
gi|301626232|gb|XP_002942299|   praipvd...........................................................
gi|169642526|gb|AAI60565|       ntpdg.............................................................
gi|187607167|ref|NP_001120289|  ntpdg.............................................................
gi|301620740|gb|XP_002939730|   evtifaae..........................................................
gi|49522964|gb|AAH75293|        vsptilsttpappa....................................................
gi|54020930|ref|NP_001005710|   vsptilsttpappa....................................................
gi|56611173|gb|AAH87759|        dd................................................................
gi|58332122|ref|NP_001011209|   dd................................................................
gi|301620750|gb|XP_002939735|   dss...............................................................
gi|301620756|gb|XP_002939738|   qtvlllnlglfgvkeavte...............................................
gi|301621490|gb|XP_002940084|   riteparstqrpd.....................................................
gi|301620768|gb|XP_002939743|   lllavgfavtaistg...................................................
gi|56541274|gb|AAH87610|        fd................................................................
gi|58332100|ref|NP_001011202|   fd................................................................
gi|58476395|gb|AAH89747|        vcglrplfeqksvedkgekelles..........................................
gi|62751950|ref|NP_001015797|   vcglrplfeqksvedkgekelles..........................................
gi|301623009|gb|XP_002940815|   lifcslalliiatgpshiwaysg...........................................
gi|301609429|gb|XP_002934284|   pdgsdenncg........................................................
gi|301628804|gb|XP_002943536|   fd................................................................
gi|301628800|gb|XP_002943534|   fd................................................................
gi|301623523|gb|XP_002941065|   qar...............................................................
gi|301614043|gb|XP_002936502|   ttaytttaadftacgigg................................................
gi|301620764|gb|XP_002939741|   llqalllltpgllgitpgatd.............................................
gi|56611148|gb|AAH87751|        willflavaaaa......................................................
gi|58332104|ref|NP_001011204|   willflavaaaa......................................................
gi|89269870|gb|CAJ83405|        agiillllvsasptvsqnttaspri.........................................
gi|166796549|gb|AAI58898|       agiillllvsasptvsqnttaspri.........................................
gi|167908783|ref|NP_001016055|  agiillllvsasptvsqnttaspri.........................................
gi|213627780|gb|AAI71053|       agiillllvsasptvsqnttaspri.........................................
gi|301623529|gb|XP_002941068|   tqt...............................................................
gi|56611170|gb|AAH87830|        willflavaaaa......................................................
gi|58332206|ref|NP_001011251|   willflavaaaa......................................................
gi|58476361|gb|AAH89695|        srvcscaqgyrlnddyktcqpavefp........................................
gi|62751546|ref|NP_001015759|   srvcscaqgyrlnddyktcqpavefp........................................
gi|56270387|gb|AAH87611|        llqalllltpgllgitpgatd.............................................
gi|58332094|ref|NP_001011195|   llqalllltpgllgitpgatd.............................................
gi|301620770|gb|XP_002939744|   vflfllvtsapilsaatvysapa...........................................
gi|301623525|gb|XP_002941066|   qt................................................................
gi|56541161|gb|AAH87563|        aaaf..............................................................
gi|58332102|ref|NP_001011199|   aaaf..............................................................
gi|56971223|gb|AAH88079|        lwvlmflavaaaa.....................................................
gi|58332720|ref|NP_001011435|   lwvlmflavaaaa.....................................................
gi|56556311|gb|AAH87753|        tqt...............................................................
gi|301620774|gb|XP_002939746|   tealllllasvspsvsdttstls...........................................
gi|301621490|gb|XP_002940084|   ..................................................................
gi|301618335|gb|XP_002938574|   lwvlmflavaaaa.....................................................
gi|301627387|gb|XP_002942851|   gyays.............................................................
gi|51895949|gb|AAH80976|        gyays.............................................................
gi|56118865|ref|NP_001008077|   gyays.............................................................
gi|301618337|gb|XP_002938575|   lwvlmflavaaaapld..................................................
gi|301611781|gb|XP_002935401|   wlvsclalattvyg....................................................
gi|56971185|gb|AAH88769|        ligstyg...........................................................
gi|58743375|ref|NP_001011477|   ligstyg...........................................................
gi|301611783|gb|XP_002935402|   wlvsclalatrvyg....................................................
gi|301606691|gb|XP_002932950|   cld...............................................................
gi|57870463|gb|AAH89075|        stygcgspais.......................................................
gi|62751938|ref|NP_001015686|   stygcgspais.......................................................
gi|301610206|gb|XP_002934644|   aigafpct..........................................................
gi|159155760|gb|AAI54947|       f.................................................................
gi|301632763|gb|XP_002945450|   f.................................................................
gi|301623527|gb|XP_002941067|   qtqt..............................................................
gi|56611133|gb|AAH87787|        vtv...............................................................
gi|58332150|ref|NP_001011223|   vtv...............................................................
gi|301620772|gb|XP_002939745|   spl...............................................................
gi|301614103|gb|XP_002936536|   lilfstg...........................................................
gi|60552068|gb|AAH91088|        c.................................................................
gi|301627389|gb|XP_002942852|   c.................................................................
gi|301623007|gb|XP_002940814|   ksg...............................................................
gi|301612271|gb|XP_002935645|   ld................................................................
gi|301603857|gb|XP_002931605|   rlvdrdrf..........................................................
gi|301615211|gb|XP_002937069|   lkltaiflfffaiyvlisisesaetce.......................................
gi|301615213|gb|XP_002937070|   lkltaiflfffaiyvlisisesaetce.......................................
gi|301603863|gb|XP_002931607|   iffifyliyesesaigg.................................................
gi|301627010|gb|XP_002942670|   llsgayg...........................................................
gi|56972340|gb|AAH88057|        llsgayg...........................................................
gi|58332702|ref|NP_001011426|   llsgayg...........................................................
gi|39850054|gb|AAH64277|        lattvyg...........................................................
gi|301615217|gb|XP_002937076|   kltaifsfffaiyvlisisesaetce........................................
gi|301630725|gb|XP_002944467|   rv................................................................
gi|60552029|gb|AAH91010|        ..................................................................
gi|71896209|ref|NP_001025574|   ..................................................................
gi|301620748|gb|XP_002939734|   ..................................................................
gi|301615956|gb|XP_002937430|   ltaalfslps........................................................
gi|301622787|gb|XP_002940708|   mqllvlltvvlcscp...................................................
gi|56789422|gb|AAH88038|        llvlltvvlcscp.....................................................
gi|56611135|gb|AAH87810|        aalahg............................................................
gi|301624444|gb|XP_002941509|   mdwfhlitallllnlgfygcaaddaept......................................
gi|301615068|gb|XP_002937000|   im................................................................
gi|301618415|gb|XP_002938616|   cf................................................................
gi|301627689|gb|XP_002943002|   id................................................................
gi|58477045|gb|AAH89660|        vvcsctngyilgengksclptekyscgrrhmkrerretklhendkknhtdsqnevkmnqtgtlper
gi|62751697|ref|NP_001015728|   vvcsctngyilgengksclptekyscgrrhmkrerretklhendkknhtdsqnevkmnqtgtlper
gi|301622330|gb|XP_002940490|   ..................................................................
gi|301620762|gb|XP_002939724|   sallllnlg.........................................................
gi|301614101|gb|XP_002936535|   cis...............................................................
gi|57032953|gb|AAH88892|        litallllnlgfygcaaddaept...........................................
gi|301620357|gb|XP_002939545|   ..................................................................
gi|58477078|gb|AAH89729|        ..................................................................
gi|58476369|gb|AAH89702|        ddnkpt............................................................
gi|301624442|gb|XP_002941516|   lqglllltla........................................................
gi|56585195|gb|AAH87729|        tgayg.............................................................
gi|56971746|gb|AAH88036|        tgayg.............................................................
gi|58332692|ref|NP_001011421|   tgayg.............................................................
gi|301614099|gb|XP_002936522|   cnyskvcictnqicngvpdcpygddeqncg....................................
gi|301627056|gb|XP_002942694|   ..................................................................
gi|301620744|gb|XP_002939732|   ravfwlslgtygimraaad...............................................
gi|301627687|gb|XP_002943001|   asgnivslrcin......................................................
gi|301620752|gb|XP_002939736|   skdfepwt..........................................................
gi|301620760|gb|XP_002939740|   ddnkpt............................................................
gi|301614101|gb|XP_002936535|   is................................................................
gi|301612617|gb|XP_002935812|   ..................................................................
gi|57032843|gb|AAH88882|        vlcgqcsndirli.....................................................
gi|58332834|ref|NP_001011493|   vlcgqcsndirli.....................................................
gi|62531104|gb|AAH92553|        cdedigfie.........................................................
gi|71895833|ref|NP_001025669|   cdedigfie.........................................................
gi|113931254|ref|NP_001039074|  caacg.............................................................
gi|89273918|gb|CAJ81839|        caacg.............................................................
gi|301614097|gb|XP_002936534|   tdlllig...........................................................
gi|187469575|gb|AAI67128|       e.................................................................
gi|301608337|gb|XP_002933738|   e.................................................................
gi|62859195|ref|NP_001016980|   llavshfelgrsqe....................................................
gi|89272057|gb|CAJ83340|        llavshfelgrsqe....................................................
gi|134023759|gb|AAI35327|       mvpnitsvytcdasgewknqetgakfptcqpv..................................
gi|147901778|ref|NP_001090874|  mvpnitsvytcdasgewknqetgakfptcqpv..................................
gi|301608335|gb|XP_002933737|   vlaalvlcghcfndvr..................................................
gi|161612048|gb|AAI56020|       ed................................................................
gi|56971188|gb|AAH88782|        cgrcdvddsyved.....................................................
gi|58332812|ref|NP_001011481|   cgrcdvddsyved.....................................................
gi|66990056|gb|AAH98090|        ls................................................................
gi|73853846|ref|NP_001027508|   ls................................................................
gi|54035177|gb|AAH84139|        tppicvpd..........................................................
gi|58332348|ref|NP_001011037|   tppicvpd..........................................................
gi|56789096|gb|AAH88027|        cmrmgqhcifllflslvsflpysfag........................................
gi|353523845|ref|NP_001238808|  vsflpysfag........................................................
gi|301610620|gb|XP_002934851|   cmrmgqhcifllflslvsflpysfag........................................
gi|301627008|gb|XP_002942673|   sp................................................................
gi|39794386|gb|AAH64208|        llavvlvltvatye....................................................
gi|45361487|ref|NP_989320|      llavvlvltvatye....................................................
gi|82237461|sp|Q6P326|          llavvlvltvatye....................................................
gi|301619167|gb|XP_002938973|   alrmlatpippcvhcgnrplyntlspefqnqk..................................
gi|56789072|gb|AAH88011|        lv................................................................
gi|58332288|ref|NP_001011293|   lv................................................................
gi|113205726|ref|NP_001037931|  pv................................................................
gi|89266985|gb|CAJ81306|        pv................................................................
gi|301619169|gb|XP_002938974|   lkel..............................................................
gi|301623913|gb|XP_002941253|   kelpictpv.........................................................
gi|163915777|gb|AAI57637|       afht..............................................................
gi|166158186|ref|NP_001107486|  afht..............................................................
gi|301626232|gb|XP_002942299|   ..................................................................
gi|66396569|gb|AAH96515|        riprcrpv..........................................................
gi|301623915|gb|XP_002941259|   riprcrpv..........................................................
gi|66396598|gb|AAH96508|        nsrgnkelpictpv....................................................
gi|301618553|gb|XP_002938678|   wddiqiewpn........................................................
gi|301619614|gb|XP_002939175|   ..................................................................
gi|301623919|gb|XP_002941255|   kiplclpv..........................................................
gi|301623917|gb|XP_002941260|   csaqgewrdeyggvkiprcrpv............................................
gi|49899920|gb|AAH76933|        sm................................................................
gi|55742037|ref|NP_001006847|   sm................................................................
gi|163915656|gb|AAI57668|       yiy...............................................................
gi|165973394|ref|NP_001107158|  yiy...............................................................
gi|213627368|gb|AAI71196|       yiy...............................................................
gi|301622373|gb|XP_002940514|   fcfcfcfvseycssgnvitlkcv...........................................
gi|301623711|gb|XP_002941159|   cect..............................................................
gi|301609058|gb|XP_002934098|   l.................................................................
gi|301607053|gb|XP_002933130|   i.................................................................
gi|301620754|gb|XP_002939737|   vn................................................................
gi|301631044|gb|XP_002944619|   ..................................................................
gi|301629851|gb|XP_002944046|   ..................................................................
gi|301629862|gb|XP_002944051|   willflavaaaa......................................................
gi|301619787|gb|XP_002939269|   a.................................................................
gi|301627058|gb|XP_002942695|   ..................................................................
gi|301629849|gb|XP_002944045|   kwn...............................................................
gi|301626232|gb|XP_002942299|   dve...............................................................
gi|301609784|gb|XP_002934450|   lp................................................................
gi|301631575|gb|XP_002944873|   fqqn..............................................................
gi|301607830|gb|XP_002933508|   ked...............................................................
gi|301620748|gb|XP_002939734|   gtlisiynvtstteattvsdp.............................................
gi|301623709|gb|XP_002941155|   rt................................................................
gi|301609490|gb|XP_002934300|   nkelspl...........................................................
gi|301607063|gb|XP_002933142|   tcsssk............................................................
gi|116487755|gb|AAI25706|       nfiadvvekiapavvhielfrmlpffkrevpaa.................................
gi|134023797|gb|AAI35435|       nfiadvvekiapavvhielfrmlpffkrevpaa.................................
gi|350276152|ref|NP_001072730|  nfiadvvekiapavvhielfrmlpffkrevpaa.................................
gi|301620766|gb|XP_002939742|   lqalllltpd........................................................
gi|301609058|gb|XP_002934098|   rtlk..............................................................
gi|301606403|gb|XP_002932829|   fnfiadvvqkiapavvhlelfrrspftgqemav.................................
gi|163915807|gb|AAI57677|       nnmt..............................................................
gi|166158294|ref|NP_001107513|  nnmt..............................................................
gi|213624433|gb|AAI71092|       nnmt..............................................................
gi|213625671|gb|AAI71088|       nnmt..............................................................
gi|301620338|gb|XP_002939538|   sl................................................................
gi|301622789|gb|XP_002940709|   pv................................................................
gi|301603859|gb|XP_002931606|   et................................................................
gi|301618560|gb|XP_002938688|   iadvvekiapavvhielflrhplfgrnvpl....................................
gi|49522408|gb|AAH75430|        spfyrrtgssrrtclktgkwsgrapscipicgklenfnitqlg.......................
gi|52345796|ref|NP_001004944|   spfyrrtgssrrtclktgkwsgrapscipicgklenfnitqlg.......................
gi|82183464|sp|Q6DIV5|          spfyrrtgssrrtclktgkwsgrapscipicgklenfnitqlg.......................
gi|301614097|gb|XP_002936534|   s.................................................................
gi|301624064|gb|XP_002941330|   e.................................................................
gi|301631613|gb|XP_002944892|   pld...............................................................
gi|301631166|gb|XP_002944677|   ..................................................................
gi|301614089|gb|XP_002936531|   enivfds...........................................................
gi|301623570|gb|XP_002941088|   llcd..............................................................
gi|301618553|gb|XP_002938678|   skisgtsg..........................................................
gi|169642095|gb|AAI60801|       nahvvvnkrgvrvkltngetysatvqdvdq....................................
gi|288684101|ref|NP_001165762|  nahvvvnkrgvrvkltngetysatvqdvdq....................................
gi|301627723|gb|XP_002943019|   h.................................................................
gi|169642366|gb|AAI60557|       scscangyklgadekschpedpfacgqilnlevsitknrnh.........................
gi|56789309|gb|AAH88065|        scscangyklgadekschpedpfacgqilnlevsitknrnh.........................
gi|313851093|ref|NP_001116189|  scscangyklgadekschpedpfacgqilnlevsitknrnh.........................
gi|301627727|gb|XP_002943021|   em................................................................
gi|301620760|gb|XP_002939740|   pe................................................................
gi|301614097|gb|XP_002936534|   sficinanqicdgvpdcpygddeencg.......................................
gi|301632426|gb|XP_002945286|   ly................................................................
gi|301603859|gb|XP_002931606|   s.................................................................
gi|169641896|gb|AAI60561|       diltvcecpsgrflsvqcqd..............................................
gi|187607137|ref|NP_001120287|  diltvcecpsgrflsvqcqd..............................................
gi|301613000|gb|XP_002936003|   hkltkkqiasvvl.....................................................
gi|301620752|gb|XP_002939736|   r.................................................................
gi|301612998|gb|XP_002936002|   hkltkkqiasvvl.....................................................
gi|160774415|gb|AAI55421|       rqiyghdsrfsiygkdflln..............................................
gi|163915255|ref|NP_001106591|  rqiyghdsrfsiygkdflln..............................................
gi|301618176|gb|XP_002938505|   rkrqiygtdsrfsisdkqf...............................................
gi|301610794|gb|XP_002934945|   sirsrkfl..........................................................
gi|301630837|gb|XP_002944523|   svtggs............................................................
gi|163916178|gb|AAI57579|       mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|166158059|ref|NP_001107438|  mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|163915732|gb|AAI57581|       mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|288684088|ref|NP_001165761|  mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|163915698|gb|AAI57530|       mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|166158009|ref|NP_001107414|  mgspfslkntitsgivssaqrgskelglsnsnmdyiqtd...........................
gi|301618333|gb|XP_002938578|   immplwvlmflavaaaapld..............................................
gi|49900216|gb|AAH76994|        gv................................................................
gi|52346064|ref|NP_001005075|   gv................................................................
gi|301612998|gb|XP_002936002|   nkapqtecdgqwscsgvildrslalvlchgaiffpflknnenafsknnllaedfesdliiqvecps
gi|301613000|gb|XP_002936003|   nkapqtecdgqwscsgvildrslalvlchgaiffpflknnenafsknnllaedfesdliiqvecps
gi|301630168|gb|XP_002944198|   mgspfslqntitsgivssvqrgghelglanrdmeyiqtd...........................
gi|301615558|gb|XP_002937233|   grwllvcsgmvagav...................................................


                                                                                                    
                                                                                                    
d1a5ia_                           ..................................................................
gi|62201369|gb|AAH93474|        ..................................................................
gi|71895773|ref|NP_001025685|   ..................................................................
gi|301620776|gb|XP_002939747|   ..................................................................
gi|45708911|gb|AAH67937|        ..................................................................
gi|47575768|ref|NP_001001228|   ..................................................................
gi|301620758|gb|XP_002939739|   ..................................................................
gi|301623566|gb|XP_002941080|   ..................................................................
gi|301620778|gb|XP_002939748|   ..................................................................
gi|49670651|gb|AAH75423|        ..................................................................
gi|52345790|ref|NP_001004941|   ..................................................................
gi|49522964|gb|AAH75293|        ..................................................................
gi|54020930|ref|NP_001005710|   ..................................................................
gi|59808136|gb|AAH89741|        ..................................................................
gi|62752849|ref|NP_001015792|   ..................................................................
gi|301621490|gb|XP_002940084|   ..................................................................
gi|301628802|gb|XP_002943535|   ..................................................................
gi|111307978|gb|AAI21657|       ..................................................................
gi|118403542|ref|NP_001072819|  ..................................................................
gi|163916428|gb|AAI57199|       ..................................................................
gi|159155191|gb|AAI54713|       ..................................................................
gi|163915041|ref|NP_001106508|  ..................................................................
gi|301626232|gb|XP_002942299|   ..................................................................
gi|169642526|gb|AAI60565|       ..................................................................
gi|187607167|ref|NP_001120289|  ..................................................................
gi|301620740|gb|XP_002939730|   ..................................................................
gi|49522964|gb|AAH75293|        ..................................................................
gi|54020930|ref|NP_001005710|   ..................................................................
gi|56611173|gb|AAH87759|        ..................................................................
gi|58332122|ref|NP_001011209|   ..................................................................
gi|301620750|gb|XP_002939735|   ..................................................................
gi|301620756|gb|XP_002939738|   ..................................................................
gi|301621490|gb|XP_002940084|   ..................................................................
gi|301620768|gb|XP_002939743|   ..................................................................
gi|56541274|gb|AAH87610|        ..................................................................
gi|58332100|ref|NP_001011202|   ..................................................................
gi|58476395|gb|AAH89747|        ..................................................................
gi|62751950|ref|NP_001015797|   ..................................................................
gi|301623009|gb|XP_002940815|   ..................................................................
gi|301609429|gb|XP_002934284|   ..................................................................
gi|301628804|gb|XP_002943536|   ..................................................................
gi|301628800|gb|XP_002943534|   ..................................................................
gi|301623523|gb|XP_002941065|   ..................................................................
gi|301614043|gb|XP_002936502|   ..................................................................
gi|301620764|gb|XP_002939741|   ..................................................................
gi|56611148|gb|AAH87751|        ..................................................................
gi|58332104|ref|NP_001011204|   ..................................................................
gi|89269870|gb|CAJ83405|        ..................................................................
gi|166796549|gb|AAI58898|       ..................................................................
gi|167908783|ref|NP_001016055|  ..................................................................
gi|213627780|gb|AAI71053|       ..................................................................
gi|301623529|gb|XP_002941068|   ..................................................................
gi|56611170|gb|AAH87830|        ..................................................................
gi|58332206|ref|NP_001011251|   ..................................................................
gi|58476361|gb|AAH89695|        ..................................................................
gi|62751546|ref|NP_001015759|   ..................................................................
gi|56270387|gb|AAH87611|        ..................................................................
gi|58332094|ref|NP_001011195|   ..................................................................
gi|301620770|gb|XP_002939744|   ..................................................................
gi|301623525|gb|XP_002941066|   ..................................................................
gi|56541161|gb|AAH87563|        ..................................................................
gi|58332102|ref|NP_001011199|   ..................................................................
gi|56971223|gb|AAH88079|        ..................................................................
gi|58332720|ref|NP_001011435|   ..................................................................
gi|56556311|gb|AAH87753|        ..................................................................
gi|301620774|gb|XP_002939746|   ..................................................................
gi|301621490|gb|XP_002940084|   ..................................................................
gi|301618335|gb|XP_002938574|   ..................................................................
gi|301627387|gb|XP_002942851|   ..................................................................
gi|51895949|gb|AAH80976|        ..................................................................
gi|56118865|ref|NP_001008077|   ..................................................................
gi|301618337|gb|XP_002938575|   ..................................................................
gi|301611781|gb|XP_002935401|   ..................................................................
gi|56971185|gb|AAH88769|        ..................................................................
gi|58743375|ref|NP_001011477|   ..................................................................
gi|301611783|gb|XP_002935402|   ..................................................................
gi|301606691|gb|XP_002932950|   ..................................................................
gi|57870463|gb|AAH89075|        ..................................................................
gi|62751938|ref|NP_001015686|   ..................................................................
gi|301610206|gb|XP_002934644|   ..................................................................
gi|159155760|gb|AAI54947|       ..................................................................
gi|301632763|gb|XP_002945450|   ..................................................................
gi|301623527|gb|XP_002941067|   ..................................................................
gi|56611133|gb|AAH87787|        ..................................................................
gi|58332150|ref|NP_001011223|   ..................................................................
gi|301620772|gb|XP_002939745|   ..................................................................
gi|301614103|gb|XP_002936536|   ..................................................................
gi|60552068|gb|AAH91088|        ..................................................................
gi|301627389|gb|XP_002942852|   ..................................................................
gi|301623007|gb|XP_002940814|   ..................................................................
gi|301612271|gb|XP_002935645|   ..................................................................
gi|301603857|gb|XP_002931605|   ..................................................................
gi|301615211|gb|XP_002937069|   ..................................................................
gi|301615213|gb|XP_002937070|   ..................................................................
gi|301603863|gb|XP_002931607|   ..................................................................
gi|301627010|gb|XP_002942670|   ..................................................................
gi|56972340|gb|AAH88057|        ..................................................................
gi|58332702|ref|NP_001011426|   ..................................................................
gi|39850054|gb|AAH64277|        ..................................................................
gi|301615217|gb|XP_002937076|   ..................................................................
gi|301630725|gb|XP_002944467|   ..................................................................
gi|60552029|gb|AAH91010|        ..................................................................
gi|71896209|ref|NP_001025574|   ..................................................................
gi|301620748|gb|XP_002939734|   ..................................................................
gi|301615956|gb|XP_002937430|   ..................................................................
gi|301622787|gb|XP_002940708|   ..................................................................
gi|56789422|gb|AAH88038|        ..................................................................
gi|56611135|gb|AAH87810|        ..................................................................
gi|301624444|gb|XP_002941509|   ..................................................................
gi|301615068|gb|XP_002937000|   ..................................................................
gi|301618415|gb|XP_002938616|   ..................................................................
gi|301627689|gb|XP_002943002|   ..................................................................
gi|58477045|gb|AAH89660|        nvtginil..........................................................
gi|62751697|ref|NP_001015728|   nvtginil..........................................................
gi|301622330|gb|XP_002940490|   ..................................................................
gi|301620762|gb|XP_002939724|   ..................................................................
gi|301614101|gb|XP_002936535|   ..................................................................
gi|57032953|gb|AAH88892|        ..................................................................
gi|301620357|gb|XP_002939545|   ..................................................................
gi|58477078|gb|AAH89729|        ..................................................................
gi|58476369|gb|AAH89702|        ..................................................................
gi|301624442|gb|XP_002941516|   ..................................................................
gi|56585195|gb|AAH87729|        ..................................................................
gi|56971746|gb|AAH88036|        ..................................................................
gi|58332692|ref|NP_001011421|   ..................................................................
gi|301614099|gb|XP_002936522|   ..................................................................
gi|301627056|gb|XP_002942694|   ..................................................................
gi|301620744|gb|XP_002939732|   ..................................................................
gi|301627687|gb|XP_002943001|   ..................................................................
gi|301620752|gb|XP_002939736|   ..................................................................
gi|301620760|gb|XP_002939740|   ..................................................................
gi|301614101|gb|XP_002936535|   ..................................................................
gi|301612617|gb|XP_002935812|   ..................................................................
gi|57032843|gb|AAH88882|        ..................................................................
gi|58332834|ref|NP_001011493|   ..................................................................
gi|62531104|gb|AAH92553|        ..................................................................
gi|71895833|ref|NP_001025669|   ..................................................................
gi|113931254|ref|NP_001039074|  ..................................................................
gi|89273918|gb|CAJ81839|        ..................................................................
gi|301614097|gb|XP_002936534|   ..................................................................
gi|187469575|gb|AAI67128|       ..................................................................
gi|301608337|gb|XP_002933738|   ..................................................................
gi|62859195|ref|NP_001016980|   ..................................................................
gi|89272057|gb|CAJ83340|        ..................................................................
gi|134023759|gb|AAI35327|       ..................................................................
gi|147901778|ref|NP_001090874|  ..................................................................
gi|301608335|gb|XP_002933737|   ..................................................................
gi|161612048|gb|AAI56020|       ..................................................................
gi|56971188|gb|AAH88782|        ..................................................................
gi|58332812|ref|NP_001011481|   ..................................................................
gi|66990056|gb|AAH98090|        ..................................................................
gi|73853846|ref|NP_001027508|   ..................................................................
gi|54035177|gb|AAH84139|        ..................................................................
gi|58332348|ref|NP_001011037|   ..................................................................
gi|56789096|gb|AAH88027|        ..................................................................
gi|353523845|ref|NP_001238808|  ..................................................................
gi|301610620|gb|XP_002934851|   ..................................................................
gi|301627008|gb|XP_002942673|   ..................................................................
gi|39794386|gb|AAH64208|        ..................................................................
gi|45361487|ref|NP_989320|      ..................................................................
gi|82237461|sp|Q6P326|          ..................................................................
gi|301619167|gb|XP_002938973|   ..................................................................
gi|56789072|gb|AAH88011|        ..................................................................
gi|58332288|ref|NP_001011293|   ..................................................................
gi|113205726|ref|NP_001037931|  ..................................................................
gi|89266985|gb|CAJ81306|        ..................................................................
gi|301619169|gb|XP_002938974|   ..................................................................
gi|301623913|gb|XP_002941253|   ..................................................................
gi|163915777|gb|AAI57637|       ..................................................................
gi|166158186|ref|NP_001107486|  ..................................................................
gi|301626232|gb|XP_002942299|   ..................................................................
gi|66396569|gb|AAH96515|        ..................................................................
gi|301623915|gb|XP_002941259|   ..................................................................
gi|66396598|gb|AAH96508|        ..................................................................
gi|301618553|gb|XP_002938678|   ..................................................................
gi|301619614|gb|XP_002939175|   ..................................................................
gi|301623919|gb|XP_002941255|   ..................................................................
gi|301623917|gb|XP_002941260|   ..................................................................
gi|49899920|gb|AAH76933|        ..................................................................
gi|55742037|ref|NP_001006847|   ..................................................................
gi|163915656|gb|AAI57668|       ..................................................................
gi|165973394|ref|NP_001107158|  ..................................................................
gi|213627368|gb|AAI71196|       ..................................................................
gi|301622373|gb|XP_002940514|   ..................................................................
gi|301623711|gb|XP_002941159|   ..................................................................
gi|301609058|gb|XP_002934098|   ..................................................................
gi|301607053|gb|XP_002933130|   ..................................................................
gi|301620754|gb|XP_002939737|   ..................................................................
gi|301631044|gb|XP_002944619|   ..................................................................
gi|301629851|gb|XP_002944046|   ..................................................................
gi|301629862|gb|XP_002944051|   ..................................................................
gi|301619787|gb|XP_002939269|   ..................................................................
gi|301627058|gb|XP_002942695|   ..................................................................
gi|301629849|gb|XP_002944045|   ..................................................................
gi|301626232|gb|XP_002942299|   ..................................................................
gi|301609784|gb|XP_002934450|   ..................................................................
gi|301631575|gb|XP_002944873|   ..................................................................
gi|301607830|gb|XP_002933508|   ..................................................................
gi|301620748|gb|XP_002939734|   ..................................................................
gi|301623709|gb|XP_002941155|   ..................................................................
gi|301609490|gb|XP_002934300|   ..................................................................
gi|301607063|gb|XP_002933142|   ..................................................................
gi|116487755|gb|AAI25706|       ..................................................................
gi|134023797|gb|AAI35435|       ..................................................................
gi|350276152|ref|NP_001072730|  ..................................................................
gi|301620766|gb|XP_002939742|   ..................................................................
gi|301609058|gb|XP_002934098|   ..................................................................
gi|301606403|gb|XP_002932829|   ..................................................................
gi|163915807|gb|AAI57677|       ..................................................................
gi|166158294|ref|NP_001107513|  ..................................................................
gi|213624433|gb|AAI71092|       ..................................................................
gi|213625671|gb|AAI71088|       ..................................................................
gi|301620338|gb|XP_002939538|   ..................................................................
gi|301622789|gb|XP_002940709|   ..................................................................
gi|301603859|gb|XP_002931606|   ..................................................................
gi|301618560|gb|XP_002938688|   ..................................................................
gi|49522408|gb|AAH75430|        ..................................................................
gi|52345796|ref|NP_001004944|   ..................................................................
gi|82183464|sp|Q6DIV5|          ..................................................................
gi|301614097|gb|XP_002936534|   ..................................................................
gi|301624064|gb|XP_002941330|   ..................................................................
gi|301631613|gb|XP_002944892|   ..................................................................
gi|301631166|gb|XP_002944677|   ..................................................................
gi|301614089|gb|XP_002936531|   ..................................................................
gi|301623570|gb|XP_002941088|   ..................................................................
gi|301618553|gb|XP_002938678|   ..................................................................
gi|169642095|gb|AAI60801|       ..................................................................
gi|288684101|ref|NP_001165762|  ..................................................................
gi|301627723|gb|XP_002943019|   ..................................................................
gi|169642366|gb|AAI60557|       ..................................................................
gi|56789309|gb|AAH88065|        ..................................................................
gi|313851093|ref|NP_001116189|  ..................................................................
gi|301627727|gb|XP_002943021|   ..................................................................
gi|301620760|gb|XP_002939740|   ..................................................................
gi|301614097|gb|XP_002936534|   ..................................................................
gi|301632426|gb|XP_002945286|   ..................................................................
gi|301603859|gb|XP_002931606|   ..................................................................
gi|169641896|gb|AAI60561|       ..................................................................
gi|187607137|ref|NP_001120287|  ..................................................................
gi|301613000|gb|XP_002936003|   ..................................................................
gi|301620752|gb|XP_002939736|   ..................................................................
gi|301612998|gb|XP_002936002|   ..................................................................
gi|160774415|gb|AAI55421|       ..................................................................
gi|163915255|ref|NP_001106591|  ..................................................................
gi|301618176|gb|XP_002938505|   ..................................................................
gi|301610794|gb|XP_002934945|   ..................................................................
gi|301630837|gb|XP_002944523|   ..................................................................
gi|163916178|gb|AAI57579|       ..................................................................
gi|166158059|ref|NP_001107438|  ..................................................................
gi|163915732|gb|AAI57581|       ..................................................................
gi|288684088|ref|NP_001165761|  ..................................................................
gi|163915698|gb|AAI57530|       ..................................................................
gi|166158009|ref|NP_001107414|  ..................................................................
gi|301618333|gb|XP_002938578|   ..................................................................
gi|49900216|gb|AAH76994|        ..................................................................
gi|52346064|ref|NP_001005075|   ..................................................................
gi|301612998|gb|XP_002936002|   lhgtssdskikldaeglqqrpglgliplsdeaglpthqllyqaqllmlvpcpefqmafsrlfskae
gi|301613000|gb|XP_002936003|   lhgtssdskikldaeglqqrpglgliplsdeaglpthqllyqaqllmlvpcpefqmafsrlfskae
gi|301630168|gb|XP_002944198|   ..................................................................
gi|301615558|gb|XP_002937233|   ..................................................................


                                                                    10           20        30       
                                                                     |            |         |       
d1a5ia_                           .....................TCGLRKYKE.....PQ...LHSTGGLFTDITSHPWQAAIFAQ.NR
gi|62201369|gb|AAH93474|        .....................VCGVPIV--.....-S...DRIVGGTNSMKGEWPWQISLSY-.--
gi|71895773|ref|NP_001025685|   .....................VCGVPIV--.....-S...DRIVGGTNSMKGEWPWQISLSY-.--
gi|301620776|gb|XP_002939747|   .....................-CGSPLV--.....-S...SRIVGGTDAREGAWPWQVSLRY-.--
gi|45708911|gb|AAH67937|        .....................--------V.....MS...KRIVGGTDSEEGEWPWQISLEF-.--
gi|47575768|ref|NP_001001228|   .....................--------V.....MS...KRIVGGTDSEEGEWPWQISLEF-.--
gi|301620758|gb|XP_002939739|   .....................-CGTRQV--.....-S...TRIMGGQDSQQGMWPWQVNIRS-.--
gi|301623566|gb|XP_002941080|   .....................---------.....-D...SRIVGGYECAPHSKPWQVHLNY-.--
gi|301620778|gb|XP_002939748|   .....................-CGVPVV--.....-S...DRIVGGMNSKKGEWPWQISLNY-.--
gi|49670651|gb|AAH75423|        .....................---------.....-D...SRIVGGYECAPHSKPWQVHLNY-.--
gi|52345790|ref|NP_001004941|   .....................---------.....-D...SRIVGGYECAPHSKPWQVHLNY-.--
gi|49522964|gb|AAH75293|        .....................-CGSPLV--.....-S...SRIVGGTDAREGAWPWQVSLRY-.--
gi|54020930|ref|NP_001005710|   .....................-CGSPLV--.....-S...SRIVGGTDAREGAWPWQVSLRY-.--
gi|59808136|gb|AAH89741|        .....................---------.....--...DKIVGGFTCTKNAVPYQVSLNA-.--
gi|62752849|ref|NP_001015792|   .....................---------.....--...DKIVGGFTCTKNAVPYQVSLNA-.--
gi|301621490|gb|XP_002940084|   .....................-CGTRPAMQ.....KT...NRIVGGSDATKGEFPWQVSLRE-.--
gi|301628802|gb|XP_002943535|   .....................---------.....--...DKIIGGATCAKNSVPYIVSLNA-.--
gi|111307978|gb|AAI21657|       .....................-CGKIPVLKnvn..KR...ARIVGGDMCPKGECPWQALLMY-.--
gi|118403542|ref|NP_001072819|  .....................-CGKIPVLKnvn..KR...ARIVGGDMCPKGECPWQALLMY-.--
gi|163916428|gb|AAI57199|       .....................-CGKIPVLKnvn..KR...ARIVGGDMCPKGECPWQALLMY-.--
gi|159155191|gb|AAI54713|       .....................-CGEPPLVHt....PG...SRIVGGRNALPGAWPWQVSLQY-.FR
gi|163915041|ref|NP_001106508|  .....................-CGEPPLVHt....PG...SRIVGGRNALPGAWPWQVSLQY-.FR
gi|301626232|gb|XP_002942299|   .....................VCGMAPMSQ.....KSal.PRIIGGEEACPNCWPWQVRILF-.--
gi|169642526|gb|AAI60565|       .....................---------.....-D...VRIVGGMRCELGQCPWQVLIRN-.--
gi|187607167|ref|NP_001120289|  .....................---------.....-D...VRIVGGMRCELGQCPWQVLIRN-.--
gi|301620740|gb|XP_002939730|   .....................-CGIPQW--.....-T...GRIVGGKNSQPGSWPWQVSLWA-.--
gi|49522964|gb|AAH75293|        .....................-CGSPLV--.....-S...SRIVGGTDAREGAWPWQVSLRY-.--
gi|54020930|ref|NP_001005710|   .....................-CGSPLV--.....-S...SRIVGGTDAREGAWPWQVSLRY-.--
gi|56611173|gb|AAH87759|        .....................---------.....--...DKIVGGYHCS---VPYQVSLNA-.--
gi|58332122|ref|NP_001011209|   .....................---------.....--...DKIVGGYHCS---VPYQVSLNA-.--
gi|301620750|gb|XP_002939735|   .....................-CGVPLV--.....-R...SRIMGGQEAPYGKWPWQANLRR-.--
gi|301620756|gb|XP_002939738|   .....................-CGMRQQ--.....-L...TRIMGGQNAQQGAWPWQARIQG-.--
gi|301621490|gb|XP_002940084|   .....................-CGFAPV-L.....PF...NKIVGGSGSVRGEWPWQVSLWL-.--
gi|301620768|gb|XP_002939743|   .....................-CGQPAF--.....-S...DRIVGGNNAVFGEWPWQVSIVY-.--
gi|56541274|gb|AAH87610|        .....................---------.....-D...DKIIGGSTCARNSVPYIVSLNS-.--
gi|58332100|ref|NP_001011202|   .....................---------.....-D...DKIIGGSTCARNSVPYIVSLNS-.--
gi|58476395|gb|AAH89747|        .....................--------Y.....MQ...GRIVKGETAEPGSAPWQVMLFK-.--
gi|62751950|ref|NP_001015797|   .....................--------Y.....MQ...GRIVKGETAEPGSAPWQVMLFK-.--
gi|301623009|gb|XP_002940815|   .....................-CGKPII--.....-P...NRIVGGQDSEPGEFPWQLSLRR-.--
gi|301609429|gb|XP_002934284|   .....................-CGIQAV--.....-G...IRLVGGTQAQEGEWPWQASLQV-.--
gi|301628804|gb|XP_002943536|   .....................---------.....-D...DKIIGGATCAKNSVPYIVSLNA-.--
gi|301628800|gb|XP_002943534|   .....................---------.....-D...DKIIGGATCAKNSVPYIVSLNA-.--
gi|301623523|gb|XP_002941065|   .....................---------.....YY...DRIIGGTECRPNSQPWQCSLYY-.--
gi|301614043|gb|XP_002936502|   .....................------P-S.....VS...NRIVGGTNAGLGSWPWQASLRL-.--
gi|301620764|gb|XP_002939741|   .....................-CGKPVV--.....-S...SRIMGGQSAQEGQWPWQVSFRN-.--
gi|56611148|gb|AAH87751|        .....................-------PL.....DD...DKIVGGYECTPHSQPWQVYFTQ-.--
gi|58332104|ref|NP_001011204|   .....................-------PL.....DD...DKIVGGYECTPHSQPWQVYFTQ-.--
gi|89269870|gb|CAJ83405|        .....................-CGSPLV--.....-S...SRIVGGTDATNGAWPWQISLRY-.--
gi|166796549|gb|AAI58898|       .....................-CGSPLV--.....-S...SRIVGGTDATNGAWPWQISLRY-.--
gi|167908783|ref|NP_001016055|  .....................-CGSPLV--.....-S...SRIVGGTDATNGAWPWQISLRY-.--
gi|213627780|gb|AAI71053|       .....................-CGSPLV--.....-S...SRIVGGTDATNGAWPWQISLRY-.--
gi|301623529|gb|XP_002941068|   .....................---------.....-F...HRIIGGEECVPHSQPWQVALYY-.--
gi|56611170|gb|AAH87830|        .....................-------PL.....DD...DKIVGGYECTPHSQPWQVYFTQ-.--
gi|58332206|ref|NP_001011251|   .....................-------PL.....DD...DKIVGGYECTPHSQPWQVYFTQ-.--
gi|58476361|gb|AAH89695|        .....................-CGKLKIVDyg...YS...ARLTGAKQGRKGDSPWQAMLRY-.--
gi|62751546|ref|NP_001015759|   .....................-CGKLKIVDyg...YS...ARLTGAKQGRKGDSPWQAMLRY-.--
gi|56270387|gb|AAH87611|        .....................-CGIPLV--.....-S...SRIMGGQSAQEGQWPWQVSFRN-.--
gi|58332094|ref|NP_001011195|   .....................-CGIPLV--.....-S...SRIMGGQSAQEGQWPWQVSFRN-.--
gi|301620770|gb|XP_002939744|   .....................-CGSPVV--.....-S...SRIVGGTAAMNGAWPWQASLQY-.--
gi|301623525|gb|XP_002941066|   .....................---------.....--...HWIIGGEECVPHSQPWQVALYY-.--
gi|56541161|gb|AAH87563|        .....................---------.....DD...DKIIGGATCAKNSVPYIVSLNS-.--
gi|58332102|ref|NP_001011199|   .....................---------.....DD...DKIIGGATCAKNSVPYIVSLNS-.--
gi|56971223|gb|AAH88079|        .....................------PLD.....DD...DKIVGGYECTPHSQPWQVLFTF-.--
gi|58332720|ref|NP_001011435|   .....................------PLD.....DD...DKIVGGYECTPHSQPWQVLFTF-.--
gi|56556311|gb|AAH87753|        .....................---------.....-F...HRIIGGEECVPHSQPWQVALYY-.--
gi|301620774|gb|XP_002939746|   .....................-CGSPLV--.....-S...NRIVGGTDATDGAWPWQVSLDY-.--
gi|301621490|gb|XP_002940084|   .....................ECGSRPGLT.....KP...NKIVGGLDAVRGEIPWQASLKE-.--
gi|301618335|gb|XP_002938574|   .....................------PLD.....DD...DKIVGGYECTPHSQPWQVLFTF-.--
gi|301627387|gb|XP_002942851|   .....................-CGVPAVAP.....KV...TRVVGGEDVVPHSWPWQISLQY-.QG
gi|51895949|gb|AAH80976|        .....................-CGVPAVAP.....KV...TRVVGGEDVVPHSWPWQISLQY-.QG
gi|56118865|ref|NP_001008077|   .....................-CGVPAVAP.....KV...TRVVGGEDVVPHSWPWQISLQY-.QG
gi|301618337|gb|XP_002938575|   .....................--------D.....DD...DKIVGGYECTPHSQPWQVLFTY-.--
gi|301611781|gb|XP_002935401|   .....................-CGQPQIAP.....VVtgyARIVNGEEAVPGSWPWQVSLQD-.--
gi|56971185|gb|AAH88769|        .....................-CGVPAIKP.....IIsgyARIVNGENAVSGSWPWQVSLQD-.--
gi|58743375|ref|NP_001011477|   .....................-CGVPAIKP.....IIsgyARIVNGENAVSGSWPWQVSLQD-.--
gi|301611783|gb|XP_002935402|   .....................-CGQPQIAP.....VVtgyARIVNGEEAVPGSWPWQVSLQD-.--
gi|301606691|gb|XP_002932950|   .....................-CGKRMA--.....--...NRIIGGVSAKLGDYPWQVSLHQ-.-R
gi|57870463|gb|AAH89075|        .....................-----PVLS.....GY...ARIVNGENAVPGSWPWQVSLQD-.--
gi|62751938|ref|NP_001015686|   .....................-----PVLS.....GY...ARIVNGENAVPGSWPWQVSLQD-.--
gi|301610206|gb|XP_002934644|   .....................-CGIRPLVK.....NHhrvRRVIEGNTPEPGSWPWMASIQM-.-L
gi|159155760|gb|AAI54947|       .....................---------.....--...HRIIGGEECVPHSQPWQVALYY-.--
gi|301632763|gb|XP_002945450|   .....................---------.....--...HRIIGGEECVPHSQPWQVALYY-.--
gi|301623527|gb|XP_002941067|   .....................---------.....-F...HRIIGGEECVPHSQPWQVALYY-.--
gi|56611133|gb|AAH87787|        .....................--------D.....PN...VRIVGGTDSLKGEFPWQVHLVN-.--
gi|58332150|ref|NP_001011223|   .....................--------D.....PN...VRIVGGTDSLKGEFPWQVHLVN-.--
gi|301620772|gb|XP_002939745|   .....................---------.....LP...NRIVGGSAATEGAWPWQVSLRY-.--
gi|301614103|gb|XP_002936536|   .....................-CGVSNN-S.....VT...SRIVGGTYANLGNWPWQVSLQY-.--
gi|60552068|gb|AAH91088|        .....................-CGVPTYQP.....VV...SRVVNGEDVAPHSWPWQVSLQY-.-L
gi|301627389|gb|XP_002942852|   .....................-CGVPTYQP.....VV...SRVVNGEDVAPHSWPWQVSLQY-.-L
gi|301623007|gb|XP_002940814|   .....................-CGRPTT--.....--...TRIVGGQDTMPGEIPWQLSLRK-.--
gi|301612271|gb|XP_002935645|   .....................-CGKRPLIEnvq..RG...SRIIGGINAQPGAWPWIVSIQY-.-K
gi|301603857|gb|XP_002931605|   .....................-CGNRPLFN.....KG...SRIVGGQNSPPGKWPWMVSIQS-.-P
gi|301615211|gb|XP_002937069|   .....................-CGKRPLIKdsq..RN...SRIVGGVNSQPGAWPWLVSIQAW.RG
gi|301615213|gb|XP_002937070|   .....................-CGKRPLIKdsq..RN...SRIVGGVNSQPGAWPWLVSIQAW.RG
gi|301603863|gb|XP_002931607|   .....................ICGNRPLFN.....KG...SRIVGGQNSPPGKWPWMVSIQS-.-P
gi|301627010|gb|XP_002942670|   .....................-CGVPTY-A.....PS...ARVVNGESAKPYSWPWQVSLQV-.-L
gi|56972340|gb|AAH88057|        .....................-CGVPTY-A.....PS...ARVVNGESAKPYSWPWQVSLQV-.-L
gi|58332702|ref|NP_001011426|   .....................-CGVPTY-A.....PS...ARVVNGESAKPYSWPWQVSLQV-.-L
gi|39850054|gb|AAH64277|        .....................-CGQPQIAP.....VVtgyARIVNGEEAVPGSWPWQVSLQD-.--
gi|301615217|gb|XP_002937076|   .....................-CGKRPLIKdsq..RN...SRIVGGVNSQPGAWPWLVSIQAW.RG
gi|301630725|gb|XP_002944467|   .....................---------.....--...RRVIEGNTPEPGSWPWMASIQM-.-L
gi|60552029|gb|AAH91010|        .....................TCGTRRPQV.....PQ...FKIKGGRGTQITSHPWQAAIFYV.SR
gi|71896209|ref|NP_001025574|   .....................TCGTRRPQV.....PQ...FKIKGGRGTQITSHPWQAAIFYV.SR
gi|301620748|gb|XP_002939734|   .....................VCGQRLV--.....-S...SRIVGGVNSRPGMWPWQVYLRG-.--
gi|301615956|gb|XP_002937430|   .....................--------S.....ET...YRIVGGHEAKPHSRPYMVSLQR-.--
gi|301622787|gb|XP_002940708|   .....................-------FS.....GA...SRIVGGREARAHSRPYIASLQI-.--
gi|56789422|gb|AAH88038|        .....................-------FS.....GA...SRIVGGREARAHSRPYIASLQI-.--
gi|56611135|gb|AAH87810|        .....................-CGVPTY-H.....PN...ARVVNGDDARPYSWPWQVSLQV-.LN
gi|301624444|gb|XP_002941509|   .....................-CGKSNV--.....GT...NRIAGGHEATKGEFPWQVAVWL-.--
gi|301615068|gb|XP_002937000|   .....................---------.....--...PRIVGGLVALPASHPYIAALYI-.--
gi|301618415|gb|XP_002938616|   .....................---------.....--...GRIVGGCEAIPFSWPWQISLRT-.--
gi|301627689|gb|XP_002943002|   .....................-CGLSTY--.....GE...SRIVGGSSASIGDWPWQVNLQY-.--
gi|58477045|gb|AAH89660|        .....................-----NPND.....PN...VRIVGGRECSQGECPWQALLVS-.--
gi|62751697|ref|NP_001015728|   .....................-----NPND.....PN...VRIVGGRECSQGECPWQALLVS-.--
gi|301622330|gb|XP_002940490|   .....................-CGVSFFQQ.....NTa..GRIVSGNEVRPYSWPWQVSLQVR.PR
gi|301620762|gb|XP_002939724|   .....................-CGKPVV--.....VR...KRMVGGKDATKGQNPWQAIVWV-.--
gi|301614101|gb|XP_002936535|   .....................-CGVSHN-S.....VT...SRIVGGTSAASGNWPWQVSLQD-.--
gi|57032953|gb|AAH88892|        .....................-CGKSNV--.....GT...NRIAGGHEATKGEFPWQVAVWL-.--
gi|301620357|gb|XP_002939545|   .....................TCGVRDLLG.....TR...GRIIGGTRTQPGKHPWLASVQLK.VP
gi|58477078|gb|AAH89729|        .....................TCGVRDLLG.....TR...GRIIGGTRTQPGKHPWLASVQLK.VP
gi|58476369|gb|AAH89702|        .....................-CGTPV--K.....ID...NRIVGGQDAMKGKNPWQVIVWI-.--
gi|301624442|gb|XP_002941516|   .....................-CGKPRV--.....FS...KRVVGGHATKNGKWPWQAIVVI-.--
gi|56585195|gb|AAH87729|        .....................-CGVPTY-S.....PH...SRVVNGEDATAHSWPWQVSLQY-.-F
gi|56971746|gb|AAH88036|        .....................-CGVPTY-S.....PH...SRVVNGEDATAHSWPWQVSLQY-.-F
gi|58332692|ref|NP_001011421|   .....................-CGVPTY-S.....PH...SRVVNGEDATAHSWPWQVSLQY-.-F
gi|301614099|gb|XP_002936522|   .....................-CGVSYN-S.....VA...NYKVGGANAAYGNWPWQVGLRY-.--
gi|301627056|gb|XP_002942694|   .....................-CGVPTYPP.....VE...SRVVNGQEAVPHSWPWQVSLQY-.-I
gi|301620744|gb|XP_002939732|   .....................-CGKVPL--.....-F...QRIMGGQNSTPGKWPWQVSIRD-.--
gi|301627687|gb|XP_002943001|   .....................-CGLST--K.....VD...SRIVGGTPALVGDWPWQAQLLK-.--
gi|301620752|gb|XP_002939736|   .....................-CGKPRV--.....FS...KRVVGGHATKNGKWPWQAIVVI-.--
gi|301620760|gb|XP_002939740|   .....................-CGTPV--K.....ID...NRIVGGQDAMKGKNPWQVIVWI-.--
gi|301614101|gb|XP_002936535|   .....................-CGVSYN-N.....VT...GQTVGGTNATLGDWPWQVYVQH-.--
gi|301612617|gb|XP_002935812|   .....................VCGISLVPH.....RK...KRIVGGTKSARGSWPWQASLRL-.KG
gi|57032843|gb|AAH88882|        .....................--------E.....DH...ERVIGGTEVQRNSWPWQVSLQY-.-L
gi|58332834|ref|NP_001011493|   .....................--------E.....DH...ERVIGGTEVQRNSWPWQVSLQY-.-L
gi|62531104|gb|AAH92553|        .....................---------.....DN...GRVVGGINAAKNSWPWQVSLQY-.-L
gi|71895833|ref|NP_001025669|   .....................---------.....DN...GRVVGGINAAKNSWPWQVSLQY-.-L
gi|113931254|ref|NP_001039074|  .....................------TGH.....KQ...ERIIGGSNSDILKYPWQVSLQY-.--
gi|89273918|gb|CAJ81839|        .....................------TGH.....KQ...ERIIGGSNSDILKYPWQVSLQY-.--
gi|301614097|gb|XP_002936534|   .....................-CGVSYN-S.....VA...SHKVGGTKAASGNWPWHVGLRY-.--
gi|187469575|gb|AAI67128|       .....................---------.....-N...SRVVGGTNASPNSWPWQISLQI-.-Q
gi|301608337|gb|XP_002933738|   .....................---------.....-N...SRVVGGTNASPNSWPWQISLQI-.-Q
gi|62859195|ref|NP_001016980|   .....................--------G.....VQ...SRIVGGHDASEGMFPWQASLRY-.--
gi|89272057|gb|CAJ83340|        .....................--------G.....VQ...SRIVGGHDASEGMFPWQASLRY-.--
gi|134023759|gb|AAI35327|       .....................-CGKPTRPL.....PGiv.KRIIGGRNAEPGFFPWQVLIVVEdLS
gi|147901778|ref|NP_001090874|  .....................-CGKPTRPL.....PGiv.KRIIGGRNAEPGFFPWQVLIVVEdLS
gi|301608335|gb|XP_002933737|   .....................------YIE.....DN...QRVIGGSEVARNSWPWQISLQY-.-L
gi|161612048|gb|AAI56020|       .....................---------.....-N...QRVIGGSEVARNSWPWQISLQY-.-L
gi|56971188|gb|AAH88782|        .....................---------.....-A...VRVVGGTNAAKNAWPWQVSLQY-.-L
gi|58332812|ref|NP_001011481|   .....................---------.....-A...VRVVGGTNAAKNAWPWQVSLQY-.-L
gi|66990056|gb|AAH98090|        .....................-CGVPPPAAptkitRK...KRVIGGTNAVKNQFPWQVAIKD-.--
gi|73853846|ref|NP_001027508|   .....................-CGVPPPAAptkitRK...KRVIGGTNAVKNQFPWQVAIKD-.--
gi|54035177|gb|AAH84139|        .....................-CGKRKP-A.....AA...GRIVGGEFANVGEFPWQVFINA-.--
gi|58332348|ref|NP_001011037|   .....................-CGKRKP-A.....AA...GRIVGGEFANVGEFPWQVFINA-.--
gi|56789096|gb|AAH88027|        .....................--------K.....IR...NGIIGGQEAKPHSRPYMAYLKI-.--
gi|353523845|ref|NP_001238808|  .....................--------K.....IR...NGIIGGQEAKPHSRPYMAYLKI-.--
gi|301610620|gb|XP_002934851|   .....................--------K.....IR...NGIIGGQEAKPHSRPYMAYLKI-.--
gi|301627008|gb|XP_002942673|   .....................---------.....--...---------------VPVSLQV-.LN
gi|39794386|gb|AAH64208|        .....................-------CR.....PR...GRILGGQDSKAEVRPYMASIQQ-.--
gi|45361487|ref|NP_989320|      .....................-------CR.....PR...GRILGGQDSKAEVRPYMASIQQ-.--
gi|82237461|sp|Q6P326|          .....................-------CR.....PR...GRILGGQDSKAEVRPYMASIQQ-.--
gi|301619167|gb|XP_002938973|   .....................---------.....--...-----ELNAEKGEWPWVASIQR-.-L
gi|56789072|gb|AAH88011|        .....................---------.....-D...DKIIGEYECAPHSQKWQVYFTY-.--
gi|58332288|ref|NP_001011293|   .....................---------.....-D...DKIIGEYECAPHSQKWQVYFTY-.--
gi|113205726|ref|NP_001037931|  .....................---------.....--...----------EGKWPWIVSIQK-.-K
gi|89266985|gb|CAJ81306|        .....................---------.....--...----------EGKWPWIVSIQK-.-K
gi|301619169|gb|XP_002938974|   .....................---------.....--...-------NVDEGEWPWITSIQQ-.-Q
gi|301623913|gb|XP_002941253|   .....................-CGVHQS-D.....KS...GRIFGGTRAKPGQFPWMIQFFD-.--
gi|163915777|gb|AAI57637|       .....................---------.....-G...DCITGGQEATAHSRPYMASVQW-.--
gi|166158186|ref|NP_001107486|  .....................---------.....-G...DCITGGQEATAHSRPYMASVQW-.--
gi|301626232|gb|XP_002942299|   .....................---------.....--...GRVVGGQQAAPRSWPWLVSIQN-.--
gi|66396569|gb|AAH96515|        .....................-CGKPGDPVg....SF...GRILHGKKADPGNFPWQVYVSR-.--
gi|301623915|gb|XP_002941259|   .....................-CGKPGDPVg....SF...GRILHGKKADPGNFPWQVYVSR-.--
gi|66396598|gb|AAH96508|        .....................-CGVHQS-D.....KS...GRIFGGTRAKPGQFPWMIQFTD-.--
gi|301618553|gb|XP_002938678|   .....................TCGKPTYPPq....IN...TRIVNGEPAAPHTWPWQVSMQVW.PS
gi|301619614|gb|XP_002939175|   .....................---------.....--...-----------------------.--
gi|301623919|gb|XP_002941255|   .....................-CGKPDNSVe....SY...ERILNGKKAAPGNFPWQVFISI-.--
gi|301623917|gb|XP_002941260|   .....................-CGKPDNPV.....ASy..ERILHGKNAAPGNFPWQVYISI-.--
gi|49899920|gb|AAH76933|        .....................---------.....-H...TQIVGGREATPNSHPYIASLQL-.--
gi|55742037|ref|NP_001006847|   .....................---------.....-H...TQIVGGREATPNSHPYIASLQL-.--
gi|163915656|gb|AAI57668|       .....................---------.....--...-----------------------.--
gi|165973394|ref|NP_001107158|  .....................---------.....--...-----------------------.--
gi|213627368|gb|AAI71196|       .....................---------.....--...-----------------------.--
gi|301622373|gb|XP_002940514|   .....................VCGLRPSYT.....SS...ARIVGGNVSAVGQWPWQASLVF-.--
gi|301623711|gb|XP_002941159|   .....................---------.....--...-EIIGGREAVPHSRPYMVALYL-.--
gi|301609058|gb|XP_002934098|   .....................---------.....--...-----------------------.--
gi|301607053|gb|XP_002933130|   .....................---------.....--...-----------------------.--
gi|301620754|gb|XP_002939737|   .....................---------.....--...-----------------------.--
gi|301631044|gb|XP_002944619|   .....................---------.....--...-----------------VSLQY-.-I
gi|301629851|gb|XP_002944046|   .....................---------.....--...-----------------------.--
gi|301629862|gb|XP_002944051|   .....................-------PL.....DD...DKIVGGYECTPHSQPWQVYFTQ-.--
gi|301619787|gb|XP_002939269|   .....................---------.....-R...GRILGGNSALPGSHPWVAGIYI-.--
gi|301627058|gb|XP_002942695|   .....................-CGVPTYPP.....VE...SRVVNGQEVAPHSWPWQVSLQY-.-I
gi|301629849|gb|XP_002944045|   .....................---------.....--...-----------------------.--
gi|301626232|gb|XP_002942299|   .....................---------.....FT...SRIVGGGDAAVGGQPWTVSLQL-.--
gi|301609784|gb|XP_002934450|   .....................---------.....--...-----------------------.--
gi|301631575|gb|XP_002944873|   .....................---------.....TA...GRIVSGNEVRPYSWPWQVSLQVR.PR
gi|301607830|gb|XP_002933508|   .....................-CGRRPAAR.....MS...KRILGGRTSRPGRWPWQCSLQS-.--
gi|301620748|gb|XP_002939734|   .....................---------.....--...-----------------------.--
gi|301623709|gb|XP_002941155|   .....................---------.....--...-----------------------.--
gi|301609490|gb|XP_002934300|   .....................VCGSRLQHR.....RP...KRIIGGKNSVR------------.--
gi|301607063|gb|XP_002933142|   .....................---------.....-Q...LRVVNGIPTQTRKV-WMVSVRY-.--
gi|116487755|gb|AAI25706|       .....................---------.....--...-----------------------.--
gi|134023797|gb|AAI35435|       .....................---------.....--...-----------------------.--
gi|350276152|ref|NP_001072730|  .....................---------.....--...-----------------------.--
gi|301620766|gb|XP_002939742|   .....................-CGKPVV--.....-S...SRIMGGQSAQEGQWPWQVSFRN-.--
gi|301609058|gb|XP_002934098|   .....................---------.....--...-----------------------.--
gi|301606403|gb|XP_002932829|   .....................---------.....--...-----------------------.--
gi|163915807|gb|AAI57677|       .....................---------.....--...-----------------------.--
gi|166158294|ref|NP_001107513|  .....................---------.....--...-----------------------.--
gi|213624433|gb|AAI71092|       .....................---------.....--...-----------------------.--
gi|213625671|gb|AAI71088|       .....................---------.....--...-----------------------.--
gi|301620338|gb|XP_002939538|   .....................---------.....--...-----------------------.--
gi|301622789|gb|XP_002940709|   .....................---------.....--...-----------------------.--
gi|301603859|gb|XP_002931606|   .....................---------.....--...-----------------------.--
gi|301618560|gb|XP_002938688|   .....................---------.....--...-----------------------.--
gi|49522408|gb|AAH75430|        .....................---------.....--...----------EQRWPWQAALYRR.SN
gi|52345796|ref|NP_001004944|   .....................---------.....--...----------EQRWPWQAALYRR.SN
gi|82183464|sp|Q6DIV5|          .....................---------.....--...----------EQRWPWQAALYRR.SN
gi|301614097|gb|XP_002936534|   .....................-CCGVSYNS.....AA...SLIEAGANAASGNWPWQVGLLY-.--
gi|301624064|gb|XP_002941330|   .....................---------.....--...-----------------------.--
gi|301631613|gb|XP_002944892|   .....................---------.....DD...DKIVGGYECTPHSQPWQVLFTF-.--
gi|301631166|gb|XP_002944677|   .....................---------.....--...-----------------------.--
gi|301614089|gb|XP_002936531|   .....................-CGKRNDRS.....SQr..TRIVGGM---PGNSPWTVSLRN-.--
gi|301623570|gb|XP_002941088|   .....................---------.....DD...DKIVGGYECTPHSQPWQVFFTF-.--
gi|301618553|gb|XP_002938678|   .....................---------.....--...----------LHSSQWHFSVQSR.AR
gi|169642095|gb|AAI60801|       .....................---------.....--...-----------------------.--
gi|288684101|ref|NP_001165762|  .....................---------.....--...-----------------------.--
gi|301627723|gb|XP_002943019|   .....................---------.....--...-------------FPWNVLVKSR.--
gi|169642366|gb|AAI60557|       .....................---------.....--...--------LQADIFPWQVPVLN-.--
gi|56789309|gb|AAH88065|        .....................---------.....--...--------LQADIFPWQVPVLN-.--
gi|313851093|ref|NP_001116189|  .....................---------.....--...--------LQADIFPWQVPVLN-.--
gi|301627727|gb|XP_002943021|   .....................---------.....--...-------------FPWIAKITI-.--
gi|301620760|gb|XP_002939740|   .....................---------.....--...-----------------------.--
gi|301614097|gb|XP_002936534|   .....................-CGVSYN-S.....AA...SLIEAGANAASGNWPWQVGLLY-.--
gi|301632426|gb|XP_002945286|   .....................---------.....--...-----------------------.--
gi|301603859|gb|XP_002931606|   .....................---------.....--...-WIVGGQNSQPGKWPWMVSIQS-.-P
gi|169641896|gb|AAI60561|       .....................-CGRRKL--.....AV...DRIVGGQDATLGRWPWQVSLRY-.--
gi|187607137|ref|NP_001120287|  .....................-CGRRKL--.....AV...DRIVGGQDATLGRWPWQVSLRY-.--
gi|301613000|gb|XP_002936003|   .....................---------.....--...-----------------------.--
gi|301620752|gb|XP_002939736|   .....................---------.....--...-----------------------.--
gi|301612998|gb|XP_002936002|   .....................---------.....--...-----------------------.--
gi|160774415|gb|AAI55421|       .....................---------.....--...-------------YPFS------.--
gi|163915255|ref|NP_001106591|  .....................---------.....--...-------------YPFS------.--
gi|301618176|gb|XP_002938505|   .....................---------.....--...----------MTNYPFSTAVKL-.--
gi|301610794|gb|XP_002934945|   .....................---------.....--...-----------QDFPFAAAVYV-.--
gi|301630837|gb|XP_002944523|   .....................---------.....--...-----------------------.--
gi|163916178|gb|AAI57579|       .....................---------.....--...-----------------------.--
gi|166158059|ref|NP_001107438|  .....................---------.....--...-----------------------.--
gi|163915732|gb|AAI57581|       .....................---------.....--...-----------------------.--
gi|288684088|ref|NP_001165761|  .....................---------.....--...-----------------------.--
gi|163915698|gb|AAI57530|       .....................---------.....--...-----------------------.--
gi|166158009|ref|NP_001107414|  .....................---------.....--...-----------------------.--
gi|301618333|gb|XP_002938578|   .....................--------D.....DD...DKIVGGYECTPHSQPWQVFFTF-.--
gi|49900216|gb|AAH76994|        .....................---------.....--...-----------------------.--
gi|52346064|ref|NP_001005075|   .....................---------.....--...-----------------------.--
gi|301612998|gb|XP_002936002|   gwefsseeekheygelqkdls---------.....--...-----------------------.--
gi|301613000|gb|XP_002936003|   gwefsseeekheygelqkdls---------.....--...-----------------------.--
gi|301630168|gb|XP_002944198|   .....................---------.....--...-----------------------.--
gi|301615558|gb|XP_002937233|   .....................---------.....--...-----------------------.--


                                             40        50         60                     70        8
                                              |         |          |                      |         
d1a5ia_                           R.......SS..GERFLCGGILISSC.WVLTAAHCFQESY.............LPDQLKVVLGRTY
gi|62201369|gb|AAH93474|        -.......--..KGQTVCGGSLITDS.WVLTAAHCFDSQ-.............KVSQYIVYLGVYQ
gi|71895773|ref|NP_001025685|   -.......--..KGQTVCGGSLITDS.WVLTAAHCFDSQ-.............KVSQYIVYLGVYQ
gi|301620776|gb|XP_002939747|   -.......--..RGSHICGGSVIGTQ.WILTAAHCFGNSQ.............SPSDYEVRLGAYR
gi|45708911|gb|AAH67937|        -.......--..EGGFLCGGSLLTDS.WVLTAAHCFDSM-.............NVSKYTAYLGVYQ
gi|47575768|ref|NP_001001228|   -.......--..EGGFLCGGSLLTDS.WVLTAAHCFDSM-.............NVSKYTAYLGVYQ
gi|301620758|gb|XP_002939739|   -.......--..NDFSFCGGSLITSK.WVISASHCFNRTN.............PPSFYTVYLGSYQ
gi|301623566|gb|XP_002941080|   -.......--..KGSFFCGGSLIAPR.WIVSAAHCYLLP-.............--KYVVAHIGMHD
gi|301620778|gb|XP_002939748|   -.......--..KNEFICGGSLITDS.WVMAAAHCFDSL-.............KVSYYTVYLGAYQ
gi|49670651|gb|AAH75423|        -.......--..KGSFFCGGSLIAPR.WIVSAAHCYLLP-.............--KYVVAHIGMHD
gi|52345790|ref|NP_001004941|   -.......--..KGSFFCGGSLIAPR.WIVSAAHCYLLP-.............--KYVVAHIGMHD
gi|49522964|gb|AAH75293|        -.......--..RGSHICGGSVIGTQ.WILTAAHCFGNSQ.............SPSDYEVRLGAYR
gi|54020930|ref|NP_001005710|   -.......--..RGSHICGGSVIGTQ.WILTAAHCFGNSQ.............SPSDYEVRLGAYR
gi|59808136|gb|AAH89741|        -.......--..-GYHFCGGSLINSQ.WVVSAAHC-----.............YKSRIQVRLGEHN
gi|62752849|ref|NP_001015792|   -.......--..-GYHFCGGSLINSQ.WVVSAAHC-----.............YKSRIQVRLGEHN
gi|301621490|gb|XP_002940084|   -.......--..NNEHFCGATVIGDK.WLVSAAHCFNDFQ.............DPAVWVAYIATTS
gi|301628802|gb|XP_002943535|   -.......--..-GYHFCGGSLINNQ.WVVSAAHC-----.............YQASIQVRLGEHN
gi|111307978|gb|AAI21657|       -.......--..NEIFICGGTLIAPN.WVITAAHCLKPL-.............PENKLTVVLGEHR
gi|118403542|ref|NP_001072819|  -.......--..NEIFICGGTLIAPN.WVITAAHCLKPL-.............PENKLTVVLGEHR
gi|163916428|gb|AAI57199|       -.......--..NEIFICGGTLIAPN.WVITAAHCLKPL-.............PENKLTVVLGEHR
gi|159155191|gb|AAI54713|       T.......LS..GYSHRCGGSLIQNN.WVLSAAHCFRANR.............NPEYWRAVLGLHN
gi|163915041|ref|NP_001106508|  T.......LS..GYSHRCGGSLIQNN.WVLSAAHCFRANR.............NPEYWRAVLGLHN
gi|301626232|gb|XP_002942299|   -.......--..LKAFHCGGAIISPQ.WVLTAAHCIRAS-.............EPSYWVIVAGDHD
gi|169642526|gb|AAI60565|       -.......-N..RGFGFCGGSLISSR.WVLSAAHCFESQ-.............--IPHHVTIGDYD
gi|187607167|ref|NP_001120289|  -.......-N..RGFGFCGGSLISSR.WVLSAAHCFESQ-.............--IPHHVTIGDYD
gi|301620740|gb|XP_002939730|   -.......--..RGQHICGGTLINNK.WVVTAAHCFIENSl............TAESITVYLGSYK
gi|49522964|gb|AAH75293|        -.......--..RGSHICGGSVIGTQ.WILTAAHCFENSQ.............FPSDYEVRLGTYR
gi|54020930|ref|NP_001005710|   -.......--..RGSHICGGSVIGTQ.WILTAAHCFENSQ.............FPSDYEVRLGTYR
gi|56611173|gb|AAH87759|        -.......--..-GYHFCGGSLINEH.WVVSAAHC-----.............YQSKMELRIGENN
gi|58332122|ref|NP_001011209|   -.......--..-GYHFCGGSLINEH.WVVSAAHC-----.............YQSKMELRIGENN
gi|301620750|gb|XP_002939735|   -.......-P..GYYPYCGGTLIGEK.WILTAAACIHSN-.............TKSSFQVFVGDYN
gi|301620756|gb|XP_002939738|   -.......--..NDGGLCGGSLVTTK.WVISAAHCFNSSN.............PPSFYTVYLGSYQ
gi|301621490|gb|XP_002940084|   -.......-R..RKEHKCGAVLISDR.WLLSAAHCFDIYS.............DPKLWAAYLGTPF
gi|301620768|gb|XP_002939743|   -.......--..QNSHICGGSLVSSN.WVVSAAHCFPRSY.............KIENMQVLLGCFA
gi|56541274|gb|AAH87610|        -.......--..-GYHFCGGSLISNQ.WVVSAAHC-----.............YKASVQVRLGEHN
gi|58332100|ref|NP_001011202|   -.......--..-GYHFCGGSLISNQ.WVVSAAHC-----.............YKASVQVRLGEHN
gi|58476395|gb|AAH89747|        -.......KS..PQELLCGASLLSDR.WVLSAAHCIFYPPwdkny........TTDDILVRIGKHF
gi|62751950|ref|NP_001015797|   -.......KS..PQELLCGASLLSDR.WVLSAAHCIFYPPwdkny........TTDDILVRIGKHF
gi|301623009|gb|XP_002940815|   -.......--..NGLHICGGSLIDSQ.WAVSAAHCFAQPF.............SASEFQVNLGAYQ
gi|301609429|gb|XP_002934284|   -.......--..RGEHICGGTLVADQ.WILTAAHCFTPESya...........SPEVWTVYLGKVR
gi|301628804|gb|XP_002943536|   -.......--..-GYHFCGGSLLNNQ.WVVSAAHC-----.............YQASIQVRLGEHN
gi|301628800|gb|XP_002943534|   -.......--..-GYHFCGGSLINNQ.WVVSAAHC-----.............YQASVQVRLGEHN
gi|301623523|gb|XP_002941065|   -.......--..FDQHVCGGVLIDEN.WVLTAAHC-----.............QLSSLQVRLGEHN
gi|301614043|gb|XP_002936502|   -.......--..LGSHTCGASLLNDT.WLVAAAHCFDMNA.............DANSWTVVLGTIN
gi|301620764|gb|XP_002939741|   -.......--..NGRHFCGGTLISNQ.WVISAAHCFPSSS.............SASSITAVLGAYM
gi|56611148|gb|AAH87751|        -.......--..ENQVFCGGSLVTPR.WIISAAHCYRTP-.............--KTLVAHLGDHD
gi|58332104|ref|NP_001011204|   -.......--..ENQVFCGGSLVTPR.WIISAAHCYRTP-.............--KTLVAHLGDHD
gi|89269870|gb|CAJ83405|        -.......--..KGSHICGGSVISNQ.WIMTAAHCFEYSR.............TPSDYQVLLGAYQ
gi|166796549|gb|AAI58898|       -.......--..KGSHICGGSVISNQ.WIMTAAHCFEYSR.............TPSDYQVLLGAYQ
gi|167908783|ref|NP_001016055|  -.......--..KGSHICGGSVISNQ.WIMTAAHCFEYSR.............TPSDYQVLLGAYQ
gi|213627780|gb|AAI71053|       -.......--..KGSHICGGSVISNQ.WIMTAAHCFEYSR.............TPSDYQVLLGAYQ
gi|301623529|gb|XP_002941068|   -.......--..FSDFICGGALINEW.WVLTAAHC-----.............DHPHLQVALGAHN
gi|56611170|gb|AAH87830|        -.......--..NSQVFCGGSLVTPR.WIISAAHCYRPP-.............--KTLVAHLGDHD
gi|58332206|ref|NP_001011251|   -.......--..NSQVFCGGSLVTPR.WIISAAHCYRPP-.............--KTLVAHLGDHD
gi|58476361|gb|AAH89695|        -.......--..EKKLKCGGVLIHPF.WVLTAAHCVTHA-.............--GKYTVRLGEYD
gi|62751546|ref|NP_001015759|   -.......--..EKKLKCGGVLIHPF.WVLTAAHCVTHA-.............--GKYTVRLGEYD
gi|56270387|gb|AAH87611|        -.......--..NGGHFCGGTLISKQ.YVISAAHCFPSSS.............SASSVTAVLGAYM
gi|58332094|ref|NP_001011195|   -.......--..NGGHFCGGTLISKQ.YVISAAHCFPSSS.............SASSVTAVLGAYM
gi|301620770|gb|XP_002939744|   -.......--..QYSHICGGSVISNK.WIMTAAHCFDNSL.............TTSLYRVRLGAYQ
gi|301623525|gb|XP_002941066|   -.......--..FSDFICGGALINQW.WVLTAAHCIQ---.............--SNLQVLLGAHN
gi|56541161|gb|AAH87563|        -.......--..-GYHFCGGSLINNQ.WVVSAAHC-----.............YKASIQVRLGEHN
gi|58332102|ref|NP_001011199|   -.......--..-GYHFCGGSLINNQ.WVVSAAHC-----.............YKASIQVRLGEHN
gi|56971223|gb|AAH88079|        -.......--..NGRNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVALLGEHD
gi|58332720|ref|NP_001011435|   -.......--..NGRNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVALLGEHD
gi|56556311|gb|AAH87753|        -.......--..FSDFICGGVLINEW.WVLTAAHC-----.............NQSNLQVLLGAHN
gi|301620774|gb|XP_002939746|   -.......--..HGSHICGGSLIATQ.WIMTAAHCFEYSK.............SPSDYKIRLGAYQ
gi|301621490|gb|XP_002940084|   -.......--..GSRHFCGATIIGDR.WLVSAAHCFNQT-.............KVDQVTAHMGSTA
gi|301618335|gb|XP_002938574|   -.......--..NGRNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVALLGEHD
gi|301627387|gb|XP_002942851|   T.......SG..AWGHTCGGTLISEQ.WVLTAAHCISSG-.............--RVYRVFLGKHS
gi|51895949|gb|AAH80976|        T.......SG..AWGHTCGGTLISEQ.WVLTAAHCISSG-.............--RVYRVFLGKHS
gi|56118865|ref|NP_001008077|   T.......SG..AWGHTCGGTLISEQ.WVLTAAHCISSG-.............--RVYRVFLGKHS
gi|301618337|gb|XP_002938575|   -.......--..NGGNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVALLGEHD
gi|301611781|gb|XP_002935401|   -.......-S..TSWHFCGGSLINNE.WVVTAAHCGVST-.............---RDKVVLGEHD
gi|56971185|gb|AAH88769|        -.......-R..TGFHFCGGSLVNNL.WVVTAAHCGVTT-.............---SHRVILGEYD
gi|58743375|ref|NP_001011477|   -.......-R..TGFHFCGGSLVNNL.WVVTAAHCGVTT-.............---SHRVILGEYD
gi|301611783|gb|XP_002935402|   -.......-S..TSWHFCGGSLINNE.WVVTAAHCGVST-.............---RDKVVLGEHD
gi|301606691|gb|XP_002932950|   A.......GN..RFAHVCGGTIINNK.WVATATHCFQETV.............DPANWRVYAGIIN
gi|57870463|gb|AAH89075|        -.......-S..TGFHFCGGSVISDF.WVVTAAHCGVTT-.............---AHRVILGEYD
gi|62751938|ref|NP_001015686|   -.......-S..TGFHFCGGSVISDF.WVVTAAHCGVTT-.............---AHRVILGEYD
gi|301610206|gb|XP_002934644|   Y.......KD..GYGSACGGVLLSNR.WVVTAAHCLSDYSir...........YRHLARIVLGARD
gi|159155760|gb|AAI54947|       -.......--..FSDFICGGVLINEW.WVLTAAHCIQS--.............---HLQVALGAHN
gi|301632763|gb|XP_002945450|   -.......--..FSDFICGGVLINEW.WVLTAAHCIQS--.............---HLQVALGAHN
gi|301623527|gb|XP_002941067|   -.......--..FSDFICGGVLINKW.WVLTAAHC-----.............NQSNLQVLLGAHN
gi|56611133|gb|AAH87787|        -.......-K..DNLGFCSGSIINEK.WIVTAAHCFLIR-.............--GEFKVVAGEHN
gi|58332150|ref|NP_001011223|   -.......-K..DNLGFCSGSIINEK.WIVTAAHCFLIR-.............--GEFKVVAGEHN
gi|301620772|gb|XP_002939745|   -.......--..KGIHICGGSVIGTH.WILTAAHCFLISQ.............SPSDFEVRLGAYQ
gi|301614103|gb|XP_002936536|   -.......--..MARVLCGGSIISPR.WIVTAAHCVYGSYs............SAPGWKVFAGTLT
gi|60552068|gb|AAH91088|        Y.......YG..YWYHTCGGSLISSN.WVLTAAHCISSY-.............--NTYRVQLGKHN
gi|301627389|gb|XP_002942852|   Y.......YG..YWYHTCGGSLISSN.WVLTAAHCISSY-.............--NTYRVQLGKHN
gi|301623007|gb|XP_002940814|   -.......--..LGLHICGGSLINNQ.WAISAAHCFAGPI.............RVSDYKVNLGAYQ
gi|301612271|gb|XP_002935645|   K.......ES..NYAHFCGGTILNSQ.WVVTAAHCFSHFNk............KLHGLRMVFGAHK
gi|301603857|gb|XP_002931605|   T.......GK..EFSHLCGGSVLNEI.WVLTAAHCFKHLQrke..........ETKSWRLVFGANN
gi|301615211|gb|XP_002937069|   S.......DY..GYGHFCGGTILNNQ.WILTAAHCLIDYKt............TFDTIRVVIGARK
gi|301615213|gb|XP_002937070|   S.......DY..GYGHFCGGTILNNQ.WILTAAHCLIDYKt............TFDTIRVVIGARK
gi|301603863|gb|XP_002931607|   T.......GK..EFSHLCGGSVLNEI.WVLTAAHCFKHLErke..........ETKSWRLVFGANN
gi|301627010|gb|XP_002942670|   K.......DG..VFLHNCGGTLIADR.WILTAAHCINFS-.............--RTNRVVVGEFD
gi|56972340|gb|AAH88057|        I.......NG..VFIHNCGGTLIADR.WILTAAHCINFS-.............--RTNRAVVGDYD
gi|58332702|ref|NP_001011426|   I.......NG..VFIHNCGGTLIADR.WILTAAHCINFS-.............--RTNRAVVGDYD
gi|39850054|gb|AAH64277|        -.......-S..TSWHFCGGSLINNE.WVVTAAHCGVST-.............---RDKVVLGEHD
gi|301615217|gb|XP_002937076|   S.......DY..GYGHFCGGTILNNQ.WILTAAHCLIDYKt............TFDTIRVVIGARK
gi|301630725|gb|XP_002944467|   Y.......KD..GYGSACGGVLLSNR.WVVTAAHCLSDYSir...........YRHLARIVLGARD
gi|60552029|gb|AAH91010|        R.......FA..GEHFLCGGTLIHSC.WVLSAAHCFNEIS.............NAEQLRVILGRTM
gi|71896209|ref|NP_001025574|   R.......FA..GEHFLCGGTLIHSC.WVLSAAHCFNEIS.............NAEQLRVILGRTM
gi|301620748|gb|XP_002939734|   -.......--..-PNFFCGGSLITSK.WIISAAHCCHSTL.............TPSNYTVYAGAYN
gi|301615956|gb|XP_002937430|   -.......-Q..DKSHFCGGTLIHPK.WVLTAAHCQEGW-.............SMDLTRVVLGAHW
gi|301622787|gb|XP_002940708|   -.......--..RGFHFCGGALINEK.WVLTAAHCMEDT-.............PVDSVRVVLGAHN
gi|56789422|gb|AAH88038|        -.......--..RGFHFCGGALINEK.WVLTAAHCMEDT-.............PVDSVRVVLGAHN
gi|56611135|gb|AAH87810|        S.......GS..RYGHYCGGSLIAPR.WVVTAAHCIHYT-.............--NTYRIVLGEHD
gi|301624444|gb|XP_002941509|   -.......--..PGKMFCGGTLLSNT.WVLTSAQCLDGH-.............NASSVVVILGSIK
gi|301615068|gb|XP_002937000|   -.......--..-DNHFCGGSLISPC.WIVTAAHCLDQRP.............NVTKISVVLGQSR
gi|301618415|gb|XP_002938616|   -.......-S..FNLHFCGGTLIDRQ.WVITAAHCLERSN.............RPSAYRVHFGIHK
gi|301627689|gb|XP_002943002|   -.......--..DDTNLCGGSVIAAN.WIVTAAHCVQGDTs............SPSLWKAFIGKIK
gi|58477045|gb|AAH89660|        -.......-D..EDEGFCGGTILSRE.FILTAAHCMNQT-.............--KYFKVVVGELN
gi|62751697|ref|NP_001015728|   -.......-D..EDEGFCGGTILSRE.FILTAAHCMNQT-.............--KYFKVVVGELN
gi|301622330|gb|XP_002940490|   G.......GK..KYVHVCGGTLIHKS.WILTAAHCFQKGKae...........DAANWRIVVGKHN
gi|301620762|gb|XP_002939724|   -.......--..PGKYYCGGSLISSN.LVLTAAHCFEVL-.............DASSVVVILGAYK
gi|301614101|gb|XP_002936535|   -.......--..ETGFMCGGSIISPK.WIVTAAHCVYGLY.............QSSAWRVFAGVLS
gi|57032953|gb|AAH88892|        -.......--..PGKMFCGGTLLSNT.WVLTSAQCLDGH-.............NASSVVVILGSIK
gi|301620357|gb|XP_002939545|   V.......PPf.PVGHICGGTLIAEC.WVLTAAHCVNTVL.............QVHKWKVLLGRTD
gi|58477078|gb|AAH89729|        V.......PPf.PVGHICGGTLIAEC.WVLTAAHCVNTVL.............QVHKWKVLLGRTD
gi|58476369|gb|AAH89702|        -.......--..PGSGYCGGALISSN.LVVTVAHCIDGF-.............NASSVVVILGAYK
gi|301624442|gb|XP_002941516|   -.......--..PNQFISGATLVSNK.WVVSAAHWLESE-.............EPGNVDVILGAFN
gi|56585195|gb|AAH87729|        N.......GQ..VFAHTCGGSLIAPN.WVMTAAHCISSS-.............--RQYQVVLGEHD
gi|56971746|gb|AAH88036|        N.......GQ..VFAHTCGGSLIAPN.WVMTAAHCISSS-.............--RQYQVVLGEHD
gi|58332692|ref|NP_001011421|   N.......GQ..VFAHTCGGSLIAPN.WVMTAAHCISSS-.............--RQYQVVLGEHD
gi|301614099|gb|XP_002936522|   -.......--..KTGLLCGGSIISPK.WIVTAAHCVYGSRs............NASGWKVFAGALT
gi|301627056|gb|XP_002942694|   Y.......YG..YWYHTCGGTLIARN.WVLTAAHCISSD-.............--NIYRVQLGKHN
gi|301620744|gb|XP_002939732|   -.......-A..KGTHFCGGTLIDNK.TVISAAHCFSYTNm............VQLPVTACLGSFS
gi|301627687|gb|XP_002943001|   L.......VG..TSTYLCGGSIITPY.WIVTAAHCVYGSTs............TPSIFKVFAGTLS
gi|301620752|gb|XP_002939736|   -.......--..PNQFISGATLISNK.WVVSAAHWLESE-.............EPANVDVILGAFN
gi|301620760|gb|XP_002939740|   -.......--..PGSGYCGGALISSN.LVVTVAHCIDGF-.............NASSVVVILGAYK
gi|301614101|gb|XP_002936535|   -.......--..ITGILCGGSIISPK.WIVTAAHCVYGYS.............SAPGWKVFAGTLT
gi|301612617|gb|XP_002935812|   F.......HK..ETRLLCGATLINNC.WALTAAHCFKRFGk............QVHRYSLRVGDYH
gi|57032843|gb|AAH88882|        S.......GG..SWYHTCGGSLIRAN.RVLTAAHCVDRA-.............--VSYRVVVGDHN
gi|58332834|ref|NP_001011493|   S.......GG..SWYHTCGGSLIRAN.RVLTAAHCVDRA-.............--VSYRVVVGDHN
gi|62531104|gb|AAH92553|        S.......SG..YWYHTCGASLIRAN.RVLTAAHCVDRS-.............--VSFRVVLGDHN
gi|71895833|ref|NP_001025669|   S.......SG..YWYHTCGASLIRAN.RVLTAAHCVDRS-.............--VSFRVVLGDHN
gi|113931254|ref|NP_001039074|  -.......--..MGQHICGGSILNSR.WILCAAHCFDRGQr............QVDRWRVQYGITT
gi|89273918|gb|CAJ81839|        -.......--..MGQHICGGSILNSR.WILCAAHCFDRGQr............QVDRWRVQYGITT
gi|301614097|gb|XP_002936534|   -.......--..KTGLLCGGSIISPK.WIVTAAHCVYGSYs............NASGWKVFAGALT
gi|187469575|gb|AAI67128|       S.......GS..GFSHTCGGSLIRTD.RVLTAAHCVDRA-.............--GPFRVILGEHN
gi|301608337|gb|XP_002933738|   S.......GS..GFSHTCGGSLIRTD.RVLTAAHCVDRA-.............--GPFRVILGEHN
gi|62859195|ref|NP_001016980|   -.......--..DGNHVCGAALISAN.FIVTAAHCFPSDH.............SLVGYSVYLGVLQ
gi|89272057|gb|CAJ83340|        -.......--..DGNHVCGAALISAN.FIVTAAHCFPSDH.............SLVGYSVYLGVLQ
gi|134023759|gb|AAI35327|       R.......VP..MNKWFGGGALISDS.WILTAAHNLRSQRrdntvmpv.....SKEHVTVYLGLHD
gi|147901778|ref|NP_001090874|  R.......VP..MNKWFGGGALISDS.WILTAAHNLRSQRrdntvmpv.....SKEHVTVYLGLHD
gi|301608335|gb|XP_002933737|   S.......GG..SWYHTCGGSLIRAN.RVLTAAHCVDTV-.............--TSYRVVVGDHN
gi|161612048|gb|AAI56020|       S.......GG..SWYHTCGGSLIRAN.RVLTAAHCVDTV-.............--TSYRVVVGDHN
gi|56971188|gb|AAH88782|        S.......GS..AWYHTCGASLIRAN.RVLTAAHCVDRV-.............--VSFRVVLGDHN
gi|58332812|ref|NP_001011481|   S.......GS..AWYHTCGASLIRAN.RVLTAAHCVDRV-.............--VSFRVVLGDHN
gi|66990056|gb|AAH98090|        -.......--..GTSVNCGGIYIGGC.WVLTAAHCVRAN-.............QPQRYLIILELLD
gi|73853846|ref|NP_001027508|   -.......--..GTSVNCGGIYIGGC.WVLTAAHCVRAN-.............QPQRYLIILELLD
gi|54035177|gb|AAH84139|        -.......--..-NNERGGGALLLDN.WILTAAHVVYSYD.............DLSSILIKMGFL-
gi|58332348|ref|NP_001011037|   -.......--..-NNERGGGALLLDN.WILTAAHVVYSYD.............DLSSILIKMGFL-
gi|56789096|gb|AAH88027|        -.......--..-GMGFCGGSLIAPD.WVISAAHC-----.............-AGDITVILGAHN
gi|353523845|ref|NP_001238808|  -.......--..-GMGFCGGSLIAPD.WVISAAHC-----.............-AGDITVILGAHN
gi|301610620|gb|XP_002934851|   -.......--..-GMGFCGGSLIAPD.WVISAAHC-----.............-AGDITVILGAHN
gi|301627008|gb|XP_002942673|   S.......GS..RYGHYCGGSLIAPR.WVVTAAHCIHYT-.............--NTYRIVLGEHD
gi|39794386|gb|AAH64208|        -.......--..NGIHQCGGVLIADK.WVLSAAHCATNS-.............SNSSLNVMLGAIS
gi|45361487|ref|NP_989320|      -.......--..NGIHQCGGVLIADK.WVLSAAHCATNS-.............SNSSLNVMLGAIS
gi|82237461|sp|Q6P326|          -.......--..NGIHQCGGVLIADK.WVLSAAHCATNS-.............SNSSLNVMLGAIS
gi|301619167|gb|XP_002938973|   D.......MN..TYEHICTGTVLNNQ.WIFTAAHCFRHLNgen..........DIKSLQVVLGAHL
gi|56789072|gb|AAH88011|        -.......--..KGYPWCGGSLISSR.WIISAASCNQSP-.............--KYLIAHLGKHD
gi|58332288|ref|NP_001011293|   -.......--..KGYPWCGGSLISSR.WIISAASCNQSP-.............--KYLIAHLGKHD
gi|113205726|ref|NP_001037931|  V.......EL..GYKHICAGTILNNE.WIITAAHCFKDWKegd..........PTTPLRVLLGTFY
gi|89266985|gb|CAJ81306|        V.......EL..GYKHICAGTILNNE.WIITAAHCFKDWKegd..........PTTPLRVLLGTFY
gi|301619169|gb|XP_002938974|   E.......NN..TYRHICAGTILNSR.WVMTAAHCFKTLNgen..........ATRSLQLVFGARH
gi|301623913|gb|XP_002941253|   -.......--..--IELGGGSLISDR.WVLTAAHVVNKKN.............FPMVFGGVMKFFL
gi|163915777|gb|AAI57637|       -.......--..NGKHECGGFLISSQ.WVMSAAHCFQDG-.............RTSGVKVVLGAHS
gi|166158186|ref|NP_001107486|  -.......--..NGKHECGGFLISSQ.WVMSAAHCFQDG-.............RTSGVKVVLGAHS
gi|301626232|gb|XP_002942299|   -.......-N..KKKHYCGGIIIANK.WILTAAHCEVKV-.............--GSHRVVVGHTD
gi|66396569|gb|AAH96515|        -.......--..--YGTAGGALIGEQ.WVLTAAQVLPDDKekq..........DLADVHVYMGSVE
gi|301623915|gb|XP_002941259|   -.......--..--YGTAGGALIGEQ.WVLTAAQVLPDDKekq..........DLADVHVYMGSVE
gi|66396598|gb|AAH96508|        -.......--..--IELGGGSLISDR.WVLTAAHVVNKKI.............FPTMFGGVMKFFP
gi|301618553|gb|XP_002938678|   S.......RNetIFFHTCGGTLIHKN.WILTAAHCFINYAd............ELYRWQMCLGKHN
gi|301619614|gb|XP_002939175|   -.......--..----MCGGSIISSQ.WVMSAAHCFVLNGfl...........TVSRWKIHAGSIS
gi|301623919|gb|XP_002941255|   -.......--..--NGRAGGALIGER.WVLTAAHVLLPDTedneek.......NLTKVHVFMGSLE
gi|301623917|gb|XP_002941260|   -.......--..--NGRAGGALIGER.WVLTAAQVLHNDNedt..........NPTYVHVFMGSVQ
gi|49899920|gb|AAH76933|        -.......--..RGRHFCGGSLIAPQ.FLMTAAHCMENT-.............ASNLVTVVLGAHS
gi|55742037|ref|NP_001006847|   -.......--..RGRHFCGGSLIAPQ.FLMTAAHCMENT-.............ASNLVTVVLGAHS
gi|163915656|gb|AAI57668|       -.......--..SRTGSCGGTLIKQN.WVLTAAHCVV---.............--NNSEVILGAHN
gi|165973394|ref|NP_001107158|  -.......--..SRTGSCGGTLIKQN.WVLTAAHCVV---.............--NNSEVILGAHN
gi|213627368|gb|AAI71196|       -.......--..SRTGSCGGTLIKQN.WVLTAAHCVV---.............--NNSEVILGAHN
gi|301622373|gb|XP_002940514|   -.......--..QGVHLCGGSLITPQ.WIVTAAHCVYDLL.............YPEWWRVQVGQVS
gi|301623711|gb|XP_002941159|   R.......EK..KFKTICGGVLIKPS.WVLTAAHCNIT--.............--EKTKIIIGAHS
gi|301609058|gb|XP_002934098|   -.......--..-----------GNK.WIVTAAHCLHHDPgaedpvltpiklfELSSFNVILGKHR
gi|301607053|gb|XP_002933130|   -.......--..--------------.-------------.............-PSNWKARLGLHT
gi|301620754|gb|XP_002939737|   -.......--..--------------.-------------.............-ASSVIVILGAYK
gi|301631044|gb|XP_002944619|   Y.......DG..YWYHTCGGSLIAPN.WVLTAAHYXXXX-.............-------------
gi|301629851|gb|XP_002944046|   -.......--..--------------.-------CLSSL-.............IYRNLQVLLGAHN
gi|301629862|gb|XP_002944051|   -.......--..NSQVFCGGSLVTPR.WIISAAHCYRPP-.............--KTLVAHLGDHD
gi|301619787|gb|XP_002939269|   -.......--..-GNYFCAGSLIQPC.WVVSAAHCFADSP.............SKSKIRVVLGQHF
gi|301627058|gb|XP_002942695|   Y.......DG..YWYHTCGGSLIAPN.WVLTAAHCISSE-.............--NTYRVQLGKHN
gi|301629849|gb|XP_002944045|   -.......--..--------------.-------------.............--RHLQVALGAHN
gi|301626232|gb|XP_002942299|   -.......--..NERHICGGSIVRKD.MVVTAAHCVYPVTek...........KVSHMTVIAGEYD
gi|301609784|gb|XP_002934450|   -.......--..--------------.-------------.............--QMWIIYSGVVK
gi|301631575|gb|XP_002944873|   G.......GK..KYVHVCGGTLIHKS.WILTAAHCFQKGKae...........DAAXWRIVVGKHN
gi|301607830|gb|XP_002933508|   -.......-D..PSGHICGCVLIGKK.WVLTVAHCFEGRE.............SAAVWKVVFGINN
gi|301620748|gb|XP_002939734|   -.......--..--------------.------------Nttv..........DLSSIVVFLGSYM
gi|301623709|gb|XP_002941155|   -.......--..-GSNLCGGTLIKDN.WVLTAATCKVDR-.............---TTTVDLGVHS
gi|301609490|gb|XP_002934300|   -.......--..--------------.---------Y-GN.............NTRSYVIRVGDYH
gi|301607063|gb|XP_002933142|   -.......--..RNSHKCGGTLIKEN.WVLTARQCFLSGDn............DLKDYEAWLGVHN
gi|116487755|gb|AAI25706|       -.......--..----SGSGFIVSEDgLILTNAHVVTNK-.............-----------HR
gi|134023797|gb|AAI35435|       -.......--..----SGSGFIVSEDgLILTNAHVVTNK-.............-----------HR
gi|350276152|ref|NP_001072730|  -.......--..----SGSGFIVSEDgLILTNAHVVTNK-.............-----------HR
gi|301620766|gb|XP_002939742|   -.......--..NGRHFCGGTLISDQ.WVISAAHCFPSS-.............-----RSQLGSLM
gi|301609058|gb|XP_002934098|   -.......--..--------------.-------------.............-------------
gi|301606403|gb|XP_002932829|   -.......--..---SSGSGFIVSDDgLIVTNAHVLTNK-.............QRIKVEVKDGAHY
gi|163915807|gb|AAI57677|       -.......--..-STARCGGILISEE.FVLTAAHCAESQAswistkrk.....AYSKIVVILGAHN
gi|166158294|ref|NP_001107513|  -.......--..-STARCGGILISEE.FVLTAAHCAESQAswistkrk.....AYSKIVVILGAHN
gi|213624433|gb|AAI71092|       -.......--..-STARCGGILISEE.FVLTAAHCAESQAswistkrk.....AYSKIVVILGAHN
gi|213625671|gb|AAI71088|       -.......--..-STARCGGILISEE.FVLTAAHCAESQAswistkrk.....AYSKIVVILGAHN
gi|301620338|gb|XP_002939538|   -.......--..--------------.-------------.............----ARIVFGLFN
gi|301622789|gb|XP_002940709|   -.......--..--------------.-------------.............--DSVRVVLGAHN
gi|301603859|gb|XP_002931606|   -.......--..--------------.-------------.............--NSLRLVFGANN
gi|301618560|gb|XP_002938688|   -.......--..---SSGSGFIISDLgLIVTNAHVVSSSNtvs..........GRQYLKVQLH---
gi|49522408|gb|AAH75430|        GvkdaslrKG..SWVLVCSGALLNER.TVVMAAHCVTDLGkssii........KVSDMKVVLGKFY
gi|52345796|ref|NP_001004944|   GvkdaslrKG..SWVLVCSGALLNER.TVVMAAHCVTDLGkssii........KVSDMKVVLGKFY
gi|82183464|sp|Q6DIV5|          GvkdaslrKG..SWVLVCSGALLNER.TVVMAAHCVTDLGkssii........KVSDMKVVLGKFY
gi|301614097|gb|XP_002936534|   -.......--..KTGLLCGGSIISPK.WIVTAAHCVYGSRs............NASEWKVFAGALT
gi|301624064|gb|XP_002941330|   -.......--..--------------.-------------.............-------------
gi|301631613|gb|XP_002944892|   -.......--..NGRNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVAHLGEHD
gi|301631166|gb|XP_002944677|   -.......--..--------------.-------------.............-------------
gi|301614089|gb|XP_002936531|   -.......-R..QGEHFCGGSLVKEN.WVISTRQCFSSCDa............DLSGYQAVMGTLF
gi|301623570|gb|XP_002941088|   -.......--..NGRNWCGGSLISPR.WIISAAHCYQPP-.............--KTLVALLGEHD
gi|301618553|gb|XP_002938678|   P.......FL..PFQHTCAGSLIHSE.WLLLPAHCIDESQ.............KLDSWRVCLGH--
gi|169642095|gb|AAI60801|       -.......--..--------------.-------------.............-------------
gi|288684101|ref|NP_001165762|  -.......--..--------------.-------------.............-------------
gi|301627723|gb|XP_002943019|   -.......-R..SVAGPCLGSLISKS.WVLSAAHCFKEGE.............LADAYDFQIG---
gi|169642366|gb|AAI60557|       -.......-S..QKVQVCSGVVLSES.VVLTTASCITMY-.............--DPYFVVAGVQQ
gi|56789309|gb|AAH88065|        -.......-S..QKVQVCSGVVLSES.VVLTTASCITMY-.............--DPYFVVAGVQQ
gi|313851093|ref|NP_001116189|  -.......-S..QKVQVCSGVVLSES.VVLTTASCITMY-.............--DPYFVVAGVQQ
gi|301627727|gb|XP_002943021|   -.......SG..SSVQYCKGTILSPY.FILTAAHCFHLDD.............KNQKIQVII----
gi|301620760|gb|XP_002939740|   -.......--..--------------.-------------.............-------------
gi|301614097|gb|XP_002936534|   -.......--..KTGLLCGGSIISPK.WIVTAAHCVYGSRs............NASEWKVFAGALT
gi|301632426|gb|XP_002945286|   -.......--..--------------.-------------.............-------------
gi|301603859|gb|XP_002931606|   V.......GK..EFSHLCGGSVLNEI.WVLTAAHCFKHL-.............-------------
gi|169641896|gb|AAI60561|       -.......--..DGAHLCGGSLISSE.WVLTAAHCFPERNr............IVSQWRVFAGAVS
gi|187607137|ref|NP_001120287|  -.......--..DGAHLCGGSLISSE.WVLTAAHCFPERNr............IVSQWRVFAGAVS
gi|301613000|gb|XP_002936003|   -.......VD..SGQVWGSGVLVNPK.VVLTCRHVVRNA-.............--SRVTVKISSLS
gi|301620752|gb|XP_002939736|   -.......--..-GVYRCGGTLVSSK.S------------.............NASCLAVILGANK
gi|301612998|gb|XP_002936002|   -.......VD..SGQVWGSGVLVNPK.VVLTCRHVVRNA-.............SRVTVKIRHPTSE
gi|160774415|gb|AAI55421|       T.......SV..KLSTGCTGTLVAEK.HVLTAAHCIHDGKny...........VKGAQKLKVGFLK
gi|163915255|ref|NP_001106591|  T.......SV..KLSTGCTGTLVAEK.HVLTAAHCIHDGKny...........VKGAQKLKVGFLK
gi|301618176|gb|XP_002938505|   -.......--..--STGCSGILISPK.HALTAAHCIHDGKdy...........IKNGKKLRVGLLK
gi|301610794|gb|XP_002934945|   -.......--..--STGCTGVLVTER.HVLTAAHCIHDGKdy...........VQGARRLRVGFLR
gi|301630837|gb|XP_002944523|   -.......--..--------------.-------------.............-------------
gi|163916178|gb|AAI57579|       -.......--..--------------.-------------.............-------------
gi|166158059|ref|NP_001107438|  -.......--..--------------.-------------.............-------------
gi|163915732|gb|AAI57581|       -.......--..--------------.-------------.............-------------
gi|288684088|ref|NP_001165761|  -.......--..--------------.-------------.............-------------
gi|163915698|gb|AAI57530|       -.......--..--------------.-------------.............-------------
gi|166158009|ref|NP_001107414|  -.......--..--------------.-------------.............-------------
gi|301618333|gb|XP_002938578|   -.......--..NGRNWCGGSLISPR.WIISAAHCY----.............-------------
gi|49900216|gb|AAH76994|        -.......--..--------------.-------------.............-------------
gi|52346064|ref|NP_001005075|   -.......--..--------------.-------------.............-------------
gi|301612998|gb|XP_002936002|   -.......--..--------------.-------------.............-------------
gi|301613000|gb|XP_002936003|   -.......--..--------------.-------------.............-------------
gi|301630168|gb|XP_002944198|   -.......--..--------------.-------------.............-------------
gi|301615558|gb|XP_002937233|   -.......--..--------------.-------------.............-------------


                                  0                                                                 
                                  |                                                                 
d1a5ia_                           RVK..........................................................PGE..
gi|62201369|gb|AAH93474|        LSNl.........................................................KNP..
gi|71895773|ref|NP_001025685|   LSNl.........................................................KNP..
gi|301620776|gb|XP_002939747|   LAE..........................................................TSP..
gi|45708911|gb|AAH67937|        LSD..........................................................LD-..
gi|47575768|ref|NP_001001228|   LSD..........................................................LD-..
gi|301620758|gb|XP_002939739|   LTG..........................................................ANG..
gi|301623566|gb|XP_002941080|   VSK..........................................................AEG..
gi|301620778|gb|XP_002939748|   LSA..........................................................LDN..
gi|49670651|gb|AAH75423|        VSK..........................................................AEG..
gi|52345790|ref|NP_001004941|   VSK..........................................................AEG..
gi|49522964|gb|AAH75293|        LAE..........................................................TSP..
gi|54020930|ref|NP_001005710|   LAE..........................................................TSP..
gi|59808136|gb|AAH89741|        IAV..........................................................NEG..
gi|62752849|ref|NP_001015792|   IAV..........................................................NEG..
gi|301621490|gb|XP_002940084|   LSG..........................................................TDS..
gi|301628802|gb|XP_002943535|   IAL..........................................................SEG..
gi|111307978|gb|AAI21657|       IGT..........................................................PEG..
gi|118403542|ref|NP_001072819|  IGT..........................................................PEG..
gi|163916428|gb|AAI57199|       IGT..........................................................PEG..
gi|159155191|gb|AAI54713|       IFM..........................................................EGS..
gi|163915041|ref|NP_001106508|  IFM..........................................................EGS..
gi|301626232|gb|XP_002942299|   RML..........................................................NES..
gi|169642526|gb|AAI60565|       TYR..........................................................RDM..
gi|187607167|ref|NP_001120289|  TYR..........................................................RDM..
gi|301620740|gb|XP_002939730|   LTE..........................................................KDP..
gi|49522964|gb|AAH75293|        LAQ..........................................................TSP..
gi|54020930|ref|NP_001005710|   LAQ..........................................................TSP..
gi|56611173|gb|AAH87759|        IEL..........................................................LEG..
gi|58332122|ref|NP_001011209|   IEL..........................................................LEG..
gi|301620750|gb|XP_002939735|   LDN..........................................................KDK..
gi|301620756|gb|XP_002939738|   TSV..........................................................PNA..
gi|301621490|gb|XP_002940084|   LNG..........................................................--V..
gi|301620768|gb|XP_002939743|   LMN..........................................................LTS..
gi|56541274|gb|AAH87610|        IAL..........................................................SEG..
gi|58332100|ref|NP_001011202|   IAL..........................................................SEG..
gi|58476395|gb|AAH89747|        RTK..........................................................YERa.
gi|62751950|ref|NP_001015797|   RTK..........................................................YERa.
gi|301623009|gb|XP_002940815|   LSV..........................................................--P..
gi|301609429|gb|XP_002934284|   LSR..........................................................STQ..
gi|301628804|gb|XP_002943536|   IAL..........................................................SEG..
gi|301628800|gb|XP_002943534|   IAV..........................................................SEG..
gi|301623523|gb|XP_002941065|   LAV..........................................................YEG..
gi|301614043|gb|XP_002936502|   VY-..........................................................---..
gi|301620764|gb|XP_002939741|   IDQ..........................................................PDG..
gi|56611148|gb|AAH87751|        LTK..........................................................EEG..
gi|58332104|ref|NP_001011204|   LTK..........................................................EEG..
gi|89269870|gb|CAJ83405|        LSV..........................................................ASA..
gi|166796549|gb|AAI58898|       LSV..........................................................ASA..
gi|167908783|ref|NP_001016055|  LSV..........................................................ASA..
gi|213627780|gb|AAI71053|       LSV..........................................................ASA..
gi|301623529|gb|XP_002941068|   RTN..........................................................PMG..
gi|56611170|gb|AAH87830|        LTK..........................................................EEG..
gi|58332206|ref|NP_001011251|   LTK..........................................................EEG..
gi|58476361|gb|AAH89695|        IRK..........................................................LED..
gi|62751546|ref|NP_001015759|   IRK..........................................................LED..
gi|56270387|gb|AAH87611|        IDQ..........................................................PDG..
gi|58332094|ref|NP_001011195|   IDQ..........................................................PDG..
gi|301620770|gb|XP_002939744|   LSL..........................................................SSP..
gi|301623525|gb|XP_002941066|   RTS..........................................................PTG..
gi|56541161|gb|AAH87563|        IAL..........................................................SEG..
gi|58332102|ref|NP_001011199|   IAL..........................................................SEG..
gi|56971223|gb|AAH88079|        LKK..........................................................KEG..
gi|58332720|ref|NP_001011435|   LKK..........................................................KEG..
gi|56556311|gb|AAH87753|        RTK..........................................................PTG..
gi|301620774|gb|XP_002939746|   LSL..........................................................ISP..
gi|301621490|gb|XP_002940084|   LSG..........................................................ADT..
gi|301618335|gb|XP_002938574|   LKK..........................................................KEG..
gi|301627387|gb|XP_002942851|   LQQ..........................................................DEA..
gi|51895949|gb|AAH80976|        LQQ..........................................................DEA..
gi|56118865|ref|NP_001008077|   LQQ..........................................................DEA..
gi|301618337|gb|XP_002938575|   LKK..........................................................KEG..
gi|301611781|gb|XP_002935401|   RNS..........................................................NVE..
gi|56971185|gb|AAH88769|        RSS..........................................................SAE..
gi|58743375|ref|NP_001011477|   RSS..........................................................SAE..
gi|301611783|gb|XP_002935402|   RNS..........................................................NVE..
gi|301606691|gb|XP_002932950|   QHN..........................................................---..
gi|57870463|gb|AAH89075|        RSS..........................................................PAE..
gi|62751938|ref|NP_001015686|   RSS..........................................................PAE..
gi|301610206|gb|XP_002934644|   LTQ..........................................................LGP..
gi|159155760|gb|AAI54947|       KTN..........................................................PMG..
gi|301632763|gb|XP_002945450|   KTN..........................................................PMG..
gi|301623527|gb|XP_002941067|   RTK..........................................................PTG..
gi|56611133|gb|AAH87787|        TEV..........................................................SDG..
gi|58332150|ref|NP_001011223|   TEV..........................................................SDG..
gi|301620772|gb|XP_002939745|   LSL..........................................................TSP..
gi|301614103|gb|XP_002936536|   LPS..........................................................-YY..
gi|60552068|gb|AAH91088|        LRY..........................................................IEP..
gi|301627389|gb|XP_002942852|   LRY..........................................................IEP..
gi|301623007|gb|XP_002940814|   LSV..........................................................--P..
gi|301612271|gb|XP_002935645|   LSE..........................................................LGP..
gi|301603857|gb|XP_002931605|   LKV..........................................................LES..
gi|301615211|gb|XP_002937069|   LSK..........................................................LGS..
gi|301615213|gb|XP_002937070|   LSK..........................................................LGS..
gi|301603863|gb|XP_002931607|   LKV..........................................................LES..
gi|301627010|gb|XP_002942670|   LAN..........................................................EEGae
gi|56972340|gb|AAH88057|        LAN..........................................................EEGae
gi|58332702|ref|NP_001011426|   LAN..........................................................EEGae
gi|39850054|gb|AAH64277|        RGS..........................................................NVE..
gi|301615217|gb|XP_002937076|   LSK..........................................................LGS..
gi|301630725|gb|XP_002944467|   LTQ..........................................................LGP..
gi|60552029|gb|AAH91010|        QRE..........................................................PGD..
gi|71896209|ref|NP_001025574|   QRE..........................................................PGD..
gi|301620748|gb|XP_002939734|   LSG..........................................................ANS..
gi|301615956|gb|XP_002937430|   LYW..........................................................SDR..
gi|301622787|gb|XP_002940708|   LQR..........................................................PDS..
gi|56789422|gb|AAH88038|        LQR..........................................................PDS..
gi|56611135|gb|AAH87810|        LIL..........................................................EEG..
gi|301624444|gb|XP_002941509|   LSG..........................................................NPK..
gi|301615068|gb|XP_002937000|   FNT..........................................................TDQ..
gi|301618415|gb|XP_002938616|   ESG..........................................................NEA..
gi|301627689|gb|XP_002943002|   MPS..........................................................-YY..
gi|58477045|gb|AAH89660|        TKI..........................................................SEG..
gi|62751697|ref|NP_001015728|   TKI..........................................................SEG..
gi|301622330|gb|XP_002940490|   LNR..........................................................TEA..
gi|301620762|gb|XP_002939724|   ITG..........................................................NPK..
gi|301614101|gb|XP_002936535|   LPR..........................................................FN-..
gi|57032953|gb|AAH88892|        LSG..........................................................NPK..
gi|301620357|gb|XP_002939545|   LAK..........................................................NES..
gi|58477078|gb|AAH89729|        LAK..........................................................NES..
gi|58476369|gb|AAH89702|        ITG..........................................................NPN..
gi|301624442|gb|XP_002941516|   IVQ..........................................................DHD..
gi|56585195|gb|AAH87729|        RSV..........................................................SEG..
gi|56971746|gb|AAH88036|        RSV..........................................................SEG..
gi|58332692|ref|NP_001011421|   RSV..........................................................SEG..
gi|301614099|gb|XP_002936522|   LPS..........................................................-YS..
gi|301627056|gb|XP_002942694|   LQQ..........................................................IDA..
gi|301620744|gb|XP_002939732|   LNQ..........................................................TNP..
gi|301627687|gb|XP_002943001|   IQS..........................................................YS-..
gi|301620752|gb|XP_002939736|   IVQ..........................................................DHD..
gi|301620760|gb|XP_002939740|   ITG..........................................................NPN..
gi|301614101|gb|XP_002936535|   LPR..........................................................-YY..
gi|301612617|gb|XP_002935812|   TGV..........................................................EDE..
gi|57032843|gb|AAH88882|        IYQ..........................................................NDG..
gi|58332834|ref|NP_001011493|   IYQ..........................................................NDG..
gi|62531104|gb|AAH92553|        INA..........................................................NDG..
gi|71895833|ref|NP_001025669|   INA..........................................................NDG..
gi|113931254|ref|NP_001039074|  LT-..........................................................---..
gi|89273918|gb|CAJ81839|        LT-..........................................................---..
gi|301614097|gb|XP_002936534|   QPS..........................................................-YS..
gi|187469575|gb|AAI67128|       LSV..........................................................NEG..
gi|301608337|gb|XP_002933738|   LSV..........................................................NEG..
gi|62859195|ref|NP_001016980|   LGV..........................................................PSS..
gi|89272057|gb|CAJ83340|        LGV..........................................................PSS..
gi|134023759|gb|AAI35327|       VRS..........................................................-KM..
gi|147901778|ref|NP_001090874|  VRS..........................................................-KM..
gi|301608335|gb|XP_002933737|   IYQ..........................................................NDG..
gi|161612048|gb|AAI56020|       IYQ..........................................................NDG..
gi|56971188|gb|AAH88782|        INA..........................................................NDG..
gi|58332812|ref|NP_001011481|   INA..........................................................NDG..
gi|66990056|gb|AAH98090|        RLS..........................................................YDK..
gi|73853846|ref|NP_001027508|   RLS..........................................................YDK..
gi|54035177|gb|AAH84139|        -ST..........................................................QDS..
gi|58332348|ref|NP_001011037|   -ST..........................................................QDS..
gi|56789096|gb|AAH88027|        VKE..........................................................PES..
gi|353523845|ref|NP_001238808|  VKE..........................................................PES..
gi|301610620|gb|XP_002934851|   VKE..........................................................PES..
gi|301627008|gb|XP_002942673|   LSL..........................................................EEG..
gi|39794386|gb|AAH64208|        LSK..........................................................PEK..
gi|45361487|ref|NP_989320|      LSK..........................................................PEK..
gi|82237461|sp|Q6P326|          LSK..........................................................PEK..
gi|301619167|gb|XP_002938973|   LSE..........................................................KEK..
gi|56789072|gb|AAH88011|        ITR..........................................................EEG..
gi|58332288|ref|NP_001011293|   ITR..........................................................EEG..
gi|113205726|ref|NP_001037931|  LSE..........................................................IGL..
gi|89266985|gb|CAJ81306|        LSE..........................................................IGL..
gi|301619169|gb|XP_002938974|   LSN..........................................................HGP..
gi|301623913|gb|XP_002941253|   NTN..........................................................LQS..
gi|163915777|gb|AAI57637|       LSG..........................................................AED..
gi|166158186|ref|NP_001107486|  LSG..........................................................AED..
gi|301626232|gb|XP_002942299|   LLE..........................................................--V..
gi|66396569|gb|AAH96515|        MKH..........................................................LK-..
gi|301623915|gb|XP_002941259|   MKH..........................................................LK-..
gi|66396598|gb|AAH96508|        NTN..........................................................LQS..
gi|301618553|gb|XP_002938678|   LTL..........................................................VEP..
gi|301619614|gb|XP_002939175|   LS-..........................................................---..
gi|301623919|gb|XP_002941255|   VKH..........................................................LL-..
gi|301623917|gb|XP_002941260|   VKH..........................................................LL-..
gi|49899920|gb|AAH76933|        LRA..........................................................NEA..
gi|55742037|ref|NP_001006847|   LRA..........................................................NEA..
gi|163915656|gb|AAI57668|       VKS..........................................................REN..
gi|165973394|ref|NP_001107158|  VKS..........................................................REN..
gi|213627368|gb|AAI71196|       VKS..........................................................REN..
gi|301622373|gb|XP_002940514|   QAS..........................................................-ES..
gi|301623711|gb|XP_002941159|   LTA..........................................................KES..
gi|301609058|gb|XP_002934098|   TLK..........................................................KDD..
gi|301607053|gb|XP_002933130|   NLN..........................................................LTQp.
gi|301620754|gb|XP_002939737|   ITG..........................................................NHK..
gi|301631044|gb|XP_002944619|   ---..........................................................-XX..
gi|301629851|gb|XP_002944046|   RTK..........................................................PTG..
gi|301629862|gb|XP_002944051|   LTK..........................................................EEG..
gi|301619787|gb|XP_002939269|   FNQ..........................................................TTD..
gi|301627058|gb|XP_002942695|   LQQ..........................................................FND..
gi|301629849|gb|XP_002944045|   KTN..........................................................PMG..
gi|301626232|gb|XP_002942299|   QQV..........................................................NDS..
gi|301609784|gb|XP_002934450|   LSN..........................................................ITQ..
gi|301631575|gb|XP_002944873|   LNR..........................................................TEA..
gi|301607830|gb|XP_002933508|   LDH..........................................................PSD..
gi|301620748|gb|XP_002939734|   LSE..........................................................PNQ..
gi|301623709|gb|XP_002941155|   IKT..........................................................MNK..
gi|301609490|gb|XP_002934300|   TLV..........................................................PEE..
gi|301607063|gb|XP_002933142|   IYS..........................................................TTEk.
gi|116487755|gb|AAI25706|       LKV..........................................................ERSdg
gi|134023797|gb|AAI35435|       LKV..........................................................ERSdg
gi|350276152|ref|NP_001072730|  LKV..........................................................ERSdg
gi|301620766|gb|XP_002939742|   TKQ..........................................................RS-..
gi|301609058|gb|XP_002934098|   ---..........................................................KDD..
gi|301606403|gb|XP_002932829|   DAK..........................................................IK-..
gi|163915807|gb|AAI57677|       IDE..........................................................QEQ..
gi|166158294|ref|NP_001107513|  IDE..........................................................QEQ..
gi|213624433|gb|AAI71092|       IDE..........................................................QEQ..
gi|213625671|gb|AAI71088|       IDE..........................................................QEQ..
gi|301620338|gb|XP_002939538|   VSD..........................................................LGP..
gi|301622789|gb|XP_002940709|   LQR..........................................................PDS..
gi|301603859|gb|XP_002931606|   LKV..........................................................LES..
gi|301618560|gb|XP_002938688|   -NG..........................................................---..
gi|49522408|gb|AAH75430|        RDDdr........................................................EEK..
gi|52345796|ref|NP_001004944|   RDDdr........................................................EEK..
gi|82183464|sp|Q6DIV5|          RDDdr........................................................EEK..
gi|301614097|gb|XP_002936534|   LPS..........................................................-YS..
gi|301624064|gb|XP_002941330|   ---..........................................................---..
gi|301631613|gb|XP_002944892|   LKK..........................................................KEG..
gi|301631166|gb|XP_002944677|   ---..........................................................---..
gi|301614089|gb|XP_002936531|   KNPsp........................................................DDP..
gi|301623570|gb|XP_002941088|   LKK..........................................................KEG..
gi|301618553|gb|XP_002938678|   ---..........................................................--A..
gi|169642095|gb|AAI60801|       ---..........................................................---..
gi|288684101|ref|NP_001165762|  ---..........................................................---..
gi|301627723|gb|XP_002943019|   ---..........................................................---..
gi|169642366|gb|AAI60557|       KSG..........................................................-LG..
gi|56789309|gb|AAH88065|        KSG..........................................................-LG..
gi|313851093|ref|NP_001116189|  KSG..........................................................-LG..
gi|301627727|gb|XP_002943021|   ---..........................................................---..
gi|301620760|gb|XP_002939740|   ---..........................................................---..
gi|301614097|gb|XP_002936534|   LPS..........................................................-YS..
gi|301632426|gb|XP_002945286|   ---..........................................................---..
gi|301603859|gb|XP_002931606|   ---..........................................................---..
gi|169641896|gb|AAI60561|       QL-..........................................................-SP..
gi|187607137|ref|NP_001120287|  QL-..........................................................-SP..
gi|301613000|gb|XP_002936003|   RFQ..........................................................VLS..
gi|301620752|gb|XP_002939736|   LSG..........................................................NEN..
gi|301612998|gb|XP_002936002|   MFQ..........................................................VLS..
gi|160774415|gb|AAI55421|       PRYkdggkglnqtnprip...........................................E-Km.
gi|163915255|ref|NP_001106591|  PRYkdggkglnqtnprip...........................................E-Km.
gi|301618176|gb|XP_002938505|   VRSkrggkrrkgskrakedesedadppkkdrkqkrksiqkrsaaaeeltnnlsgkergsgaGKP..
gi|301610794|gb|XP_002934945|   PGV..........................................................-NP..
gi|301630837|gb|XP_002944523|   ---..........................................................---..
gi|163916178|gb|AAI57579|       ---..........................................................---..
gi|166158059|ref|NP_001107438|  ---..........................................................---..
gi|163915732|gb|AAI57581|       ---..........................................................---..
gi|288684088|ref|NP_001165761|  ---..........................................................---..
gi|163915698|gb|AAI57530|       ---..........................................................---..
gi|166158009|ref|NP_001107414|  ---..........................................................---..
gi|301618333|gb|XP_002938578|   ---..........................................................---..
gi|49900216|gb|AAH76994|        ---..........................................................---..
gi|52346064|ref|NP_001005075|   ---..........................................................---..
gi|301612998|gb|XP_002936002|   ---..........................................................---..
gi|301613000|gb|XP_002936003|   ---..........................................................---..
gi|301630168|gb|XP_002944198|   ---..........................................................---..
gi|301615558|gb|XP_002937233|   ---..........................................................---..


                                        90         100                                           110
                                         |           |                                             |
d1a5ia_                           ...EEQTFKV..KKYIVHKEF...D........................DDT.........YNNDI
gi|62201369|gb|AAH93474|        ...NTVSSGV..KRIIINKAY...Q........................YEG.........SSGDI
gi|71895773|ref|NP_001025685|   ...NTVSSGV..KRIIINKAY...Q........................YEG.........SSGDI
gi|301620776|gb|XP_002939747|   ...NEITAKV..DRIIMHPQY...D........................ELT.........YFGDI
gi|45708911|gb|AAH67937|        ...NAVLRGV..KNITVHPDY...M........................YEG.........SSGDI
gi|47575768|ref|NP_001001228|   ...NAVLRGV..KNITVHPDY...M........................YEG.........SSGDI
gi|301620758|gb|XP_002939739|   ...NEIPMAI..QRFIVHPNY...T........................SPE.........YGHDI
gi|301623566|gb|XP_002941080|   ...TVQIIQV..EKSFQHYKY...N........................SSS.........IDNDI
gi|301620778|gb|XP_002939748|   ...STVSRGV..KKIIKNPNF...L........................YEG.........SSGDI
gi|49670651|gb|AAH75423|        ...TVQIIQV..EKSFQHYKY...N........................SSN.........IDNDI
gi|52345790|ref|NP_001004941|   ...TVQIIQV..EKSFQHYKY...N........................SSN.........IDNDI
gi|49522964|gb|AAH75293|        ...NEITAKV..DRIIMHPQY...D........................ELT.........YFGDI
gi|54020930|ref|NP_001005710|   ...NEITAKV..DRIIMHPQY...D........................ELT.........YFGDI
gi|59808136|gb|AAH89741|        ...TEQFIES..QKVIKHPSY...N........................SRN.........LDNDI
gi|62752849|ref|NP_001015792|   ...TEQFIES..QKVIKHPSY...N........................SRN.........LDNDI
gi|301621490|gb|XP_002940084|   ...STVKATI..RNIIKHPSY...D........................PDT.........ADYDV
gi|301628802|gb|XP_002943535|   ...TEQFINS..AKVIRHPSY...N........................SRT.........TDNDI
gi|111307978|gb|AAI21657|       ...TEQESKV..SKIIMHEHYyg.S........................KTN.........NDNDI
gi|118403542|ref|NP_001072819|  ...TEQESKV..SKIIMHEHYyg.S........................KTN.........NDNDI
gi|163916428|gb|AAI57199|       ...TEQESKV..SKIIMHEHYyg.S........................KTN.........NDNDI
gi|159155191|gb|AAI54713|       ...PVVKAKI..KQIIIHASY...D........................HIA.........ITNDI
gi|163915041|ref|NP_001106508|  ...PVVKAKI..KQIIIHASY...D........................HIA.........ITNDI
gi|301626232|gb|XP_002942299|   ...MEQIRNI..KAIRIHEDY...N........................SEN.........YDNDI
gi|169642526|gb|AAI60565|       ...DEQKIAV..LQVFSHPNY...L........................AEF.........YDHDI
gi|187607167|ref|NP_001120289|  ...DEQKIAV..LQVFSHPNY...L........................AEF.........YDHDI
gi|301620740|gb|XP_002939730|   ...EEISVGV..AKIINYPTY...R........................RES.........DSGDI
gi|49522964|gb|AAH75293|        ...NEITYTV..DRIIVNSQF...D........................SST.........LFGDI
gi|54020930|ref|NP_001005710|   ...NEITYTV..DRIIVNSQF...D........................SST.........LFGDI
gi|56611173|gb|AAH87759|        ...TEQFIQS..AKIIRHPQY...N........................SWT.........IDNDI
gi|58332122|ref|NP_001011209|   ...TEQFIQS..AKIIRHPQY...N........................SWT.........IDNDI
gi|301620750|gb|XP_002939735|   ...GEQPVSV..KRIIIHPSY...R........................EGY.........LNDNI
gi|301620756|gb|XP_002939738|   ...NEVPMTV..KRFMNHPNY...T........................SPD.........KGFDI
gi|301621490|gb|XP_002940084|   ...EGRVEKI..FRIHKHPFY...N........................VYT.........LDNDV
gi|301620768|gb|XP_002939743|   ...DAVIIRV..KRVITYPLY...T........................GEG.........SSGDI
gi|56541274|gb|AAH87610|        ...TEQFINS..AKVIRHPSY...N........................SRT.........IDNDI
gi|58332100|ref|NP_001011202|   ...TEQFINS..AKVIRHPSY...N........................SRT.........IDNDI
gi|58476395|gb|AAH89747|        ...TERIAQL..ERIIVHPKY...Nw.......................KEN.........LDRDI
gi|62751950|ref|NP_001015797|   ...TERIAQL..ERIIVHPKY...Nw.......................KEN.........LDRDI
gi|301623009|gb|XP_002940815|   ...SGILMNV..DSIHIHPTF...K........................GIG.........NSGDI
gi|301609429|gb|XP_002934284|   ...KELAFKV..IRLVIHPFY...D........................EDS.........HDYDV
gi|301628804|gb|XP_002943536|   ...TEQFINS..AKVIRHPSY...N........................SRT.........TDNDI
gi|301628800|gb|XP_002943534|   ...TEQFINS..AKVIRHSGY...N........................SRT.........LDNDI
gi|301623523|gb|XP_002941065|   ...KEQFSYA..EKMCPHSGF...N........................PIT.........FDNDI
gi|301614043|gb|XP_002936502|   ...SGSEFKI..EKIIIYEGY...T........................SHN.........HRNDI
gi|301620764|gb|XP_002939741|   ...NQEAIAV..QSATNNPSY...I........................NEG.........DSGDI
gi|56611148|gb|AAH87751|        ...TEQHIQV..ENIYKHFSY...K........................DND.........VDHDI
gi|58332104|ref|NP_001011204|   ...TEQHIQV..ENIYKHFSY...K........................DND.........VDHDI
gi|89269870|gb|CAJ83405|        ...SELLSSV..ARVIVNPSF...T........................TPG.........GPGDI
gi|166796549|gb|AAI58898|       ...SELLSSV..ARVIVNPSF...T........................IPG.........GPGDI
gi|167908783|ref|NP_001016055|  ...SELLSSV..ARVIVNPSF...T........................IPG.........GPGDI
gi|213627780|gb|AAI71053|       ...SELLSSV..ARVIVNPSF...T........................IPG.........GPGDI
gi|301623529|gb|XP_002941068|   ...HIQYTYV..AKIFRHCGF...D........................WST.........YNNDI
gi|56611170|gb|AAH87830|        ...TEQHIQV..EAAYKHSSY...K........................DEA.........YDHDI
gi|58332206|ref|NP_001011251|   ...TEQHIQV..EAAYKHSSY...K........................DEA.........YDHDI
gi|58476361|gb|AAH89695|        ...TEQQFAV..IKIIPHPEY...E........................SNT.........NDNDI
gi|62751546|ref|NP_001015759|   ...TEQQFAV..IKIIPHPEY...E........................SNT.........NDNDI
gi|56270387|gb|AAH87611|        ...NQVAIPV..QSATNYPSY...V........................NEG.........DSGDI
gi|58332094|ref|NP_001011195|   ...NQVAIPV..QSATNYPSY...V........................NEG.........DSGDI
gi|301620770|gb|XP_002939744|   ...NEFISSV..KSITVNSQY...N........................SQT.........NFGDI
gi|301623525|gb|XP_002941066|   ...DEQYTYA..AKICPHQDF...E........................PVT.........YDNDI
gi|56541161|gb|AAH87563|        ...TEQFISS..SKVIRHSGY...N........................SWT.........LDNDI
gi|58332102|ref|NP_001011199|   ...TEQFISS..SKVIRHSGY...N........................SWT.........LDNDI
gi|56971223|gb|AAH88079|        ...TEQHIQV..EAAYKHFGY...K........................DEA.........YDHDI
gi|58332720|ref|NP_001011435|   ...TEQHIQV..EAAYKHFGY...K........................DEA.........YDHDI
gi|56556311|gb|AAH87753|        ...HKQYTYA..AKICPHCGF...H........................PIT.........YDHDI
gi|301620774|gb|XP_002939746|   ...HEITSTV..DSIIVNSP-...N........................SSS.........TNTDI
gi|301621490|gb|XP_002940084|   ...IAIKISL..KRVIQHPHF...N........................PLT.........LDFDV
gi|301618335|gb|XP_002938574|   ...TEQHIQV..EAAYKHFGY...K........................DEA.........YDHDI
gi|301627387|gb|XP_002942851|   ...EAVAITP..EKIIVHEKW...N........................SLF.........IINDI
gi|51895949|gb|AAH80976|        ...EAVAITP..EKIIVHEKW...N........................SLF.........IINDI
gi|56118865|ref|NP_001008077|   ...EAVAITP..EKIIVHEKW...N........................SLF.........IINDI
gi|301618337|gb|XP_002938575|   ...TEQHIQV..EAAYKHFGY...K........................DKA.........HDHDI
gi|301611781|gb|XP_002935401|   ...KIQSLAV..AKVFTHPQW...N........................SNT.........INNDI
gi|56971185|gb|AAH88769|        ...PIQTMSI..SRVFKHPNY...N........................TNT.........MINDI
gi|58743375|ref|NP_001011477|   ...PIQTMSI..SRVFKHPNY...N........................TNT.........MINDI
gi|301611783|gb|XP_002935402|   ...KIQSLAV..AKVFTHPQW...N........................SNT.........INNDI
gi|301606691|gb|XP_002932950|   ...LNAMHTV..TVIVRNENY...N........................SDT.........DDFDM
gi|57870463|gb|AAH89075|        ...PIQTKTI..AKVFRHPNY...N........................SFT.........IANDI
gi|62751938|ref|NP_001015686|   ...PIQTKTI..AKVFRHPNY...N........................SFT.........IANDI
gi|301610206|gb|XP_002934644|   ...ETQIRTI..KQWIQHEDF...D........................HKT.........HKNDI
gi|159155760|gb|AAI54947|       ...HIQYTYA..AKICPHRDF...D........................WST.........YNNDI
gi|301632763|gb|XP_002945450|   ...HIQYTYA..AKICPHRDF...D........................WST.........YNNDI
gi|301623527|gb|XP_002941067|   ...HKQYTYA..AKICPHEEF...D........................WST.........YNNDI
gi|56611133|gb|AAH87787|        ...TEQHHKV..TRIILYPAY...N........................ATRsk.......YNNDI
gi|58332150|ref|NP_001011223|   ...TEQHHKV..TRIILYPAY...N........................ATRsk.......YNNDI
gi|301620772|gb|XP_002939745|   ...NEITYKV..DRIIVNSQF...D........................SSS.........HYGDI
gi|301614103|gb|XP_002936536|   ...DPSGYSV..ERIIAHPGY...N........................SST.........NDNDI
gi|60552068|gb|AAH91088|        ...GQKIINV..SKLINHPRW...D........................PNSlg.......NGFDI
gi|301627389|gb|XP_002942852|   ...GQKIINV..SKLINHPRW...D........................PNSlg.......NGFDI
gi|301623007|gb|XP_002940814|   ...SGIFVDV..AAVYVHPTF...K........................GAG.........SIGDI
gi|301612271|gb|XP_002935645|   ...DTQTRKI..KKLIVHEEY...S........................GEGk........QIYDM
gi|301603857|gb|XP_002931605|   ...SVQIRKI..KEVIQPKAY...N........................PTT.........EANDI
gi|301615211|gb|XP_002937069|   ...ETQIRKV..KQLILHEKY...L........................REGk........HSYDI
gi|301615213|gb|XP_002937070|   ...ETQIRKV..KQLILHEKY...L........................REGk........HSYDI
gi|301603863|gb|XP_002931607|   ...SVQIRKI..KEVVQPKAY...N........................PTT.........EANDI
gi|301627010|gb|XP_002942670|   ...EIFLIPS..EDMFVHQSW...N........................SVCva.......CGNDI
gi|56972340|gb|AAH88057|        ...EIFLIPS..EDMFVHESW...N........................NNCip.......CGNDI
gi|58332702|ref|NP_001011426|   ...EIFLIPS..EDMFVHESW...N........................NNCip.......CGNDI
gi|39850054|gb|AAH64277|        ...KIQSLAV..AKVFTHPQW...N........................SNT.........INNDI
gi|301615217|gb|XP_002937076|   ...ETQIRKV..KQLILHEKY...L........................REGk........HSYDI
gi|301630725|gb|XP_002944467|   ...ETQIRTI..KQWIQHEDF...D........................HKT.........HKNDI
gi|60552029|gb|AAH91010|        ...EEQKFTV..EQLYVHSEF...D........................ANT.........FDNDI
gi|71896209|ref|NP_001025574|   ...EEQKFTV..EQLYVHSEF...D........................ANT.........FDNDI
gi|301620748|gb|XP_002939734|   ...HEVKVKV..KNFIINPNY...T........................TFT.........KGSDI
gi|301615956|gb|XP_002937430|   ...PVQVFRT..LKFVQHPQF...N........................PQT.........FQSDL
gi|301622787|gb|XP_002940708|   ...LVQEFRV..QESVQNPEY...N........................PTT.........FQNDI
gi|56789422|gb|AAH88038|        ...LVQEFRV..QESVQNPEY...N........................PTT.........FQNDI
gi|56611135|gb|AAH87810|        ...AEQNIPInnSDIFNHPKW...N........................RGCae.......CGYDI
gi|301624444|gb|XP_002941509|   ...EETAIPA..KRIIIHPYY...Y........................FSN.........YSGDL
gi|301615068|gb|XP_002937000|   ...HTVTLLV..EKYILHEKY...Y........................GDT.........LQHDI
gi|301618415|gb|XP_002938616|   ...SKQVRQI..EKFFKEPS-...-........................---.........-NADI
gi|301627689|gb|XP_002943002|   ...DSSAYSV..DRIIVHPDY...S........................SQT.........NSNDI
gi|58477045|gb|AAH89660|        ...TESIHKV..EKIIMHPRF...V........................KST.........YDYDI
gi|62751697|ref|NP_001015728|   ...TESIHKV..EKIIMHPRF...V........................KST.........YDYDI
gi|301622330|gb|XP_002940490|   ...TEKVYSV..KRIYRHERF...S........................YPQlnd......LDYDI
gi|301620762|gb|XP_002939724|   ...EEIPVQV..KQIIIHPSY...N........................ESD.........NSADI
gi|301614101|gb|XP_002936535|   ...DTNSYLV..ERIIAHPGF...N........................LAS.........RDNDI
gi|57032953|gb|AAH88892|        ...EETAIPA..KRIIIHPYY...Y........................FSN.........YSGDL
gi|301620357|gb|XP_002939545|   ...SEQSFDV..DGIFVHENYye.T........................VSS.........FHNDI
gi|58477078|gb|AAH89729|        ...SEQSFDV..DGIFVHENYye.T........................VSS.........FHNDI
gi|58476369|gb|AAH89702|        ...EENSVPV..QQIIIHPSY...N........................ESD.........NSADI
gi|301624442|gb|XP_002941516|   ...EHSPIKA..KQIIIHPDY...S........................PST.........LLADI
gi|56585195|gb|AAH87729|        ...GEQIIPVtnEDIFVHEKW...I........................SICaa.......CGNDI
gi|56971746|gb|AAH88036|        ...GEQIIPVtnEDIFVHEKW...I........................SICaa.......CGNDI
gi|58332692|ref|NP_001011421|   ...GEQIIPVtnEDIFVHEKW...I........................SICaa.......CGNDI
gi|301614099|gb|XP_002936522|   ...DANGYSV..ERIIVFPGY...N........................SSD.........NDNDI
gi|301627056|gb|XP_002942694|   ...GQETISV..IGLYNHPGW...D........................PNDva.......KGFDI
gi|301620744|gb|XP_002939732|   ...NEVCVKV..KNITSYPNY...T........................KDT.........DSGDI
gi|301627687|gb|XP_002943001|   ...-SSGRLV..ERALVHPNY...T........................SNT.........QNYDV
gi|301620752|gb|XP_002939736|   ...EHSPIKA..KQIIIHPDY...S........................PST.........LLADI
gi|301620760|gb|XP_002939740|   ...EENSVPV..QQIIIHPSY...N........................ESD.........NSADI
gi|301614101|gb|XP_002936535|   ...DPSGYSV..ERIITHPGY...Y........................SVT.........YNNDI
gi|301612617|gb|XP_002935812|   ...FERELPL..QKIVIHKNY...R........................STS.........NDNDI
gi|57032843|gb|AAH88882|        ...TEQYISV..SRIVKHANW...N........................PNNia.......AGYDI
gi|58332834|ref|NP_001011493|   ...TEQYISV..SRIVKHANW...N........................PNNia.......AGYDI
gi|62531104|gb|AAH92553|        ...TEQYISV..SRIIKHANW...N........................TNNia.......AGYDI
gi|71895833|ref|NP_001025669|   ...TEQYISV..SRIIKHANW...N........................TNNia.......AGYDI
gi|113931254|ref|NP_001039074|  ...YLFGTFV..DKIFLNSKY...V........................TDQ.........KPNDI
gi|89273918|gb|CAJ81839|        ...YLFGTFV..DKIFLNSKY...V........................TDQ.........KPNDI
gi|301614097|gb|XP_002936534|   ...DANGYSV..ERIIVFPGY...N........................SSD.........NDNDI
gi|187469575|gb|AAI67128|       ...PEQIIAV..SKIVKHVNW...N........................PNNva.......AGWDI
gi|301608337|gb|XP_002933738|   ...PEQIIAV..SKIVKHVNW...N........................PNNva.......AGWDI
gi|62859195|ref|NP_001016980|   ...NSQLLKL..KQVTIYPSY...S........................HDT.........SSGDL
gi|89272057|gb|CAJ83340|        ...NSQLLKL..KQVTIYPSY...S........................HDT.........SSGDL
gi|134023759|gb|AAI35327|       ...DAVNRTI..EKIILHEMF...D........................PES.........YNHDI
gi|147901778|ref|NP_001090874|  ...DAVNRTI..EKIILHEMF...D........................PES.........YNHDI
gi|301608335|gb|XP_002933737|   ...TEQYISV..SRIVQHANW...N........................RNNva.......AGYDI
gi|161612048|gb|AAI56020|       ...TEQYISV..SRIVQHANW...N........................RNNva.......AGYDI
gi|56971188|gb|AAH88782|        ...TEQYISV..SKIVKHANW...N........................TNNva.......AGYDI
gi|58332812|ref|NP_001011481|   ...TEQYISV..SKIVKHANW...N........................TNNva.......AGYDI
gi|66990056|gb|AAH98090|        ...DIDSFPV..KSVIVHESY...N........................PNT.........YENDI
gi|73853846|ref|NP_001027508|   ...DIDSFPV..KSVIVHESY...N........................PNT.........YENDI
gi|54035177|gb|AAH84139|        ...NYIRGWP..EAVFIHEGY...K........................PGH.........YNNDI
gi|58332348|ref|NP_001011037|   ...NYIRGWP..EAVFIHEGY...K........................PGH.........YNNDI
gi|56789096|gb|AAH88027|        ...SQQVIGV..QSKHLHPEY...D........................DEEsl.......PFNDV
gi|353523845|ref|NP_001238808|  ...SQQVIGV..QSKHLHPEY...D........................DEEsl.......PFNDV
gi|301610620|gb|XP_002934851|   ...SQQVIGV..QSKHLHPEY...D........................DEEsl.......PFNDV
gi|301627008|gb|XP_002942673|   ...AEQNIPInnSDIFNHPKW...N........................RGCae.......CGYDI
gi|39794386|gb|AAH64208|        ...YKIVVKV..LREIPHPLY...N........................STI.........KHHDL
gi|45361487|ref|NP_989320|      ...YKIVVKV..LREIPHPLY...N........................STI.........KHHDL
gi|82237461|sp|Q6P326|          ...YKIVVKV..LREIPHPLY...N........................STI.........KHHDL
gi|301619167|gb|XP_002938973|   ...HIQVLNV..KQIIQHELY...D........................PKV.........QYYDI
gi|56789072|gb|AAH88011|        ...TEQHIQV..EKTFPHNRY...L........................GLS.........DSNNI
gi|58332288|ref|NP_001011293|   ...TEQHIQV..EKTFPHNRY...L........................GLS.........DSNNI
gi|113205726|ref|NP_001037931|  ...RTQSRGV..KQLIKHDQY...D........................PIT.........ESNDI
gi|89266985|gb|CAJ81306|        ...RTQSRGV..KQLIKHDQY...D........................PIT.........ESNDI
gi|301619169|gb|XP_002938974|   ...KSQVRYI..RQIIQHEQY...D........................PNT.........EKNDI
gi|301623913|gb|XP_002941253|   ...QEKRLQA..KKIIIHPLY...Qdnedteg.................QSN.........FDNDI
gi|163915777|gb|AAI57637|       ...TKQTFD-..AEVYNHPDF...S........................ISN.........YDNDI
gi|166158186|ref|NP_001107486|  ...TKQTFD-..AEVYNHPDF...S........................ISN.........YDNDI
gi|301626232|gb|XP_002942299|   ...HNEHALV..INSHVHELY...V........................PKSvp.......PTNDL
gi|66396569|gb|AAH96515|        ...ELGTHPV..EAFYMHPNF...N........................RNN.........YDNDI
gi|301623915|gb|XP_002941259|   ...ELGTHPV..EAFYMHPNF...N........................RNN.........YDNDI
gi|66396598|gb|AAH96508|        ...QEKRLQA..KKIIIHPLY...Qdnedteg.................QSN.........FDNDI
gi|301618553|gb|XP_002938678|   ...TEKCFKV..LGIYRHELF...V........................YPEipa......LEFDV
gi|301619614|gb|XP_002939175|   ...TGIAYSV..RNIYYNGLY...S........................LET.........NDYDV
gi|301623919|gb|XP_002941255|   ...EMGNHPV..EAFYVHPAF...R........................KGS.........YDNDI
gi|301623917|gb|XP_002941260|   ...EMGPHPV..EAFYVHPNF...-........................-RS.........YDNDI
gi|49899920|gb|AAH76933|        ...TKQRFRV..NQVFE-NGF...N........................PLT.........LQNDI
gi|55742037|ref|NP_001006847|   ...TKQRFRV..NQVFE-NGF...N........................PLT.........LQNDI
gi|163915656|gb|AAI57668|       ...EQQRFSV..ARAIPHPCF...E........................WKK.........KIHDI
gi|165973394|ref|NP_001107158|  ...EQQRFSV..ARAIPHPCF...E........................WKK.........KIHDI
gi|213627368|gb|AAI71196|       ...EQQRFSV..ARAIPHPCF...E........................WKK.........KIHDI
gi|301622373|gb|XP_002940514|   ...AQTAVPV..QKIIYHSKY...R........................SST.........MANDI
gi|301623711|gb|XP_002941159|   ...QKQIIPI..IKKFQHEDF...R........................IET.........FDYDV
gi|301609058|gb|XP_002934098|   ...TEQTFQP..KNLILHPNY...K........................PRT.........FQFDI
gi|301607053|gb|XP_002933130|   ...QIATQMI..DQIVINPQY...N........................RRT.........KDSDI
gi|301620754|gb|XP_002939737|   ...EEVTVPV..KRIIKHHLY...N........................DTD.........FPYDI
gi|301631044|gb|XP_002944619|   ...XXXXXXX..XXXXXHPQW...N........................PNNla.......NGNDI
gi|301629851|gb|XP_002944046|   ...HKQYTYA..AKICPHEEF...D........................WST.........YNNDI
gi|301629862|gb|XP_002944051|   ...TEQHIQV..EAAYKHSSY...K........................DEA.........YDHDI
gi|301619787|gb|XP_002939269|   ...VTQTFEV..ERYIFYDKY...SvfkrnehdigdaxxxxxxxxxxxxX--.........-----
gi|301627058|gb|XP_002942695|   ...GQETIGV..IGLFNHPQW...N........................PNNla.......NGFDI
gi|301629849|gb|XP_002944045|   ...HIQYTYA..AKICPHCGF...N........................PIT.........YNDDI
gi|301626232|gb|XP_002942299|   ...QEQSIPV..SRIEPHPDY...R........................GGGk........MSYDI
gi|301609784|gb|XP_002934450|   ...STPFSET..EQIIIHPHY...T........................GAG.........NGTDI
gi|301631575|gb|XP_002944873|   ...TEKVYSV..KRIYRHERF...X........................XXX.........XX---
gi|301607830|gb|XP_002933508|   ...FAQTRLV..KKIILHPRY...N........................RAV.........VDYDI
gi|301620748|gb|XP_002939734|   ...QEIRVAV..MRIIVHPRY...D........................KYS.........SINDI
gi|301623709|gb|XP_002941155|   ...LRQQFKV..ARWVPHQKF...D........................RRS.........YVNNL
gi|301609490|gb|XP_002934300|   ...YEEDMTI..QQIIIHNDY...R........................PDG.........NDYDI
gi|301607063|gb|XP_002933142|   ...HKQVLNI..SQLVHGPK-...-........................---.........-GSNL
gi|116487755|gb|AAI25706|       styDAQIIDV..DE-------...-........................---.........-KADI
gi|134023797|gb|AAI35435|       styDAQIIDV..DE-------...-........................---.........-KADI
gi|350276152|ref|NP_001072730|  styDAQIIDV..DE-------...-........................---.........-KADI
gi|301620766|gb|XP_002939742|   ...------V..---------...-........................---.........-S---
gi|301609058|gb|XP_002934098|   ...TEQTFQP..KNLILHPNY...K........................PRT.........FQFDI
gi|301606403|gb|XP_002932829|   ...-------..---------...-........................DID.........QKLDI
gi|163915807|gb|AAI57677|       ...SQQKIGV..CEQIKPPEY...S........................TQR.........DEHDI
gi|166158294|ref|NP_001107513|  ...SQQKIGV..CEQIKPPEY...S........................TQR.........DEHDI
gi|213624433|gb|AAI71092|       ...SQQKIGV..CEQIKPPEY...S........................TQR.........DEHDI
gi|213625671|gb|AAI71088|       ...SQQKIGV..CEQIKPPEY...S........................TQR.........DEHDI
gi|301620338|gb|XP_002939538|   ...ETQIRKI..KEMIRHEHF...N........................KKE.........NKNDI
gi|301622789|gb|XP_002940709|   ...LVQEFRV..QESVQNPEY...N........................PTT.........FQNDI
gi|301603859|gb|XP_002931606|   ...SVQMRRI..KEVVQPKAY...N........................PTT.........EANDI
gi|301618560|gb|XP_002938688|   ...DSYEATI..K--------...-........................DID.........KKSDI
gi|49522408|gb|AAH75430|        ...SQQHLHI..SAVIVNPNY...D........................PIL.........LDSDI
gi|52345796|ref|NP_001004944|   ...SQQHLHI..SAVIVNPNY...D........................PIL.........LDSDI
gi|82183464|sp|Q6DIV5|          ...SQQHLHI..SAVIVNPNY...D........................PIL.........LDSDI
gi|301614097|gb|XP_002936534|   ...DANGYSV..ERIIVFPGY...N........................SSD.........NDNDI
gi|301624064|gb|XP_002941330|   ...-------..---------...-........................---.........-----
gi|301631613|gb|XP_002944892|   ...TEQHIQV..EAAYKHFGY...K........................DEA.........YDHDI
gi|301631166|gb|XP_002944677|   ...-------..--VFTHPQW...N........................SNT.........INNDI
gi|301614089|gb|XP_002936531|   ...DRQSVPI..SKIVCGPS-...-........................---.........-DSSL
gi|301623570|gb|XP_002941088|   ...TEQHIQV..EAAYKHFGY...K........................DEA.........YDHDI
gi|301618553|gb|XP_002938678|   ...PEKCFST..DAIIKHENFafpQ........................NND.........HSYDI
gi|169642095|gb|AAI60801|       ...-------..---------...-........................---.........-AADI
gi|288684101|ref|NP_001165762|  ...-------..---------...-........................---.........-AADI
gi|301627723|gb|XP_002943019|   ...-RQSYKA..KTIEIHNCY...Nisrkksknv...............NED.........YDYDV
gi|169642366|gb|AAI60557|       ...QRQMIRV..KTKQVHMRY...S........................EET.........GDNNI
gi|56789309|gb|AAH88065|        ...QRQMIRV..KTKQVHMRY...S........................EET.........GDNNI
gi|313851093|ref|NP_001116189|  ...QRQMIRV..KTKQVHMRY...S........................EET.........GDNNI
gi|301627727|gb|XP_002943021|   ...DGKEYPV..KQPYRHPKY...N........................PISkvdknikraFDYDV
gi|301620760|gb|XP_002939740|   ...-------..---------...-........................---.........-----
gi|301614097|gb|XP_002936534|   ...DANGYSV..ERIIVFPGY...N........................SSD.........NDNDI
gi|301632426|gb|XP_002945286|   ...-------..---------...-........................---.........-----
gi|301603859|gb|XP_002931606|   ...----ERI..KEVTQPKAY...N........................PMT.........EANDI
gi|169641896|gb|AAI60561|       ...RGKLLGV..KGIIYHSGY...L........................PF-.........-----
gi|187607137|ref|NP_001120287|  ...RGKLLGV..KGIIYHSGY...L........................PF-.........-----
gi|301613000|gb|XP_002936003|   ...GQVVFST..KE-------...-........................--S.........SPYDV
gi|301620752|gb|XP_002939736|   ...EEMAVSV..KNIYIHPNY...N........................DTD.........MTNDI
gi|301612998|gb|XP_002936002|   ...GQVVFST..---------...-........................KES.........SPYDV
gi|160774415|gb|AAI55421|       ...KFQWIRV..KRTHVPKGW...I........................KGNandig....MDYDY
gi|163915255|ref|NP_001106591|  ...KFQWIRV..KRTHVPKGW...I........................KGNandig....MDYDY
gi|301618176|gb|XP_002938505|   ...SFQWTRV..KAIQIPKGW...Yrdvsh...................NMS.........LDYDY
gi|301610794|gb|XP_002934945|   ...SLRWVRV..KSTRVPRRW...Igapa....................ELS.........MDYDY
gi|301630837|gb|XP_002944523|   ...-------..---------...-........................---.........-----
gi|163916178|gb|AAI57579|       ...-------..---------...-........................---.........-----
gi|166158059|ref|NP_001107438|  ...-------..---------...-........................---.........-----
gi|163915732|gb|AAI57581|       ...-------..---------...-........................---.........-----
gi|288684088|ref|NP_001165761|  ...-------..---------...-........................---.........-----
gi|163915698|gb|AAI57530|       ...-------..---------...-........................---.........-----
gi|166158009|ref|NP_001107414|  ...-------..---------...-........................---.........-----
gi|301618333|gb|XP_002938578|   ...-------..---------...-........................---.........-----
gi|49900216|gb|AAH76994|        ...-------..---------...-........................---.........-----
gi|52346064|ref|NP_001005075|   ...-------..---------...-........................---.........-----
gi|301612998|gb|XP_002936002|   ...-------..---------...-........................---.........YLHWF
gi|301613000|gb|XP_002936003|   ...-------..---------...-........................---.........YLHWF
gi|301630168|gb|XP_002944198|   ...-------..---------...-........................---.........-----
gi|301615558|gb|XP_002937233|   ...-------..---------...-........................---.........-----


                                           120         130             140                      150 
                                             |           |               |                        | 
d1a5ia_                           ALLQLKSDS..PQC.AQES.DSVRAICLPEANL......QLPDWTE...............CELSG
gi|62201369|gb|AAH93474|        ALIELEKP-..---.VTFT.PYILPVCLPPPAS......ELPAGTK...............CWVTG
gi|71895773|ref|NP_001025685|   ALIELEKP-..---.VTFT.PYILPVCLPPPAS......ELPAGTK...............CWVTG
gi|301620776|gb|XP_002939747|   ALIRLTSP-..---.IDYT.AYILPVCLPSASN......SFTDGME...............CWVTG
gi|45708911|gb|AAH67937|        ALIELEEP-..---.IVFT.PSIQPVCLPSQDV......PLPMGTM...............CWVTG
gi|47575768|ref|NP_001001228|   ALIELEEP-..---.IVFT.PSIQPVCLPSQDV......PLPMGTM...............CWVTG
gi|301620758|gb|XP_002939739|   TLVELSSD-..---.VNFT.NYIQPVCLPSAGV......NFPTGLQ...............CWVTG
gi|301623566|gb|XP_002941080|   MLIKLAEP-..---.AQFN.HYVQPIPLAHSC-......-PIKGTT...............CVVSG
gi|301620778|gb|XP_002939748|   ALMELETP-..---.VTFT.PYILPVCLPSQEV......QLAAGTM...............CWVTG
gi|49670651|gb|AAH75423|        MLIKLAEP-..---.AQFN.HHVQPIPLAHSC-......-PMKGTR...............CVVSG
gi|52345790|ref|NP_001004941|   MLIKLAEP-..---.AQFN.HHVQPIPLAHSC-......-PMKGTR...............CVVSG
gi|49522964|gb|AAH75293|        ALIRLTSP-..---.IDYT.AYILPVCLPSASN......SFTDGME...............CWVTG
gi|54020930|ref|NP_001005710|   ALIRLTSP-..---.IDYT.AYILPVCLPSASN......SFTDGME...............CWVTG
gi|59808136|gb|AAH89741|        MLIKLSTT-..---.ARLS.SNIQSVPLPSAC-......-ASAGTN...............CLISG
gi|62752849|ref|NP_001015792|   MLIKLSTT-..---.ARLS.SNIQSVPLPSAC-......-ASAGTN...............CLISG
gi|301621490|gb|XP_002940084|   AVLELDSP-..---.LKFN.KYTQPVCLPDPTH......VFPVGKK...............CIITG
gi|301628802|gb|XP_002943535|   MLIKLASP-..---.ASLN.SYVKAVSLPSSC-......-AAAGTS...............CLVSG
gi|111307978|gb|AAI21657|       ALLKLTTP-..---.VNYT.DYVVPLCLPEKQFavq...ELLSIRY...............STVSG
gi|118403542|ref|NP_001072819|  ALLKLTTP-..---.VNYT.DYVVPLCLPEKQFavq...ELLSIRY...............STVSG
gi|163916428|gb|AAI57199|       ALLKLTTP-..---.VNYT.DYVVPLCLPEKQFavq...ELLSIRY...............STVSG
gi|159155191|gb|AAI54713|       ALLLLHDF-..---.VTYS.DYIHPVCLGSVT-......VPDSLTA...............CFITG
gi|163915041|ref|NP_001106508|  ALLLLHDF-..---.VTYS.DYIHPVCLGSVT-......VPDSLTA...............CFITG
gi|301626232|gb|XP_002942299|   ALLYLEEP-..---.LEFN.DFLRPVCLPEPEE......ALTPTSL...............CVVTG
gi|169642526|gb|AAI60565|       ALLFLRSP-..---.AMFG.EYSRPICLPNPGLgkm...LTQEGQT...............GQVSG
gi|187607167|ref|NP_001120289|  ALLFLRSP-..---.AMFG.EYSRPICLPNPGLgkm...LTQEGQT...............GQVSG
gi|301620740|gb|XP_002939730|   SLVELSSR-..---.VNFT.KHIWPICLPASGV......IFPTGLQ...............CWVTG
gi|49522964|gb|AAH75293|        ALIRLTSP-..---.ITYT.KYILPVCLPSTSN......SFTDGME...............CWVTG
gi|54020930|ref|NP_001005710|   ALIRLTSP-..---.ITYT.KYILPVCLPSTSN......SFTDGME...............CWVTG
gi|56611173|gb|AAH87759|        MLIQLQEP-..---.AQLN.NEVQPIPLPTEC-......-PPVGSI...............CLISG
gi|58332122|ref|NP_001011209|   MLIQLQEP-..---.AQLN.NEVQPIPLPTEC-......-PPVGSI...............CLISG
gi|301620750|gb|XP_002939735|   ALLELATK-..---.VQMN.KVTLPVCLPDASV......TFPDGQK...............CSVTG
gi|301620756|gb|XP_002939738|   ALVELSSD-..---.VNYT.LYIQPVCLPSIGV......SLLTGLQ...............CWVTG
gi|301621490|gb|XP_002940084|   ALLELPSP-..---.LTYT.NLIRPICLPDISH......IFPEGTR...............CFITG
gi|301620768|gb|XP_002939743|   AMVEMESP-..---.VTYS.SYILPICIPLTNE......DFPSGKM...............CWVTG
gi|56541274|gb|AAH87610|        MLIKLASP-..---.ASLN.SAVNTVALPSSC-......-AAAGTS...............CLVSG
gi|58332100|ref|NP_001011202|   MLIKLASP-..---.ASLN.SAVNTVALPSSC-......-AAAGTS...............CLVSG
gi|58476395|gb|AAH89747|        ALIQLKRP-..---.VAFS.NYIHPVCLPTKDTvvk...LLAAGYK...............GRVTG
gi|62751950|ref|NP_001015797|   ALIQLKRP-..---.VAFS.NYIHPVCLPTKDTvvk...LLAAGYK...............GRVTG
gi|301623009|gb|XP_002940815|   ALIKLASP-..---.VTFT.DLIMPVCIPTPEV......VFPNGIN...............CTVTG
gi|301609429|gb|XP_002934284|   ALVLLDHLV..PLT.---S.PHVQPICLPSSTH......HFPTGSS...............CWVTG
gi|301628804|gb|XP_002943536|   MLIKLASP-..---.ASLN.SYVKAVSLPSSC-......-AAAGTS...............CLVSG
gi|301628800|gb|XP_002943534|   MLIKLSSA-..---.ASLN.SAVNAVALPSSC-......-AAAGTS...............CLISG
gi|301623523|gb|XP_002941065|   MLLKLVSP-..---.VTIN.DYVQTIPLGCPT-......-VGDGET...............CLVSG
gi|301614043|gb|XP_002936502|   ALLKLFTP-..---.LNFT.SIIRPVCLPEASD......IFPDGSS...............CYITG
gi|301620764|gb|XP_002939741|   SLVQLASP-..---.VTFT.DYILPVCLPADTV......TFPTGLQ...............CWVTG
gi|56611148|gb|AAH87751|        MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PREGTE...............CLVSG
gi|58332104|ref|NP_001011204|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PREGTE...............CLVSG
gi|89269870|gb|CAJ83405|        ALLKLTSP-..---.VAYT.EYILPVCVPSSAS......GFYEGMQ...............CWVTG
gi|166796549|gb|AAI58898|       ALLKLTSP-..---.VAYT.EYILPVCVPSSAS......GFYEGMQ...............CWVTG
gi|167908783|ref|NP_001016055|  ALLKLTSP-..---.VAYT.EYILPVCVPSSAS......GFYEGMQ...............CWVTG
gi|213627780|gb|AAI71053|       ALLKLTSP-..---.VAYT.EYILPVCVPSSAS......GFYEGMQ...............CWVTG
gi|301623529|gb|XP_002941068|   MLLKLASQ-..---.ADIN.TRVAPIPLASYL-......-VADNTE...............CLASG
gi|56611170|gb|AAH87830|        MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PREGTE...............CLVSG
gi|58332206|ref|NP_001011251|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PREGTE...............CLVSG
gi|58476361|gb|AAH89695|        ALLRLVQP-..---.VVYN.KYILPICLPSVDLaesn..LTMDDTV...............VAVTG
gi|62751546|ref|NP_001015759|   ALLRLVQP-..---.VVYN.KYILPICLPSVDLaesn..LTMDDTV...............VAVTG
gi|56270387|gb|AAH87611|        SLVQLASP-..---.VTFT.NYILPVCLPADTV......TFPTGLQ...............CWVTG
gi|58332094|ref|NP_001011195|   SLVQLASP-..---.VTFT.NYILPVCLPADTV......TFPTGLQ...............CWVTG
gi|301620770|gb|XP_002939744|   ALVELSST-..---.ITYT.TFILPVCVPSSSA......NFTAGME...............CWVTG
gi|301623525|gb|XP_002941066|   MLLKLASE-..---.ADIN.TWVAPIPLASYL-......-VDDNSE...............CLASG
gi|56541161|gb|AAH87563|        MLIKLSSA-..---.ASLN.AAVNAVALPSGC-......-AAAGAS...............CLISG
gi|58332102|ref|NP_001011199|   MLIKLSSA-..---.ASLN.AAVNAVALPSGC-......-AAAGAS...............CLISG
gi|56971223|gb|AAH88079|        MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|58332720|ref|NP_001011435|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|56556311|gb|AAH87753|        MLLKLASE-..---.ADIN.TRVAPIPLASYL-......-VADNTE...............CLASG
gi|301620774|gb|XP_002939746|   ALIRLTSP-..---.ITYT.KYILPICLPSTSD......GFTEGME...............CWVTG
gi|301621490|gb|XP_002940084|   AVLELASS-..---.LTFN.KYVQPVCLPSALQ......KFPAGWK...............CMISG
gi|301618335|gb|XP_002938574|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|301627387|gb|XP_002942851|   ALIKLSQP-..---.APLS.EAIQPACIPSSGA......ILANDFP...............CFVTG
gi|51895949|gb|AAH80976|        ALIKLSQP-..---.APLS.EAIQPACIPSSGA......ILANDFP...............CFVTG
gi|56118865|ref|NP_001008077|   ALIKLSQP-..---.APLS.EAIQPACIPSSGA......ILANDFP...............CFVTG
gi|301618337|gb|XP_002938575|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|301611781|gb|XP_002935401|   SLIKLATP-..---.AVLG.ATVAPVCLANIGE......DYEGGRI...............CVTSG
gi|56971185|gb|AAH88769|        TLLKLSST-..---.ASFN.SRVAPVCIPTSSE......VFNSPER...............CITTG
gi|58743375|ref|NP_001011477|   TLLKLSST-..---.ASFN.SRVAPVCIPTSSE......VFNSPER...............CITTG
gi|301611783|gb|XP_002935402|   SLIKLATP-..---.AVLG.ATVAPVCLANIGE......DYEGGRI...............CVTSG
gi|301606691|gb|XP_002932950|   ALMKMKQP-..---.FIFT.AAIQPACLPMMNQ......NFGQNDI...............CFISG
gi|57870463|gb|AAH89075|        TLLKLSSP-..---.ASFS.NIVAPVCVASSSD......AFNGGER...............CVTTG
gi|62751938|ref|NP_001015686|   TLLKLSSP-..---.ASFS.NIVAPVCVASSSD......AFNGGER...............CVTTG
gi|301610206|gb|XP_002934644|   ALIRLNYP-..---.VKFS.DYIQPACLPPKSS......NVYKMDD...............CHIAG
gi|159155760|gb|AAI54947|       MLLKLASQ-..---.ADIN.DRVAPIPLASYL-......-VADNTK...............CLASG
gi|301632763|gb|XP_002945450|   MLLKLASQ-..---.ADIN.DRVAPIPLASYL-......-VADNTK...............CLASG
gi|301623527|gb|XP_002941067|   MLLKLASQ-..---.ADIN.TRVAPIPLASYL-......-VADNTE...............CLASG
gi|56611133|gb|AAH87787|        ALLELEKP-..---.LELN.DYVRPVCIGNMDFtek...LLKRNAF...............SMVSG
gi|58332150|ref|NP_001011223|   ALLELEKP-..---.LELN.DYVRPVCIGNMDFtek...LLKRNAF...............SMVSG
gi|301620772|gb|XP_002939745|   ALIRPTSP-..---.ITYT.PYILPVCLPSTSN......SFPEGME...............CWVTG
gi|301614103|gb|XP_002936536|   ALMELSNE-..---.LTFG.YSIQPVCLPNSGM......FWEAGTT...............NWISG
gi|60552068|gb|AAH91088|        SLIKLEES-..---.VDFS.DTVQPACLPPAGY......ILPHQYG...............CYVTG
gi|301627389|gb|XP_002942852|   SLIKLEES-..---.VDFS.DTVQPACLPPAGY......ILPHQYG...............CYVTG
gi|301623007|gb|XP_002940814|   ALIKLANP-..---.VQFT.DYIIPVCIPTQNV......VFPDGMN...............CIVSG
gi|301612271|gb|XP_002935645|   ALVRLDEP-..---.ITFN.NYIQPACFPSKSI......KVEHMTK...............CQVAG
gi|301603857|gb|XP_002931605|   TLLRLDKP-..---.IVFT.DYVQPACFPTEFA......NVEKKTD...............CYIAG
gi|301615211|gb|XP_002937069|   GLILLDEP-..---.IKFN.DYTQRACLPSASL......NVAQKTN...............CYVAG
gi|301615213|gb|XP_002937070|   GLILLDEP-..---.IKFN.DYTQRACLPSASL......NVAQKTN...............CYVAG
gi|301603863|gb|XP_002931607|   TLLRLDKP-..---.IVFT.DYVQPACFPTEFA......NVEKKTD...............CYIAG
gi|301627010|gb|XP_002942670|   ALIRLPRP-..---.VQIS.DKVQLSCLPPAGE......LLPNNFS...............CYASG
gi|56972340|gb|AAH88057|        ALIRLSRP-..---.VQIS.DKVQLSCLPPAGE......LLPNNFS...............CYASG
gi|58332702|ref|NP_001011426|   ALIRLSRP-..---.VQIS.DKVQLSCLPPAGE......LLPNNFS...............CYASG
gi|39850054|gb|AAH64277|        SLIKLATP-..---.AVIG.ATVAPVCLANIGE......DYEGGRI...............CVTSG
gi|301615217|gb|XP_002937076|   GLILLDEP-..---.IKFN.DYTQRACLPSASL......NVAQKTN...............CYVAG
gi|301630725|gb|XP_002944467|   ALIRLNYP-..---.VKFS.DYIQPACLPPKSS......NVYKMDD...............CHIAG
gi|60552029|gb|AAH91010|        ALLKLYSTS..GSC.AKET.ESTRPACIPDSGL......TLPDWTE...............CEISG
gi|71896209|ref|NP_001025574|   ALLKLYSTS..GSC.AKET.ESTRPACIPDSGL......TLPDWTE...............CEISG
gi|301620748|gb|XP_002939734|   CLMELQTE-..---.LNFT.QYISPVCLPASGV......AFPTGLP...............CWVTG
gi|301615956|gb|XP_002937430|   LLLKLNDS-..---.VHFS.PAVRTIPLPAPNT......DVIPGTA...............CSVAG
gi|301622787|gb|XP_002940708|   HLLKLNDS-..---.AVIT.SGVRTIRLPVPNS......DVAPRSN...............CSVAG
gi|56789422|gb|AAH88038|        HLLKLNDS-..---.AVIT.SGVRTIRLPVPNS......DVAPRSN...............CSVAG
gi|56611135|gb|AAH87810|        ALIKLSRE-..---.AQLN.DKVQLGCIPPTGE......TLSHNQL...............CYVTG
gi|301624444|gb|XP_002941509|   ALIELEKP-..---.VDFT.TYITPLCLPPPTV......TFTPGQL...............CYVAG
gi|301615068|gb|XP_002937000|   ALVKVKSIN..GLCaSEFS.QFVQPICLPQQFK......MAESTKQ...............CVVAG
gi|301618415|gb|XP_002938616|   ALLKLTSP-..---.ALIS.DEVLPVCLPPVNY......VVPDRSE...............CYVTG
gi|301627689|gb|XP_002943002|   ALMKLKTS-..---.IAFS.SISRPVCLPNYGM......QWEEGQP...............CYISG
gi|58477045|gb|AAH89660|        AVIKLKEA-..---.INFT.ENIIPACIPDPEFadq...VLMNEPD...............AMVSG
gi|62751697|ref|NP_001015728|   AVIKLKEA-..---.INFT.ENIIPACIPDPEFadq...VLMNEPD...............AMVSG
gi|301622330|gb|XP_002940490|   ALVKPAED-..---.IITT.HFIHYACLPKKEM......AMHPGHF...............CWVTG
gi|301620762|gb|XP_002939724|   ALLQLSQN-..---.VPFT.RYILPVLLPTTST......VFLPGQS...............CVVTG
gi|301614101|gb|XP_002936535|   ALMKLTEEI..TFD.----.-----VCLPNAGM......FWEAGTP...............CWISG
gi|57032953|gb|AAH88892|        ALIELEKP-..---.VDFT.TYITPLCLPPPTV......TFTPGQL...............CYVAG
gi|301620357|gb|XP_002939545|   ALLKLKKIN..GRC.ATET.RYVKTACLPKQE-......-FKAGKP...............CVISG
gi|58477078|gb|AAH89729|        ALLKLKKIN..GRC.ATET.RYVKTACLPKQE-......-FKAGKP...............CVISG
gi|58476369|gb|AAH89702|        ALLQLSQN-..---.VPIT.RYIQPVCVPSAST......VFPPGQN...............CVVTG
gi|301624442|gb|XP_002941516|   CLIELSES-..---.VSYT.IHILPICLPAPSM......AFPSGTR...............CWTTG
gi|56585195|gb|AAH87729|        ALIKLSRP-..---.ALLN.DQVELGCVPPAGQ......ILPNDYP...............CYITG
gi|56971746|gb|AAH88036|        ALIKLSRP-..---.ALLN.DQVELGCVPPAGQ......ILPNDYP...............CYITG
gi|58332692|ref|NP_001011421|   ALIKLSRP-..---.ALLN.DQVELGCVPPAGQ......ILPNDYP...............CYITG
gi|301614099|gb|XP_002936522|   ALMKLTDK-..---.ITFN.YNTQPVCLPNAGM......FWEAGTQ...............CWISG
gi|301627056|gb|XP_002942694|   SLIKLAVE-..---.VNYS.DTIKPGCLPPAGY......ILPNQLG...............CYVTG
gi|301620744|gb|XP_002939732|   SILELDKE-..---.VNMT.NYIYPICVPVSGL......TFPEGQN...............CSVTG
gi|301627687|gb|XP_002943001|   ALLKLTAG-..---.LVFT.TNLRPVCLPNVGM......PWSGGQP...............CWISG
gi|301620752|gb|XP_002939736|   CLIELSES-..---.VSYT.IHILPICLPAPSM......AFPSGTR...............CWTTG
gi|301620760|gb|XP_002939740|   ALLQLSQN-..---.VPIT.RYIQPVCVPSAST......VFPPGQN...............CVVTG
gi|301614101|gb|XP_002936535|   ALMKLSNG-..---.ITFG.YNTQPVCLPNAGM......FWTAGTL...............CWISG
gi|301612617|gb|XP_002935812|   ALVRVQGKE..GHC.FPFS.LHVLPICLPEKKE......KTNNWQP...............CFISG
gi|57032843|gb|AAH88882|        SILHLSSS-..---.ATLN.SYVKLAQLPADNV......VLAHNYN...............CVVTG
gi|58332834|ref|NP_001011493|   SILHLSSS-..---.ATLN.SYVKLAQLPADNV......VLAHNYN...............CVVTG
gi|62531104|gb|AAH92553|        AVLHLASS-..---.ATLN.NYVRLAQLPADGV......VLANNHG...............CVVTG
gi|71895833|ref|NP_001025669|   AVLHLASS-..---.ATLN.NYVRLAQLPADGV......VLANNHG...............CVVTG
gi|113931254|ref|NP_001039074|  ALLQLKSD-..---.IVAS.ASVQPVCLPGYDN......NLVVGAV...............LYVTG
gi|89273918|gb|CAJ81839|        ALLQLKSD-..---.IVAS.ASVQPVCLPGYDN......NLVVGAV...............LYVTG
gi|301614097|gb|XP_002936534|   ALMKLTND-..---.IKFS.YTTQPVCLPNVGM......FWEAGTQ...............CWISG
gi|187469575|gb|AAI67128|       ALLYLASS-..---.ASLN.SNVQLASLPSNGA......ILAHNSP...............CIITG
gi|301608337|gb|XP_002933738|   ALLYLASS-..---.ASLN.SNVQLASLPSNGA......ILAHNSP...............CIITG
gi|62859195|ref|NP_001016980|   AVAALDSP-..---.ATFS.HVVQPISLPAANV......QFPIGMT...............CQVTG
gi|89272057|gb|CAJ83340|        AVAALDSP-..---.ATFS.HVVQPISLPAANV......QFPIGMT...............CQVTG
gi|134023759|gb|AAI35327|       ALVKLNEK-..---.VIMN.QYVMPVCLPELEHele...GPQPNTL...............GLVAG
gi|147901778|ref|NP_001090874|  ALVKLNEK-..---.VIMN.QYVMPVCLPELEHele...GPQPNTL...............GLVAG
gi|301608335|gb|XP_002933737|   AVLHLASS-..---.AALN.SYVQLANLPADGA......VLAHNYA...............CIITG
gi|161612048|gb|AAI56020|       AVLHLASS-..---.AALN.SYVQLANLPADGA......VLAHNYA...............CIITG
gi|56971188|gb|AAH88782|        AVLHLASS-..---.ATLN.TSVKLANLPADGA......ILAHNYG...............CIVTG
gi|58332812|ref|NP_001011481|   AVLHLASS-..---.ATLN.TSVKLANLPADGA......ILAHNYG...............CIVTG
gi|66990056|gb|AAH98090|        ALLEVKNIYsnPKC.MQTD.NNMVPACVPWSPF......QFRAGDT...............CTVSG
gi|73853846|ref|NP_001027508|   ALLEVKNIYsnPKC.MQTD.NNMVPACVPWSPF......QFRAGDT...............CTVSG
gi|54035177|gb|AAH84139|        ALIKLKNK-..---.VPLSeESILGICLPTKEKsyhishKDDDNHV...............GLVAG
gi|58332348|ref|NP_001011037|   ALIKLKNK-..---.VPLSeESILGICLPTKEKsyhishKDDDNHV...............GLVAG
gi|56789096|gb|AAH88027|        MLLKLTSK-..---.ATIN.RYVQTIPLPTSSS......DLPTGTP...............CSVSG
gi|353523845|ref|NP_001238808|  MLLKLTSK-..---.ATIN.RYVQTIPLPTSSS......DLPTGTP...............CSVSG
gi|301610620|gb|XP_002934851|   MLLKLTSK-..---.ATIN.RYVQTIPLPTSSS......DLPTGTP...............CSVSG
gi|301627008|gb|XP_002942673|   ALIKLSRE-..---.AQLN.DKVQLGCIPPTGE......TLSHNQL...............CFVTG
gi|39794386|gb|AAH64208|        LLLELSEK-..---.VTLS.PAVNPLPFQNENI......DISAGKR...............CLVAG
gi|45361487|ref|NP_989320|      LLLELSEK-..---.VTLS.PAVNPLPFQNENI......DISAGKR...............CLVAG
gi|82237461|sp|Q6P326|          LLLELSEK-..---.VTLS.PAVNPLPFQNENI......DISAGKR...............CLVAG
gi|301619167|gb|XP_002938973|   ALIQLNKP-..---.VQLN.DYVQPACLPMSSA......TLEPLTE...............CYLAG
gi|56789072|gb|AAH88011|        MLVKLAEP-..---.AQFN.QFVQPIKVASSC-......-PREGKV...............CQVSG
gi|58332288|ref|NP_001011293|   MLVKLAEP-..---.AQFN.QFVQPIKVASSC-......-PREGKV...............CQVSG
gi|113205726|ref|NP_001037931|  ALIQLDKQ-..---.VEFS.DHIQQACFPKESA......DLKDLID...............CSIAG
gi|89266985|gb|CAJ81306|        ALIQLDKQ-..---.VEFS.DHIQQACFPKESA......DLKDLID...............CSIAG
gi|301619169|gb|XP_002938974|   ALVQLNEA-..---.VQFS.DRIQPACLPSSSA......KLEPLTE...............CYMAG
gi|301623913|gb|XP_002941253|   ALVQLTKK-..---.VKLG.SCISPICLPRRGL......APVVNEV...............ATIAG
gi|163915777|gb|AAI57637|       ALIKLDKP-..---.VTQS.DAVKPVKFQRDETa.....DPKEAAV...............VETAG
gi|166158186|ref|NP_001107486|  ALIKLDKP-..---.VTQS.DAVKPVKFQRDETa.....DPKEAAV...............VETAG
gi|301626232|gb|XP_002942299|   LLLELDTP-..---.LHLN.NSVAVICLPDGV-......TDWTHSE...............CLVAG
gi|66396569|gb|AAH96515|        ALIRLKNP-..---.IVMN.QNVSPICLPSPQDedd...IYQKDRI...............GYVSG
gi|301623915|gb|XP_002941259|   ALIRLKNP-..---.IVMN.QNVSPICLPSPQDedd...IYQKDRI...............GYVSG
gi|66396598|gb|AAH96508|        ALVQLTKK-..---.VKLG.SCISPICLPRRGL......APVVNEV...............AIIAG
gi|301618553|gb|XP_002938678|   ALVKIDGE-..---.VAAS.DVIDFACLPPYDE......VLNPNYR...............CHATG
gi|301619614|gb|XP_002939175|   ALLKTTVP-..---.MSFS.DTTRPVCLPRAYQ......QFQVTAN...............CWIIG
gi|301623919|gb|XP_002941255|   ALIQLKNP-..---.VVMS.QGVSPICLPSPEDedd...IYQNGRK...............GYASG
gi|301623917|gb|XP_002941260|   ALIRLKNP-..---.VVMN.QNVSPICLPSPQDedd...IYQKDRI...............GYVSG
gi|49899920|gb|AAH76933|        VILKLDRP-..---.VSLN.GKVQVVSLPSANE......DVPAGTQ...............CVTAG
gi|55742037|ref|NP_001006847|   VILKLDRP-..---.VSLN.GKVQVVSLPSANE......DVPAGTQ...............CVTAG
gi|163915656|gb|AAI57668|       QLLQIKGA-..---.AKLN.KFVSVLKLPTTDM......DVKPGSS...............CSTAG
gi|165973394|ref|NP_001107158|  QLLQIKGA-..---.AKLN.KFVSVLKLPTTDM......DVKPGSS...............CSTAG
gi|213627368|gb|AAI71196|       QLLQIKGA-..---.AKLN.KFVSVLKLPTTDM......DVKPGSS...............CSTAG
gi|301622373|gb|XP_002940514|   ALIRLASP-..---.FTFN.GSIQPICLPNYRE......DFPEGKI...............CWISG
gi|301623711|gb|XP_002941159|   QLLQLSKA-..---.AVLG.SDVSVLPLSVKRK......KLQPGTV...............CETAG
gi|301609058|gb|XP_002934098|   ALVELSDK-..---.AFLN.DYVMPICLPEKQ-......-VQQGLLhnclrllfeivcyeyVIVSG
gi|301607053|gb|XP_002933130|   VMMHLQFK-..---.VNYS.DYIQPICLPETDQ......EFSVGIN...............CSIAG
gi|301620754|gb|XP_002939737|   ALLELSRN-..---.VPFT.DFILPACLPTASV......EFLPGHS...............CVVTG
gi|301631044|gb|XP_002944619|   SLLKLERE-..---.VDYS.DTIKPGCLPPAGY......ILPNQFG...............CYVTG
gi|301629851|gb|XP_002944046|   MLLKLASQ-..---.ADIN.TRVAPIPLASYL-......-VADNTE...............CLASG
gi|301629862|gb|XP_002944051|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PREGTE...............CLVSG
gi|301619787|gb|XP_002939269|   --------X..XXX.AKKT.QFVQXICLPDVSA......PFADDHH...............CQIAG
gi|301627058|gb|XP_002942695|   SLLKLERE-..---.VDYS.DTIKPGCLPPAGY......ILPNQFG...............CYVTG
gi|301629849|gb|XP_002944045|   MLLKLASE-..---.ANIN.ASVAIIPLASYM-......-VADNTE...............CLASG
gi|301626232|gb|XP_002942299|   ALIFLAKP-..---.IVFG.SQVQPICLPQVGE......KLEIGTL...............CVSSG
gi|301609784|gb|XP_002934450|   ALLKLKTP-..---.ISFN.DHQKAICLPPREP......TFVLPNS...............CWITG
gi|301631575|gb|XP_002944873|   ---------..---.X---.----XXXXXXXXX......XLETGGQ...............G----
gi|301607830|gb|XP_002933508|   SIVELNED-..---.ITET.SYVRPVCLPTKGQ......LVEPDTY...............CYITG
gi|301620748|gb|XP_002939734|   SLLELENE-..---.VVLT.DAIIPVCLPTAAV......TFPTGLK...............CWATG
gi|301623709|gb|XP_002941155|   QLLQLSSK-..---.ANFS.YAVNILLLPTKYK......DIKPGTV...............CETAG
gi|301609490|gb|XP_002934300|   ALIRLHGTA..EQC.VQLS.THVLPACLPLRREr.....PQKTASN...............CYITG
gi|301607063|gb|XP_002933142|   VLLKLSRP-..---.ATLN.AYVDRIKLPNYGC......TIPENTM...............CSVYG
gi|116487755|gb|AAI25706|       ALIKIKAK-..---.----.-GKLPVLLLGRSE......DLRPGEF...............VVAIG
gi|134023797|gb|AAI35435|       ALIKIKAK-..---.----.-GKLPVLLLGRSE......DLRPGEF...............VVAIG
gi|350276152|ref|NP_001072730|  ALIKIKAK-..---.----.-GKLPVLLLGRSE......DLRPGEF...............VVAIG
gi|301620766|gb|XP_002939742|   ---------..---.----.-------------......-------...............-----
gi|301609058|gb|XP_002934098|   ALVELSDK-..---.AFLN.DYVMPICLPEKQ-......-VQQDEY...............VIVSG
gi|301606403|gb|XP_002932829|   ALIKIDPD-..---.----.-APLPVLMLGRSA......DLRPGEF...............VVALG
gi|163915807|gb|AAI57677|       MLLKLMKK-..---.AVPN.QYVLPIRPRQSGP......KLEPHNL...............CNVAG
gi|166158294|ref|NP_001107513|  MLLKLMKK-..---.AVPN.QYVLPIRPRQSGP......KLEPHNL...............CNVAG
gi|213624433|gb|AAI71092|       MLLKLMKK-..---.AVPN.QYVLPIRPRQSGP......KLEPHNL...............CNVAG
gi|213625671|gb|AAI71088|       MLLKLMKK-..---.AVPN.QYVLPIRPRQSGP......KLEPHNL...............CNVAG
gi|301620338|gb|XP_002939538|   ALIYLDRP-..---.VAFS.DYIQPACLPQQSS......DITRMND...............CYIAG
gi|301622789|gb|XP_002940709|   HLLKLNDS-..---.AVIT.SGVRTIRLPVPNS......DVAPRSN...............CSVAG
gi|301603859|gb|XP_002931606|   TLLRLDKL-..---.IVFT.DYVQPACFPTEFA......NVEKKTD...............CYIAG
gi|301618560|gb|XP_002938688|   ATIKIYPR-..---.----.-KKLPVLLLGHSA......DLRPGEF...............VVAIG
gi|49522408|gb|AAH75430|        AVIKLLDK-..---.ARVS.DYVQPVCLTLATEmi....TSPQEYT...............IVISG
gi|52345796|ref|NP_001004944|   AVIKLLDK-..---.ARVS.DYVQPVCLTLATEmi....TSPQEYT...............IVISG
gi|82183464|sp|Q6DIV5|          AVIKLLDK-..---.ARVS.DYVQPVCLTLATEmi....TSPQEYT...............IVISG
gi|301614097|gb|XP_002936534|   ALMKLTNE-..---.ITFS.YTPSRCAYPMPE-......--CSGRP...............AH---
gi|301624064|gb|XP_002941330|   ----LSNG-..---.ITFG.YNTQPVCLPNAGM......FWSSGTP...............CWISG
gi|301631613|gb|XP_002944892|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|301631166|gb|XP_002944677|   SLIKLATP-..---.AVIG.ATVAPVCLANIGE......DYEGGRI...............CVTSG
gi|301614089|gb|XP_002936531|   VMLKLERX-..---.----.--IAIHCRRLRT-......-------...............-----
gi|301623570|gb|XP_002941088|   MLVKLAKP-..---.AQYN.QYVQPIPVARSC-......-PTDGAK...............CLVSG
gi|301618553|gb|XP_002938678|   ALMHISEK-..---.VT--.-EVQPACLPASTK......FLPAGEL...............CYWAG
gi|169642095|gb|AAI60801|       ATIKINVK-..---.----.-NPLPALRLGKSS......DVRQGEF...............VVAMG
gi|288684101|ref|NP_001165762|  ATIKINVK-..---.----.-NPLPALRLGKSS......DVRQGEF...............VVAMG
gi|301627723|gb|XP_002943019|   ALVQLKEN-..---.VKFS.KEARPICIPCTE-......-PANRAM...............KRVKG
gi|169642366|gb|AAI60557|       ALLKLKEK-..---.IVFH.NNSLPICIPQKDFaen...VLVPFNT...............GLVSG
gi|56789309|gb|AAH88065|        ALLKLKEK-..---.IVFH.NNSLPICIPQKDFaen...VLVPFNT...............GLVSG
gi|313851093|ref|NP_001116189|  ALLKLKEK-..---.IVFH.NNSLPICIPQKDFaen...VLVPFNT...............GLVSG
gi|301627727|gb|XP_002943021|   ELLELQKK-..---.IEFS.VTARPICIPCTQS......-------...............-----
gi|301620760|gb|XP_002939740|   ---------..---.----.-------------......-------...............-----
gi|301614097|gb|XP_002936534|   ALMKLTNE-..---.ITFS.-------------......-------...............-----
gi|301632426|gb|XP_002945286|   ---------..---.----.-------------......-------...............-----
gi|301603859|gb|XP_002931606|   TLLRLDKP-..---.IVFT.DYVQPACFPEEF-......-------...............-----
gi|169641896|gb|AAI60561|       ----L----..---.----.-------------......-------...............-----
gi|187607137|ref|NP_001120287|  ----L----..---.----.-------------......-------...............-----
gi|301613000|gb|XP_002936003|   AVVELKDSI..P--.----.----GIPEPVLAS......EYCTGMD...............VLIWG
gi|301620752|gb|XP_002939736|   GLAELTQN-..---.VSFT.SYVIPLVHMTSS-......LWLVLVL...............VQANG
gi|301612998|gb|XP_002936002|   AVVELKDSI..P--.----.----GIPEPVLAS......EYCTGMD...............VLIWG
gi|160774415|gb|AAI55421|       ALLELKKPH..KRK.----.--FMMIGVSPSG-......RQLPSGR...............IHFSG
gi|163915255|ref|NP_001106591|  ALLELKKPH..KRK.----.--FMMIGVSPSG-......RQLPSGR...............IHFSG
gi|301618176|gb|XP_002938505|   AVLELKRPH..KKK.----.-YMELGISPEAD-......-KMPGSR...............VHFSG
gi|301610794|gb|XP_002934945|   ALLELRRPQ..SQP.----.-HMSLAVSPPLQ-......-NLAGGR...............VHFSG
gi|301630837|gb|XP_002944523|   ---------..---.----.-------------......-------...............-----
gi|163916178|gb|AAI57579|       ---------..---.----.-------------......-------...............-----
gi|166158059|ref|NP_001107438|  ---------..---.----.-------------......-------...............-----
gi|163915732|gb|AAI57581|       ---------..---.----.-------------......-------...............-----
gi|288684088|ref|NP_001165761|  ---------..---.----.-------------......-------...............-----
gi|163915698|gb|AAI57530|       ---------..---.----.-------------......-------...............-----
gi|166158009|ref|NP_001107414|  ---------..---.----.-------------......-------...............-----
gi|301618333|gb|XP_002938578|   ---------..---.----.-------------......-------...............-----
gi|49900216|gb|AAH76994|        ---------..---.----.-------------......-------...............-----
gi|52346064|ref|NP_001005075|   ---------..---.----.-------------......-------...............-----
gi|301612998|gb|XP_002936002|   ALLKLRSP-..---.--LS.DRHKKITFVPSS-......MLEKGCT...............VIACG
gi|301613000|gb|XP_002936003|   ALLKLRSP-..---.--LS.DRHKKITFVPSS-......MLEKGCT...............VIACG
gi|301630168|gb|XP_002944198|   ---------..---.----.-------------......-------...............-----
gi|301615558|gb|XP_002937233|   ---------..---.----.-------------......-------...............-----


                                            160                                                     
                                              |                                                     
d1a5ia_                           YGKHKSSS....P.....................................................
gi|62201369|gb|AAH93474|        WGDIKEGQd...L.....................................................
gi|71895773|ref|NP_001025685|   WGDIKEGQd...L.....................................................
gi|301620776|gb|XP_002939747|   WGKTAFNVn...L.....................................................
gi|45708911|gb|AAH67937|        WGNIKENTp...L.....................................................
gi|47575768|ref|NP_001001228|   WGNIKENTp...L.....................................................
gi|301620758|gb|XP_002939739|   WGNIASNVs...L.....................................................
gi|301623566|gb|XP_002941080|   YGNMRPGFf...G.....................................................
gi|301620778|gb|XP_002939748|   WGDTQEGIp...L.....................................................
gi|49670651|gb|AAH75423|        YGNMRPGFf...G.....................................................
gi|52345790|ref|NP_001004941|   YGNMRPGFf...G.....................................................
gi|49522964|gb|AAH75293|        WGKTAFNVn...L.....................................................
gi|54020930|ref|NP_001005710|   WGKTAFNVn...L.....................................................
gi|59808136|gb|AAH89741|        WGNTLSSG....T.....................................................
gi|62752849|ref|NP_001015792|   WGNTLSSG....T.....................................................
gi|301621490|gb|XP_002940084|   WGYLKEDN....L.....................................................
gi|301628802|gb|XP_002943535|   WGNTSASG....S.....................................................
gi|111307978|gb|AAI21657|       WGRLLESG....-.....................................................
gi|118403542|ref|NP_001072819|  WGRLLESG....-.....................................................
gi|163916428|gb|AAI57199|       WGRLLESG....-.....................................................
gi|159155191|gb|AAI54713|       WGVTKEKG....-.....................................................
gi|163915041|ref|NP_001106508|  WGVTKEKG....-.....................................................
gi|301626232|gb|XP_002942299|   WGNTAEGG....-.....................................................
gi|169642526|gb|AAI60565|       WGATRQFG....-.....................................................
gi|187607167|ref|NP_001120289|  WGATRQFG....-.....................................................
gi|301620740|gb|XP_002939730|   WGQIKGGLn...Q.....................................................
gi|49522964|gb|AAH75293|        WGTISLYVn...L.....................................................
gi|54020930|ref|NP_001005710|   WGTISLYVn...L.....................................................
gi|56611173|gb|AAH87759|        WGNTLSNG....V.....................................................
gi|58332122|ref|NP_001011209|   WGNTLSNG....V.....................................................
gi|301620750|gb|XP_002939735|   WGQIMDGAd...P.....................................................
gi|301620756|gb|XP_002939738|   WGNIASNVs...L.....................................................
gi|301621490|gb|XP_002940084|   WGSTKEGG....-.....................................................
gi|301620768|gb|XP_002939743|   WGNIQSDVs...L.....................................................
gi|56541274|gb|AAH87610|        WGNLSTTT....S.....................................................
gi|58332100|ref|NP_001011202|   WGNLSTTT....S.....................................................
gi|58476395|gb|AAH89747|        WGNLQETWtsgaQ.....................................................
gi|62751950|ref|NP_001015797|   WGNLQETWtsgaQ.....................................................
gi|301623009|gb|XP_002940815|   WGTIRYLVn...L.....................................................
gi|301609429|gb|XP_002934284|   WGSVKENG....-.....................................................
gi|301628804|gb|XP_002943536|   WGNXXXXS....A.....................................................
gi|301628800|gb|XP_002943534|   WGNTSASG....S.....................................................
gi|301623523|gb|XP_002941065|   WGTTTSPE....E.....................................................
gi|301614043|gb|XP_002936502|   WGALTDGG....-.....................................................
gi|301620764|gb|XP_002939741|   WGNIASDTn...L.....................................................
gi|56611148|gb|AAH87751|        YGNMRSDNi...G.....................................................
gi|58332104|ref|NP_001011204|   YGNMRSDNi...G.....................................................
gi|89269870|gb|CAJ83405|        WGNIGSAVt...L.....................................................
gi|166796549|gb|AAI58898|       WGNIGSAVt...L.....................................................
gi|167908783|ref|NP_001016055|  WGNIGSAVt...L.....................................................
gi|213627780|gb|AAI71053|       WGNIGSAVt...L.....................................................
gi|301623529|gb|XP_002941068|   WGSTTSPE....E.....................................................
gi|56611170|gb|AAH87830|        YGNLRSDHi...G.....................................................
gi|58332206|ref|NP_001011251|   YGNLRSDHi...G.....................................................
gi|58476361|gb|AAH89695|        WGREDETA....L.....................................................
gi|62751546|ref|NP_001015759|   WGREDETA....L.....................................................
gi|56270387|gb|AAH87611|        WGNIASDVs...L.....................................................
gi|58332094|ref|NP_001011195|   WGNIASDVs...L.....................................................
gi|301620770|gb|XP_002939744|   WGNIGWGAk...L.....................................................
gi|301623525|gb|XP_002941066|   WGSTTSPE....E.....................................................
gi|56541161|gb|AAH87563|        WGNTLSSG....S.....................................................
gi|58332102|ref|NP_001011199|   WGNTLSSG....S.....................................................
gi|56971223|gb|AAH88079|        YGNVLGYN....T.....................................................
gi|58332720|ref|NP_001011435|   YGNVLGYN....T.....................................................
gi|56556311|gb|AAH87753|        WGSTTSPQ....E.....................................................
gi|301620774|gb|XP_002939746|   WGTIASQVn...L.....................................................
gi|301621490|gb|XP_002940084|   WGNIKEGN....V.....................................................
gi|301618335|gb|XP_002938574|   YGNVLGYN....T.....................................................
gi|301627387|gb|XP_002942851|   WGRLYTNG....-.....................................................
gi|51895949|gb|AAH80976|        WGRLYTNG....-.....................................................
gi|56118865|ref|NP_001008077|   WGRLYTNG....-.....................................................
gi|301618337|gb|XP_002938575|   FGNVLGYN....V.....................................................
gi|301611781|gb|XP_002935401|   WGKTRYNA....F.....................................................
gi|56971185|gb|AAH88769|        WGYVDAYS....K.....................................................
gi|58743375|ref|NP_001011477|   WGYVDAYS....K.....................................................
gi|301611783|gb|XP_002935402|   WGKTRYNA....F.....................................................
gi|301606691|gb|XP_002932950|   FGKTIQSS....D.....................................................
gi|57870463|gb|AAH89075|        WGYVDAAS....R.....................................................
gi|62751938|ref|NP_001015686|   WGYVDAAS....R.....................................................
gi|301610206|gb|XP_002934644|   WGLLNEKP....R.....................................................
gi|159155760|gb|AAI54947|       WGSTTSPQ....E.....................................................
gi|301632763|gb|XP_002945450|   WGSTTSPQ....E.....................................................
gi|301623527|gb|XP_002941067|   WGSTTSPQ....E.....................................................
gi|56611133|gb|AAH87787|        WGDLGYKG....-.....................................................
gi|58332150|ref|NP_001011223|   WGDLGYKG....-.....................................................
gi|301620772|gb|XP_002939745|   WGTTAFQVn...L.....................................................
gi|301614103|gb|XP_002936536|   WGSTYEGG....-.....................................................
gi|60552068|gb|AAH91088|        WGNIRTGG....-.....................................................
gi|301627389|gb|XP_002942852|   WGNIRTGG....-.....................................................
gi|301623007|gb|XP_002940814|   WGTINQQVs...L.....................................................
gi|301612271|gb|XP_002935645|   WGVLSEKS....K.....................................................
gi|301603857|gb|XP_002931605|   WGVLDEES....G.....................................................
gi|301615211|gb|XP_002937069|   WGVLEEKE....I.....................................................
gi|301615213|gb|XP_002937070|   WGVLEEKE....I.....................................................
gi|301603863|gb|XP_002931607|   WGVLDEES....G.....................................................
gi|301627010|gb|XP_002942670|   WGRLYTGG....-.....................................................
gi|56972340|gb|AAH88057|        WGRLYTGG....-.....................................................
gi|58332702|ref|NP_001011426|   WGRLYTGG....-.....................................................
gi|39850054|gb|AAH64277|        WGKTRYNA....F.....................................................
gi|301615217|gb|XP_002937076|   WGVLEEKE....I.....................................................
gi|301630725|gb|XP_002944467|   WGLLNEKP....R.....................................................
gi|60552029|gb|AAH91010|        YGKHEELA....L.....................................................
gi|71896209|ref|NP_001025574|   YGKHEELA....L.....................................................
gi|301620748|gb|XP_002939734|   WGNIARNVs...L.....................................................
gi|301615956|gb|XP_002937430|   WGLTSDSG....-.....................................................
gi|301622787|gb|XP_002940708|   WGDINDFG....-.....................................................
gi|56789422|gb|AAH88038|        WGDINDFG....-.....................................................
gi|56611135|gb|AAH87810|        WGRLTSTG....-.....................................................
gi|301624444|gb|XP_002941509|   WGQKKFNDs...E.....................................................
gi|301615068|gb|XP_002937000|   WGHQYEGA....E.....................................................
gi|301618415|gb|XP_002938616|   WGETQGT-....-.....................................................
gi|301627689|gb|XP_002943002|   WGTTSQKG....-.....................................................
gi|58477045|gb|AAH89660|        FGRIHERG....-.....................................................
gi|62751697|ref|NP_001015728|   FGRIHERG....-.....................................................
gi|301622330|gb|XP_002940490|   WGDTRGGQgn..V.....................................................
gi|301620762|gb|XP_002939724|   WGYLELNKt...K.....................................................
gi|301614101|gb|XP_002936535|   WGTTSEGG....-.....................................................
gi|57032953|gb|AAH88892|        WGQKKFNDs...E.....................................................
gi|301620357|gb|XP_002939545|   WGKTETE-....-.....................................................
gi|58477078|gb|AAH89729|        WGKTETE-....-.....................................................
gi|58476369|gb|AAH89702|        WGDIELSVi...P.....................................................
gi|301624442|gb|XP_002941516|   WGDVEYGGy...Q.....................................................
gi|56585195|gb|AAH87729|        WGRLTTGG....-.....................................................
gi|56971746|gb|AAH88036|        WGRLTTGG....-.....................................................
gi|58332692|ref|NP_001011421|   WGRLTTGG....-.....................................................
gi|301614099|gb|XP_002936522|   WGTTAQGD....-.....................................................
gi|301627056|gb|XP_002942694|   WGYLQTSG....-.....................................................
gi|301620744|gb|XP_002939732|   WGDISFGTn...L.....................................................
gi|301627687|gb|XP_002943001|   WGTTSSGG....-.....................................................
gi|301620752|gb|XP_002939736|   WGDVEYGGy...Q.....................................................
gi|301620760|gb|XP_002939740|   WGDIELSVi...P.....................................................
gi|301614101|gb|XP_002936535|   WGTTYHGG....-.....................................................
gi|301612617|gb|XP_002935812|   WGDTGTS-....-.....................................................
gi|57032843|gb|AAH88882|        WGKTSNNG....-.....................................................
gi|58332834|ref|NP_001011493|   WGKTSNNG....-.....................................................
gi|62531104|gb|AAH92553|        WGRTSTGG....-.....................................................
gi|71895833|ref|NP_001025669|   WGRTSTGG....-.....................................................
gi|113931254|ref|NP_001039074|  WGHTVEGG....A.....................................................
gi|89273918|gb|CAJ81839|        WGHTVEGG....A.....................................................
gi|301614097|gb|XP_002936534|   WNTTSQGG....-.....................................................
gi|187469575|gb|AAI67128|       WGRTVTNG....-.....................................................
gi|301608337|gb|XP_002933738|   WGRTVTNG....-.....................................................
gi|62859195|ref|NP_001016980|   WGNIQQGVn...L.....................................................
gi|89272057|gb|CAJ83340|        WGNIQQGVn...L.....................................................
gi|134023759|gb|AAI35327|       WGISNPNI....Tvdeiissdmr...........................................
gi|147901778|ref|NP_001090874|  WGISNPNI....Tvdeiissdmr...........................................
gi|301608335|gb|XP_002933737|   WGKTSNNG....-.....................................................
gi|161612048|gb|AAI56020|       WGKTSNNG....-.....................................................
gi|56971188|gb|AAH88782|        WGRTSTGG....-.....................................................
gi|58332812|ref|NP_001011481|   WGRTSTGG....-.....................................................
gi|66990056|gb|AAH98090|        WGREKGM-....-.....................................................
gi|73853846|ref|NP_001027508|   WGREKGM-....-.....................................................
gi|54035177|gb|AAH84139|        WGLTEAQ-....-.....................................................
gi|58332348|ref|NP_001011037|   WGLTEAQ-....-.....................................................
gi|56789096|gb|AAH88027|        WGLIDRD-....-.....................................................
gi|353523845|ref|NP_001238808|  WGLIDRD-....-.....................................................
gi|301610620|gb|XP_002934851|   WGLIDRD-....-.....................................................
gi|301627008|gb|XP_002942673|   WGRLTSGG....-.....................................................
gi|39794386|gb|AAH64208|        WGQMRLTG....-.....................................................
gi|45361487|ref|NP_989320|      WGQMRLTG....-.....................................................
gi|82237461|sp|Q6P326|          WGQMRLTG....-.....................................................
gi|301619167|gb|XP_002938973|   WGVRDEGD....-.....................................................
gi|56789072|gb|AAH88011|        FGNLNSYA....E.....................................................
gi|58332288|ref|NP_001011293|   FGNLNSYA....E.....................................................
gi|113205726|ref|NP_001037931|  WGAQGKHL....D.....................................................
gi|89266985|gb|CAJ81306|        WGAQGKHL....D.....................................................
gi|301619169|gb|XP_002938974|   WGVEEEGE....-.....................................................
gi|301623913|gb|XP_002941253|   WGKTEKR-....-.....................................................
gi|163915777|gb|AAI57637|       WGSLNNMG....-.....................................................
gi|166158186|ref|NP_001107486|  WGSLNNMG....-.....................................................
gi|301626232|gb|XP_002942299|   WGITNVEG....M.....................................................
gi|66396569|gb|AAH96515|        YGVNENR-....-.....................................................
gi|301623915|gb|XP_002941259|   YGVNENR-....-.....................................................
gi|66396598|gb|AAH96508|        WGKTEKR-....-.....................................................
gi|301618553|gb|XP_002938678|   WGDETGNSaa..P.....................................................
gi|301619614|gb|XP_002939175|   WGHVSEGG....-.....................................................
gi|301623919|gb|XP_002941255|   YGVTEKH-....-.....................................................
gi|301623917|gb|XP_002941260|   YGVTEKR-....-.....................................................
gi|49899920|gb|AAH76933|        WGRLSTEG....-.....................................................
gi|55742037|ref|NP_001006847|   WGRLSTEG....-.....................................................
gi|163915656|gb|AAI57668|       WGVTKPNG....K.....................................................
gi|165973394|ref|NP_001107158|  WGVTKPNG....K.....................................................
gi|213627368|gb|AAI71196|       WGVTKPNG....K.....................................................
gi|301622373|gb|XP_002940514|   WGATEEGG....-.....................................................
gi|301623711|gb|XP_002941159|   WGTTTNHR....N.....................................................
gi|301609058|gb|XP_002934098|   WGKQFLK-....-.....................................................
gi|301607053|gb|XP_002933130|   WGRTQSGG....-.....................................................
gi|301620754|gb|XP_002939737|   WGDTEDNTt...K.....................................................
gi|301631044|gb|XP_002944619|   WGYLQTEG....-.....................................................
gi|301629851|gb|XP_002944046|   WGSTTSPQ....E.....................................................
gi|301629862|gb|XP_002944051|   YGNLRSDHi...G.....................................................
gi|301619787|gb|XP_002939269|   WGRMHEDS....T.....................................................
gi|301627058|gb|XP_002942695|   WGYLQTEG....-.....................................................
gi|301629849|gb|XP_002944045|   WGSTTSPE....E.....................................................
gi|301626232|gb|XP_002942299|   WGRLEESKwvl.R.....................................................
gi|301609784|gb|XP_002934450|   WGFTEESG....-.....................................................
gi|301631575|gb|XP_002944873|   -------N....V.....................................................
gi|301607830|gb|XP_002933508|   WGHMGNKM....-.....................................................
gi|301620748|gb|XP_002939734|   WGAILPGVp...L.....................................................
gi|301623709|gb|XP_002941155|   WGITAYNG....K.....................................................
gi|301609490|gb|XP_002934300|   WGDTGRA-....-.....................................................
gi|301607063|gb|XP_002933142|   WGHTGTN-....-.....................................................
gi|116487755|gb|AAI25706|       --------....-.....................................................
gi|134023797|gb|AAI35435|       --------....-.....................................................
gi|350276152|ref|NP_001072730|  --------....-.....................................................
gi|301620766|gb|XP_002939742|   --RDFAAN....L.....................................................
gi|301609058|gb|XP_002934098|   WGKQFLK-....-.....................................................
gi|301606403|gb|XP_002932829|   --------....-.....................................................
gi|163915807|gb|AAI57677|       WGRINTFN....D.....................................................
gi|166158294|ref|NP_001107513|  WGRINTFN....D.....................................................
gi|213624433|gb|AAI71092|       WGRINTFN....D.....................................................
gi|213625671|gb|AAI71088|       WGRINTFN....D.....................................................
gi|301620338|gb|XP_002939538|   WGLVDDYF....R.....................................................
gi|301622789|gb|XP_002940709|   WGDINDFG....-.....................................................
gi|301603859|gb|XP_002931606|   WGVLDEEFkfs.G.....................................................
gi|301618560|gb|XP_002938688|   --------....-.....................................................
gi|49522408|gb|AAH75430|        WKILSDPRap..G.....................................................
gi|52345796|ref|NP_001004944|   WKILSDPRap..G.....................................................
gi|82183464|sp|Q6DIV5|          WKILSDPRap..G.....................................................
gi|301614097|gb|XP_002936534|   --------....-.....................................................
gi|301624064|gb|XP_002941330|   WGTTSQGG....-.....................................................
gi|301631613|gb|XP_002944892|   YGN-----....-.....................................................
gi|301631166|gb|XP_002944677|   WGKTRYNA....F.....................................................
gi|301614089|gb|XP_002936531|   --------....-.....................................................
gi|301623570|gb|XP_002941088|   YGN-----....-.....................................................
gi|301618553|gb|XP_002938678|   WAASSKGGak..F.....................................................
gi|169642095|gb|AAI60801|       SPFSLKN-....-.....................................................
gi|288684101|ref|NP_001165762|  SPFSLKN-....-.....................................................
gi|301627723|gb|XP_002943019|   STCKDHRE....Qlmgvsqipagylsknnkneliekrvf...........................
gi|169642366|gb|AAI60557|       WKSSSEEE....A.....................................................
gi|56789309|gb|AAH88065|        WKSSSEEE....A.....................................................
gi|313851093|ref|NP_001116189|  WKSSSEEE....A.....................................................
gi|301627727|gb|XP_002943021|   --------....-.....................................................
gi|301620760|gb|XP_002939740|   --------....-.....................................................
gi|301614097|gb|XP_002936534|   --------....-.....................................................
gi|301632426|gb|XP_002945286|   --------....-.....................................................
gi|301603859|gb|XP_002931606|   --------....-.....................................................
gi|169641896|gb|AAI60561|       --------....-.....................................................
gi|187607137|ref|NP_001120287|  --------....-.....................................................
gi|301613000|gb|XP_002936003|   YGAFGESC....G.....................................................
gi|301620752|gb|XP_002939736|   YTLVKPIT....Kvylklmswlelgvgkggtclgnnwlretpldgsdqqekkrrraevivvvvrqg
gi|301612998|gb|XP_002936002|   YGAFGESC....G.....................................................
gi|160774415|gb|AAI55421|       YDNDRPGH....L.....................................................
gi|163915255|ref|NP_001106591|  YDNDRPGH....L.....................................................
gi|301618176|gb|XP_002938505|   FDEDRPGQ....L.....................................................
gi|301610794|gb|XP_002934945|   FDNDRPGE....L.....................................................
gi|301630837|gb|XP_002944523|   --------....-.....................................................
gi|163916178|gb|AAI57579|       --------....-.....................................................
gi|166158059|ref|NP_001107438|  --------....-.....................................................
gi|163915732|gb|AAI57581|       --------....-.....................................................
gi|288684088|ref|NP_001165761|  --------....-.....................................................
gi|163915698|gb|AAI57530|       --------....-.....................................................
gi|166158009|ref|NP_001107414|  --------....-.....................................................
gi|301618333|gb|XP_002938578|   --------....-.....................................................
gi|49900216|gb|AAH76994|        --------....-.....................................................
gi|52346064|ref|NP_001005075|   --------....-.....................................................
gi|301612998|gb|XP_002936002|   SPFGSFY-....-.....................................................
gi|301613000|gb|XP_002936003|   SPFGSFY-....-.....................................................
gi|301630168|gb|XP_002944198|   --------....-.....................................................
gi|301615558|gb|XP_002937233|   --------....-.....................................................


                                                           170       180                            
                                                             |         |                            
d1a5ia_                           ..................FYSEQLKEGHVRLYPSSRCAPKF.........................
gi|62201369|gb|AAH93474|        ..................SNPKTLQKASVKLIDWNSCEPMYettfgyk..................
gi|71895773|ref|NP_001025685|   ..................SNPKTLQKASVKLIDWNSCEPMYettfgyk..................
gi|301620776|gb|XP_002939747|   ..................PFPGTLQEVMTPLISRATCDQMY.........................
gi|45708911|gb|AAH67937|        ..................EDPQTLQKAEVGLINRTSCEAMY.........................
gi|47575768|ref|NP_001001228|   ..................EDPQTLQKAEVGLINRTSCEAMY.........................
gi|301620758|gb|XP_002939739|   ..................RDPNTLQQVAVPLIGNQQCNSIL.........................
gi|301623566|gb|XP_002941080|   ..................EFPDRLQCLDLPVLPEDSCKSSY.........................
gi|301620778|gb|XP_002939748|   ..................SNPKTLQMAEVGIISSSSCEDMYessfgys..................
gi|49670651|gb|AAH75423|        ..................EFPDRLQCLDLPVLPEDSCKSSY.........................
gi|52345790|ref|NP_001004941|   ..................EFPDRLQCLDLPVLPEDSCKSSY.........................
gi|49522964|gb|AAH75293|        ..................PFPGTLQEVMTPLINRTRCDQMY.........................
gi|54020930|ref|NP_001005710|   ..................PFPGTLQEVMTPLINRTRCDQMY.........................
gi|59808136|gb|AAH89741|        ..................NYPDLLQCLNAPILTASECSNSY.........................
gi|62752849|ref|NP_001015792|   ..................NYPDLLQCLNAPILTASECSNSY.........................
gi|301621490|gb|XP_002940084|   ..................VKPEVLQKATVAIMDQSLCNSLY.........................
gi|301628802|gb|XP_002943535|   ..................NYPNLLQCLNAPILTTAQCSSAY.........................
gi|111307978|gb|AAI21657|       ..................ATPELLQRVQLPRVKTQDCIRQT.........................
gi|118403542|ref|NP_001072819|  ..................ATPELLQRVQLPRVKTQDCIRQT.........................
gi|163916428|gb|AAI57199|       ..................ATPELLQRVQLPRVKTQDCIRQT.........................
gi|159155191|gb|AAI54713|       ..................SISVILQEALVQTIPYSECNSSS.........................
gi|163915041|ref|NP_001106508|  ..................SISVILQEALVQTIPYSECNSSS.........................
gi|301626232|gb|XP_002942299|   ..................QPALRLQQLHLPILDSKICNESY.........................
gi|169642526|gb|AAI60565|       ..................PYTRFLLKVRLPIVSQETCMAST.........................
gi|187607167|ref|NP_001120289|  ..................PYTRFLLKVRLPIVSQETCMAST.........................
gi|301620740|gb|XP_002939730|   ..................SLVEILQEVAVPLIDSEKCNQLY.........................
gi|49522964|gb|AAH75293|        ..................PYPKTLQEVMTPLINRTRCDQMY.........................
gi|54020930|ref|NP_001005710|   ..................PYPKTLQEVMTPLINRTRCDQMY.........................
gi|56611173|gb|AAH87759|        ..................NYPDLLQCIEAPILSDQECRQSY.........................
gi|58332122|ref|NP_001011209|   ..................NYPDLLQCIEAPILSDQECRQSY.........................
gi|301620750|gb|XP_002939735|   ..................PSPRVLREVEVKMMSNDRCNTLF.........................
gi|301620756|gb|XP_002939738|   ..................PEPNTLQELAVPLIDNQQCNTLL.........................
gi|301621490|gb|XP_002940084|   ..................AMSRQLQKASVSIVGDQTCKKFY.........................
gi|301620768|gb|XP_002939743|   ..................SPPYPLQEVEVPLVNASSCDTMY.........................
gi|56541274|gb|AAH87610|        ..................NYPDLLQCLNAPILTTAQCSGAY.........................
gi|58332100|ref|NP_001011202|   ..................NYPDLLQCLNAPILTTAQCSGAY.........................
gi|58476395|gb|AAH89747|        ..................NLPQALQQINLPIVDQETCKSST.........................
gi|62751950|ref|NP_001015797|   ..................NLPQALQQINLPIVDQETCKSST.........................
gi|301623009|gb|XP_002940815|   ..................PYPRTLQKVQVPIIERTTCDQLY.........................
gi|301609429|gb|XP_002934284|   ..................PTSDVLQKVDIQLVAQDICTELY.........................
gi|301628804|gb|XP_002943536|   ..................NYPNLLQCLNAPILTTAQCSSAY.........................
gi|301628800|gb|XP_002943534|   ..................NYPNLLQCLNAPILTTAQCSGAY.........................
gi|301623523|gb|XP_002941065|   ..................TFPDELQCVEVQTVSQDYCQGAF.........................
gi|301614043|gb|XP_002936502|   ..................SASQVLQQAEVKIINSDTCSSSQ.........................
gi|301620764|gb|XP_002939741|   ..................PSPKTLQEVAVPLIDANKCNTLY.........................
gi|56611148|gb|AAH87751|        ..................EFPDRLQCVDVPVLSDSSCKASY.........................
gi|58332104|ref|NP_001011204|   ..................EFPDRLQCVDVPVLSDSSCKASY.........................
gi|89269870|gb|CAJ83405|        ..................PYPQTLQQVMTPLISWSTCNQMY.........................
gi|166796549|gb|AAI58898|       ..................PYPQTLQQVMTPLISWSTCNQMY.........................
gi|167908783|ref|NP_001016055|  ..................PYPQTLQQVMTPLISWSTCNQMY.........................
gi|213627780|gb|AAI71053|       ..................PYPQTLQQVMTPLISWSTCNQMY.........................
gi|301623529|gb|XP_002941068|   ..................TYPDNLQCVNVTTVSNSDCQACY.........................
gi|56611170|gb|AAH87830|        ..................EFPDRLQCVDVPVLSDSSCKASC.........................
gi|58332206|ref|NP_001011251|   ..................EFPDRLQCVDVPVLSDSSCKASC.........................
gi|58476361|gb|AAH89695|        ..................NYSSVLSYIQIPIAPRNQCAETL.........................
gi|62751546|ref|NP_001015759|   ..................NYSSVLSYIQIPIAPRNQCAETL.........................
gi|56270387|gb|AAH87611|        ..................VSPMTLQEVAVPLIDANECNALY.........................
gi|58332094|ref|NP_001011195|   ..................VSPMTLQEVAVPLIDANECNALY.........................
gi|301620770|gb|XP_002939744|   ..................PYPQTLQQVMTPLISRDSCEQMY.........................
gi|301623525|gb|XP_002941066|   ..................TYPGELQCVNITTVSNSDCQDYY.........................
gi|56541161|gb|AAH87563|        ..................NYPDLLQCLYAPILTDAQCNNAY.........................
gi|58332102|ref|NP_001011199|   ..................NYPDLLQCLYAPILTDAQCNNAY.........................
gi|56971223|gb|AAH88079|        ..................RYPDQLQCLDVPIVSDSSCKASY.........................
gi|58332720|ref|NP_001011435|   ..................RYPDQLQCLDVPIVSDSSCKASY.........................
gi|56556311|gb|AAH87753|        ..................TYPDNLQCVNVTTVSNSDCQACY.........................
gi|301620774|gb|XP_002939746|   ..................PYPMTLQQVMTPLISRATCNQMY.........................
gi|301621490|gb|XP_002940084|   ..................SKPEVLQKASVGIIDQKICSVLY.........................
gi|301618335|gb|XP_002938574|   ..................RYPDQLQCLEVPIVSDSSCKASY.........................
gi|301627387|gb|XP_002942851|   ..................PIADNLQQALLPVVDHATCTLRD.........................
gi|51895949|gb|AAH80976|        ..................PIADNLQQALLPVVDHATCTLRD.........................
gi|56118865|ref|NP_001008077|   ..................PIADNLQQALLPVVDHATCTLRD.........................
gi|301618337|gb|XP_002938575|   ..................RYPDQLQCLEVPIVSDSSCKASY.........................
gi|301611781|gb|XP_002935401|   ..................TTPNLLQQTALPLLTNDQCKSYW.........................
gi|56971185|gb|AAH88769|        ..................LSPNKLQQVTLPLLSNTECQRYW.........................
gi|58743375|ref|NP_001011477|   ..................LSPNKLQQVTLPLLSNTECQRYW.........................
gi|301611783|gb|XP_002935402|   ..................TTPNLLQQTALPLLTNDQCKSYW.........................
gi|301606691|gb|XP_002932950|   ..................EGSQYLMQAQVHVIPTSVCNKVN.........................
gi|57870463|gb|AAH89075|        ..................LTPNKLQQVALPLLSNTECQRYW.........................
gi|62751938|ref|NP_001015686|   ..................LTPNKLQQVALPLLSNTECQRYW.........................
gi|301610206|gb|XP_002934644|   ..................TVTTMLQEATVELIDRKRCNSSD.........................
gi|159155760|gb|AAI54947|       ..................TYPDNLKCVSITTASNSVCQASY.........................
gi|301632763|gb|XP_002945450|   ..................TYPDNLKCVSITTASNSVCQASY.........................
gi|301623527|gb|XP_002941067|   ..................TYPDNLKCVNITTVSNSVCQACY.........................
gi|56611133|gb|AAH87787|        ..................RPAVILQKLAVPYINQAACKKSS.........................
gi|58332150|ref|NP_001011223|   ..................RPAVILQKLAVPYINQAACKKSS.........................
gi|301620772|gb|XP_002939745|   ..................PYPQTLQQVMTPLISRTSCDQMY.........................
gi|301614103|gb|XP_002936536|   ..................SASTYLRYAAVPLIDSNVCNKTY.........................
gi|60552068|gb|AAH91088|        ..................PEPDILQQGLLLVVDYATCSQWD.........................
gi|301627389|gb|XP_002942852|   ..................PEPDILQQGLLLVVDYATCSQWD.........................
gi|301623007|gb|XP_002940814|   ..................PYPKTLQKVRVPIIGRASCDQMYhinnptlp.................
gi|301612271|gb|XP_002935645|   ..................ESADILQEASVTLIPNTLCNSKD.........................
gi|301603857|gb|XP_002931605|   ..................EPSEILQEARVHQIDSKKCNSKD.........................
gi|301615211|gb|XP_002937069|   ..................AAADILQEAGVFFINKELCNSKE.........................
gi|301615213|gb|XP_002937070|   ..................AAADILQEAGVFFINKELCNSKE.........................
gi|301603863|gb|XP_002931607|   ..................EPSEILQEARVHQIDSKKCNSKD.........................
gi|301627010|gb|XP_002942670|   ..................PYPDILQQALLPVVDYDHCTQRD.........................
gi|56972340|gb|AAH88057|        ..................PYPDILQQALLPVVDYDHCSQRD.........................
gi|58332702|ref|NP_001011426|   ..................PYPDILQQALLPVVDYDHCSQRD.........................
gi|39850054|gb|AAH64277|        ..................TTPNQLQQTALPLLTNDQCKSYW.........................
gi|301615217|gb|XP_002937076|   ..................AAADILQEAGVFFINKELCNSKE.........................
gi|301630725|gb|XP_002944467|   ..................TVTTMLQEATVELIDRKRCNSSD.........................
gi|60552029|gb|AAH91010|        ..................LYSEQLKEGHVRLYPDSMCTPER.........................
gi|71896209|ref|NP_001025574|   ..................LYSEQLKEGHVRLYPDSMCTPER.........................
gi|301620748|gb|XP_002939734|   ..................PPPKTLQEVLVPLIGAQVCKSYY.........................
gi|301615956|gb|XP_002937430|   ..................TRPFALMEADVDVISRMSCNKTW.........................
gi|301622787|gb|XP_002940708|   ..................TSPRALMQTNADIISRQACNRSW.........................
gi|56789422|gb|AAH88038|        ..................TSPRALMQTNADIISRQACNRSW.........................
gi|56611135|gb|AAH87810|        ..................PYPDILQQADLPVVGISVCTRSD.........................
gi|301624444|gb|XP_002941509|   ..................GISDVLRGAEVRLITSELCQDYY.........................
gi|301615068|gb|XP_002937000|   ..................HYAFFLQEASMPIIPYTQCQSPS.........................
gi|301618415|gb|XP_002938616|   ..................GKEGVLKEAGIPVIENKLCNSPE.........................
gi|301627689|gb|XP_002943002|   ..................SISSVLKYAMVPLISPTTCNQTI.........................
gi|58477045|gb|AAH89660|        ..................RQASTLQMLQVPYIKRHSCKESS.........................
gi|62751697|ref|NP_001015728|   ..................RQASTLQMLQVPYIKRHSCKESS.........................
gi|301622330|gb|XP_002940490|   ..................TLSEVLNQARLPIIDTKTCRHKK.........................
gi|301620762|gb|XP_002939724|   ..................PKPVNLQEAEVRLMSAEQCRGYY.........................
gi|301614101|gb|XP_002936535|   ..................NVSASLKYAEVPLIDSKTCNESL.........................
gi|57032953|gb|AAH88892|        ..................GISDVLRGAEVRLITSELCQDYY.........................
gi|301620357|gb|XP_002939545|   ..................DSPSQLLEATVQLISEANCSQPK.........................
gi|58477078|gb|AAH89729|        ..................DSPSQLLEATVQLISEANCSQPK.........................
gi|58476369|gb|AAH89702|        ..................QRPVVLQETQVRLMSTEQCKSYY.........................
gi|301624442|gb|XP_002941516|   ..................PRPNTLQEVELQLFSDQQCKNAY.........................
gi|56585195|gb|AAH87729|        ..................NLPDILQQALMPVVDHKTCTQRD.........................
gi|56971746|gb|AAH88036|        ..................NLPDILQQALMPVVDHKTCTQRD.........................
gi|58332692|ref|NP_001011421|   ..................NLPDILQQALMPVVDHKTCTQRD.........................
gi|301614099|gb|XP_002936522|   ..................NIARTLQYAEVQLVPSHVCNQSH.........................
gi|301627056|gb|XP_002942694|   ..................PPSEKLQQGLLQVVDYPTCSQPD.........................
gi|301620744|gb|XP_002939732|   ..................PDPRTLQEVTLPLIAANKCNKSY.........................
gi|301627687|gb|XP_002943001|   ..................SIATTLMAASVPLISSTTCNQAA.........................
gi|301620752|gb|XP_002939736|   ..................PRPNTLQEVELQLFSDQQCKNAY.........................
gi|301620760|gb|XP_002939740|   ..................QRPVVLQETQVRLMSTEQCKSYY.........................
gi|301614101|gb|XP_002936535|   ..................TVSTSLNYAAVPLIDSNVCKYHD.........................
gi|301612617|gb|XP_002935812|   ..................-YSRTLLQGAVSVLPKDTCILRY.........................
gi|57032843|gb|AAH88882|        ..................NLASVLQQAPLPVIAHSTCSSGS.........................
gi|58332834|ref|NP_001011493|   ..................NLASVLQQAPLPVIAHSTCSSGS.........................
gi|62531104|gb|AAH92553|        ..................SLAAILQQAPLSVVAHSTCSSSS.........................
gi|71895833|ref|NP_001025669|   ..................SLAAILQQAPLSVVAHSTCSSSS.........................
gi|113931254|ref|NP_001039074|  ..................ALASQLQEVAISLISSTTCNQEY.........................
gi|89273918|gb|CAJ81839|        ..................ALASQLQEVAISLISSTTCNQEY.........................
gi|301614097|gb|XP_002936534|   ..................NISTTLQYAEVQLVPSHVCNQSH.........................
gi|187469575|gb|AAI67128|       ..................PLPAILQQAPLPSVAHATCSTSS.........................
gi|301608337|gb|XP_002933738|   ..................PLPAILQQAPLPSVAHATCSTSS.........................
gi|62859195|ref|NP_001016980|   ..................PGAKNLQVGNVKLIGRQTCNCLY.........................
gi|89272057|gb|CAJ83340|        ..................PGAKNLQVGNVKLIGRQTCNCLY.........................
gi|134023759|gb|AAI35327|       ..................THSAILQYVKLPVVLHEVCKESY.........................
gi|147901778|ref|NP_001090874|  ..................THSAILQYVKLPVVLHEVCKESY.........................
gi|301608335|gb|XP_002933737|   ..................SVASVLQQAPLPVVAHATCSTGS.........................
gi|161612048|gb|AAI56020|       ..................SVASVLQQAPLPVVAHATCSTGS.........................
gi|56971188|gb|AAH88782|        ..................ALASVLQQAPLSVVQHSTCSSSS.........................
gi|58332812|ref|NP_001011481|   ..................ALASVLQQAPLSVVQHSTCSSSS.........................
gi|66990056|gb|AAH98090|        ..................SRVFHLKWGHINLMNN--CSEVY.........................
gi|73853846|ref|NP_001027508|   ..................SRVFHLKWGHINLMNN--CSEVY.........................
gi|54035177|gb|AAH84139|        ..................RSSRKLRFVEVNIVDHSTCKAEY.........................
gi|58332348|ref|NP_001011037|   ..................RSSRKLRFVEVNIVDHSTCKAEY.........................
gi|56789096|gb|AAH88027|        ..................EVTDKLFETNVTIVSRRLCHRYF.........................
gi|353523845|ref|NP_001238808|  ..................EVTDKLFETNVTIVSRRLCHRYF.........................
gi|301610620|gb|XP_002934851|   ..................EVTDKLFETNVTIVSRRLCHRYF.........................
gi|301627008|gb|XP_002942673|   ..................PIPDILQQALLPVVDHNHCTQRD.........................
gi|39794386|gb|AAH64208|        ..................KKPDTLQELWVPLISRDVCNRRN.........................
gi|45361487|ref|NP_989320|      ..................KKPDTLQELWVPLISRDVCNRRN.........................
gi|82237461|sp|Q6P326|          ..................KKPDTLQELWVPLISRDVCNRRN.........................
gi|301619167|gb|XP_002938973|   ..................EPVAIMQEVKVERINSKRCNKTY.........................
gi|56789072|gb|AAH88011|        ..................KYPDRLQCLDLPILPESSCDAYF.........................
gi|58332288|ref|NP_001011293|   ..................KYPDRLQCLDLPILPESSCDAYF.........................
gi|113205726|ref|NP_001037931|  ..................EPSQFLQEAQVERIDTKHCNKWY.........................
gi|89266985|gb|CAJ81306|        ..................EPSQFLQEAQVERIDTKHCNKWY.........................
gi|301619169|gb|XP_002938974|   ..................ESVAIMQEAKVKRIDNKNCNITY.........................
gi|301623913|gb|XP_002941253|   ..................ESAVNLQFASISLSSMDKCKKAT.........................
gi|163915777|gb|AAI57637|       ..................GRPDKLHELSIPVMERWRCGRAD.........................
gi|166158186|ref|NP_001107486|  ..................GRPDKLHELSIPVMERWRCGRAD.........................
gi|301626232|gb|XP_002942299|   ..................IFPTQLQQAKVPIVSIKKCKNYW.........................
gi|66396569|gb|AAH96515|        ..................DIPNELRYVSVPMASRQDCKAYL.........................
gi|301623915|gb|XP_002941259|   ..................DIPNELRYVSVPMASRQDCKTYL.........................
gi|66396598|gb|AAH96508|        ..................ESAVNLQFASISLSSMDKCKKAT.........................
gi|301618553|gb|XP_002938678|   ..................KVAESLNQVVLPVIPYETCKTPQ.........................
gi|301619614|gb|XP_002939175|   ..................QLSPVLQEAKVQLISSQICNHSS.........................
gi|301623919|gb|XP_002941255|   ..................TIANELRYVYVPVASWQDCETYVdgkkksikdhtn.............
gi|301623917|gb|XP_002941260|   ..................NIAKELRYVSVPVASRQDCETYLdrkkqenp.................
gi|49899920|gb|AAH76933|        ..................QIPDRLQELNVTVTRQNLCR---.........................
gi|55742037|ref|NP_001006847|   ..................QIPDRLQELNVTVTRQNLCR---.........................
gi|163915656|gb|AAI57668|       ..................TPSDVLREVNVTVVDRGTCNKIY.........................
gi|165973394|ref|NP_001107158|  ..................TPSDVLREVNVTVVDRGTCNKIY.........................
gi|213627368|gb|AAI71196|       ..................TPSDVLREVNVTVVDRGTCNKIY.........................
gi|301622373|gb|XP_002940514|   ..................DTSQTMDYAGVPLISNRVCNTKY.........................
gi|301623711|gb|XP_002941159|   ..................IISDKLMEVNVTIVDTKTCAKRW.........................
gi|301609058|gb|XP_002934098|   ..................RLPESLMEIEIPVVNHALCKTVY.........................
gi|301607053|gb|XP_002933130|   ..................PVPNILQEAEIPLISNHKCQQQM.........................
gi|301620754|gb|XP_002939737|   ..................PRPDILQEVEVRLLSLEHCRDLY.........................
gi|301631044|gb|XP_002944619|   ..................PPSATLQQGRLQIVDYATCRRLD.........................
gi|301629851|gb|XP_002944046|   ..................TYPDNLKCVNITTVSNSVCQACY.........................
gi|301629862|gb|XP_002944051|   ..................EFPDRLQCVDVPVLSDSSCKASC.........................
gi|301619787|gb|XP_002939269|   ..................EYAQNLQEAIVPLVPDNKCSSPE.........................
gi|301627058|gb|XP_002942695|   ..................PPSATLQQGLLKIVDYATCRRLD.........................
gi|301629849|gb|XP_002944045|   ..................TYPDKLQCVNITTVSNSDCQDYY.........................
gi|301626232|gb|XP_002942299|   ..................LIYPLLXMIRILAVTEGFCAHIK.........................
gi|301609784|gb|XP_002934450|   ..................SLSNILQKAEVPPISTEECQGNY.........................
gi|301631575|gb|XP_002944873|   ..................TLSEVLNQARLPIIDTKTCRHKK.........................
gi|301607830|gb|XP_002933508|   ..................--PFKLQEGEVRIISLERCQSYF.........................
gi|301620748|gb|XP_002939734|   ..................PNPKILQEVALPMIDSQTCSQYF.........................
gi|301623709|gb|XP_002941155|   ..................QQSDKLMEVSLTVLDRMQCNNQW.........................
gi|301609490|gb|XP_002934300|   ..................-YSRTLQQATVTLLPKRVCEERY.........................
gi|301607063|gb|XP_002933142|   ..................DYDGQLQEGTLHIVGNEKCNEHH.........................
gi|116487755|gb|AAI25706|       ..................SPFSLQNTVTTGIVSTAQRGGKE.........................
gi|134023797|gb|AAI35435|       ..................SPFSLQNTVTTGIVSTAQRGGKE.........................
gi|350276152|ref|NP_001072730|  ..................SPFSLQNTVTTGIVSTAQRGGKE.........................
gi|301620766|gb|XP_002939742|   ..................PSPMTLQEVAVPLIGADQCNTLY.........................
gi|301609058|gb|XP_002934098|   ..................RLPESLMEIEIPVVNHALCKTVY.........................
gi|301606403|gb|XP_002932829|   ..................SPFSLQNTVTTGIISTTQRGGKE.........................
gi|163915807|gb|AAI57677|       ..................KMASKLQELNMTIVAPDECAKAF.........................
gi|166158294|ref|NP_001107513|  ..................KMASKLQELNMTIVAPDECAKAF.........................
gi|213624433|gb|AAI71092|       ..................KMASKLQELNMTIVAPDECAKAF.........................
gi|213625671|gb|AAI71088|       ..................KMASKLQELNMTIVAPDECAKAF.........................
gi|301620338|gb|XP_002939538|   ..................IRTDVLQEAKTELIANSRCNQSD.........................
gi|301622789|gb|XP_002940709|   ..................TSPRALMQTNADIISRQACNRSW.........................
gi|301603859|gb|XP_002931606|   ..................EPSELLQEARVHQIDSNKCNSKD.........................
gi|301618560|gb|XP_002938688|   ..................SPFALQNTVTTGIVSTAQRDGKE.........................
gi|49522408|gb|AAH75430|        ..................SKNETIRAGAIEPVDSLQCEQQYeen......................
gi|52345796|ref|NP_001004944|   ..................SKNETIRAGAIEPVDSLQCEQQYeen......................
gi|82183464|sp|Q6DIV5|          ..................SKNETIRAGAIEPVDSLQCEQQYeen......................
gi|301614097|gb|XP_002936534|   ..................-----------------------.........................
gi|301624064|gb|XP_002941330|   ..................SASTYLQYAAVQLIDSNVCNQNY.........................
gi|301631613|gb|XP_002944892|   ..................-----------------------.........................
gi|301631166|gb|XP_002944677|   ..................TTPNQLQQTALPLLTNDQCKSYW.........................
gi|301614089|gb|XP_002936531|   ..................GHDNVLKIAIFHIISNDECNKNY.........................
gi|301623570|gb|XP_002941088|   ..................-----------------------.........................
gi|301618553|gb|XP_002938678|   ..................ANTKEKFQVPIPILSYETCSQPK.........................
gi|169642095|gb|AAI60801|       ..................-------TITSGIVSSAQRGSKE.........................
gi|288684101|ref|NP_001165762|  ..................-------TITSGIVSSAQRGSKE.........................
gi|301627723|gb|XP_002943019|   ..................I---------KTNKDREACVASVqkwpkfehi................
gi|169642366|gb|AAI60557|       ..................DALIPIQFYTKYTNRTEVCEQSL.........................
gi|56789309|gb|AAH88065|        ..................DALIPIQFYTKYTNRTEVCEQSL.........................
gi|313851093|ref|NP_001116189|  ..................DALIPIQFYTKYTNRTEVCEQSL.........................
gi|301627727|gb|XP_002943021|   ..................-TAQVLKVPGAPCSSHEKALLSEeevkaifiaeesknpleqknviikr
gi|301620760|gb|XP_002939740|   ..................--PNTLQEVAVPLIGNQQCNALF.........................
gi|301614097|gb|XP_002936534|   ..................-----------------------.........................
gi|301632426|gb|XP_002945286|   ..................----------APILTDAQCNNAY.........................
gi|301603859|gb|XP_002931606|   ..................-----------------------.........................
gi|169641896|gb|AAI60561|       ..................-----------------------.........................
gi|187607137|ref|NP_001120287|  ..................-----------------------.........................
gi|301613000|gb|XP_002936003|   ..................PSAT-------------------.........................
gi|301620752|gb|XP_002939736|   sglasvpillglalviasLSPNTLQEVQMRILSAEQCRSYY.........................
gi|301612998|gb|XP_002936002|   ..................PSAT-------------------.........................
gi|160774415|gb|AAI55421|       ..................VY---------------------.........................
gi|163915255|ref|NP_001106591|  ..................VY---------------------.........................
gi|301618176|gb|XP_002938505|   ..................VY---------------------.........................
gi|301610794|gb|XP_002934945|   ..................VY---------------------.........................
gi|301630837|gb|XP_002944523|   ..................-----------------------.........................
gi|163916178|gb|AAI57579|       ..................-----------------------.........................
gi|166158059|ref|NP_001107438|  ..................-----------------------.........................
gi|163915732|gb|AAI57581|       ..................-----------------------.........................
gi|288684088|ref|NP_001165761|  ..................-----------------------.........................
gi|163915698|gb|AAI57530|       ..................-----------------------.........................
gi|166158009|ref|NP_001107414|  ..................-----------------------.........................
gi|301618333|gb|XP_002938578|   ..................-----------------------.........................
gi|49900216|gb|AAH76994|        ..................-----------------------.........................
gi|52346064|ref|NP_001005075|   ..................-----------------------.........................
gi|301612998|gb|XP_002936002|   ..................-PDIFLNSISKGIIS--------.........................
gi|301613000|gb|XP_002936003|   ..................-PDIFLNSISKGIIS--------.........................
gi|301630168|gb|XP_002944198|   ..................-----------------------.........................
gi|301615558|gb|XP_002937233|   ..................-----------------------.........................


                                                                      190       200       210       
                                                                        |         |         |       
d1a5ia_                           .....................LF...........NKTVTNNMLCAGDTRSGEIYPNVHD..ACQGD
gi|62201369|gb|AAH93474|        .....................PS...........VPFIMDDMFCAGYKEGQ------ID..ACQGD
gi|71895773|ref|NP_001025685|   .....................PS...........VPFIMDDMFCAGYKEGQ------ID..ACQGD
gi|301620776|gb|XP_002939747|   .....................HIdspvsas....SEIIPSDQICSGYSDGG------KD..SCKGD
gi|45708911|gb|AAH67937|        .....................QSslgyrps....IHLIQDDMICAGYKQGK------ID..ACQGD
gi|47575768|ref|NP_001001228|   .....................QSslgyrps....IHLIQDDMICAGYKQGK------ID..ACQGD
gi|301620758|gb|XP_002939739|   .....................QApsplgps....SFAILNDMLCAGYIDGG------KD..SCQGD
gi|301623566|gb|XP_002941080|   .....................G-...........-DDITNNMFCAGFQEGG------KD..SCQGD
gi|301620778|gb|XP_002939748|   .....................TG...........GTFIQEDMVCAGYQEGQ------ID..ACQGD
gi|49670651|gb|AAH75423|        .....................G-...........-DDITNNMFCAGFQEGG------KD..SCQGD
gi|52345790|ref|NP_001004941|   .....................G-...........-DDITNNMFCAGFQEGG------KD..SCQGD
gi|49522964|gb|AAH75293|        .....................HIdspvsas....SEIIPSDQICSGYSDGG------KD..SCKGD
gi|54020930|ref|NP_001005710|   .....................HIdspvsas....SEIIPSDQICSGYSDGG------KD..SCKGD
gi|59808136|gb|AAH89741|        .....................P-...........-GEITNNMFCAGFLAGG------KD..SCQGD
gi|62752849|ref|NP_001015792|   .....................P-...........-GEITNNMFCAGFLAGG------KD..SCQGD
gi|301621490|gb|XP_002940084|   .....................S-...........-NVVTERMLCAGYLEGK------ID..SCQGD
gi|301628802|gb|XP_002943535|   .....................P-...........-GQITNNMFCAGFLEGG------KD..SCQGD
gi|111307978|gb|AAI21657|       .....................Q-...........-MNISQNMFCAGYTDGS------KD..SCKGD
gi|118403542|ref|NP_001072819|  .....................Q-...........-MNISQNMFCAGYTDGS------KD..SCKGD
gi|163916428|gb|AAI57199|       .....................Q-...........-MNISQNMFCAGYTDGS------KD..SCKGD
gi|159155191|gb|AAI54713|       .....................SY...........NGFITQSMICAGDNSGA------VD..SCQGD
gi|163915041|ref|NP_001106508|  .....................SY...........NGFITQSMICAGDNSGA------VD..SCQGD
gi|301626232|gb|XP_002942299|   .....................YP...........-GQMTNHMLCAGFPSSKA-----KD..ACQGD
gi|169642526|gb|AAI60565|       .....................E-...........-NILTGNMFCAGYKEGV------KD..ACSGD
gi|187607167|ref|NP_001120289|  .....................E-...........-NILTGNMFCAGYKEGV------KD..ACSGD
gi|301620740|gb|XP_002939730|   .....................NTknpqgaf....TARIKNDMICAGYIKGG------KA..SCQGD
gi|49522964|gb|AAH75293|        .....................HIdspvsas....SEIIPSDQICSGYSAGG------KD..SCKGD
gi|54020930|ref|NP_001005710|   .....................HIdspvsas....SEIIPSDQICSGYSAGG------KD..SCKGD
gi|56611173|gb|AAH87759|        .....................P-...........-GSITDNMICVGYLEGG------ID..SCQGD
gi|58332122|ref|NP_001011209|   .....................P-...........-GSITDNMICVGYLEGG------ID..SCQGD
gi|301620750|gb|XP_002939735|   .....................NIpdaygrt....TANLTDTMLCAGYAKGG------RD..SCNGD
gi|301620756|gb|XP_002939738|   .....................QTpsstgqss...SFVILNDMLCAGYIDGS------KD..SCQGD
gi|301621490|gb|XP_002940084|   .....................P-...........-IQISPRMLCAGFMQGG------VD..SCSGD
gi|301620768|gb|XP_002939743|   .....................HYnsdlnpa....TQLVHDDMICAGYPEGQ------KD..ACQGD
gi|56541274|gb|AAH87610|        .....................P-...........-GQITNNMFCAGFLEGG------KD..SCQGD
gi|58332100|ref|NP_001011202|   .....................P-...........-GQITNNMFCAGFLEGG------KD..SCQGD
gi|58476395|gb|AAH89747|        .....................N-...........-IKVTDNMFCAGYNPED---SKRGD..ACEGD
gi|62751950|ref|NP_001015797|   .....................N-...........-IKVTDNMFCAGYNPED---SKRGD..ACEGD
gi|301623009|gb|XP_002940815|   .....................HVdnpslpas...QSLIMWDMICAGYKAGG------KD..ACQGD
gi|301609429|gb|XP_002934284|   .....................R-...........-YQISPRMLCAGYRDGS------KD..ACQGD
gi|301628804|gb|XP_002943536|   .....................P-...........-GQITNNMFCAGFLEGG------KD..SCQGD
gi|301628800|gb|XP_002943534|   .....................P-...........-GQITNNMFCAGFLEGG------KD..SCQGD
gi|301623523|gb|XP_002941065|   .....................PT...........-DEITDNMLCAGVMEGG------KD..SCQGD
gi|301614043|gb|XP_002936502|   .....................MY...........GGLIYPSMICAGYATGQ------ID..SCQGD
gi|301620764|gb|XP_002939741|   .....................QTpnsdgts....SISVHSDMICAGFINGG------KD..SCQGD
gi|56611148|gb|AAH87751|        .....................R-...........-GLFTENMFCAGFLEGG------KD..SCQVD
gi|58332104|ref|NP_001011204|   .....................R-...........-GLFTENMFCAGFLEGG------KD..SCQVD
gi|89269870|gb|CAJ83405|        .....................HVqsgissn....IAIVPKDQICAGYAAGQ------KD..SCQGD
gi|166796549|gb|AAI58898|       .....................HVqsgissn....IAIVPKDQICAGYAAGQ------KD..SCQGD
gi|167908783|ref|NP_001016055|  .....................HVqsgissn....IAIVPKDQICAGYAAGQ------KD..SCQGD
gi|213627780|gb|AAI71053|       .....................HVqsgissn....IAIVPKDQICAGYAAGQ------KD..SCQGD
gi|301623529|gb|XP_002941068|   .....................PS...........-DIITDNMLCAGNMAGG------KD..TCVGD
gi|56611170|gb|AAH87830|        .....................R-...........-GLFTENMFCAGFLEGG------KD..SCQVD
gi|58332206|ref|NP_001011251|   .....................R-...........-GLFTENMFCAGFLEGG------KD..SCQVD
gi|58476361|gb|AAH89695|        .....................K-...........-DGVSDNMLCAGQLGHI------QD..ACYGD
gi|62751546|ref|NP_001015759|   .....................K-...........-DGVSDNMLCAGQLGHI------QD..ACYGD
gi|56270387|gb|AAH87611|        .....................QTpnsygts....SISVHSDMICAGFINGG------KD..SCQGD
gi|58332094|ref|NP_001011195|   .....................QTpnsygts....SISVHSDMICAGFINGG------KD..SCQGD
gi|301620770|gb|XP_002939744|   .....................HTstgfsss....VTIVPVDQICAGYAAGQ------KD..SCQGD
gi|301623525|gb|XP_002941066|   .....................PR...........-DTITDNMLCAGDVAGG------KD..TCGGD
gi|56541161|gb|AAH87563|        .....................P-...........-GEITNNMICLGFLEGG------KD..SCQGD
gi|58332102|ref|NP_001011199|   .....................P-...........-GEITNNMICLGFLEGG------KD..SCQGD
gi|56971223|gb|AAH88079|        .....................P-...........-RMISENMFCAGFLEGG------KG..SCKGD
gi|58332720|ref|NP_001011435|   .....................P-...........-RMISENMFCAGFLEGG------KG..SCKGD
gi|56556311|gb|AAH87753|        .....................PS...........-DIITDNMLCAGNMAGG------KD..TCVGD
gi|301620774|gb|XP_002939746|   .....................NTdsll.......SVVVPLDQICAGYAAGQ------KD..SCQGD
gi|301621490|gb|XP_002940084|   .....................N-...........-FSITERMICAGFLDGK------VD..SCQGD
gi|301618335|gb|XP_002938574|   .....................P-...........-RMISENMFCAGFLEGE------KG..SCKGD
gi|301627387|gb|XP_002942851|   .....................WW...........GSQVQTTMVCAGGDGI-------VS..GCNGD
gi|51895949|gb|AAH80976|        .....................WW...........GSQVQTTMVCAGGDGI-------VS..GCNGD
gi|56118865|ref|NP_001008077|   .....................WW...........GSQVQTTMVCAGGDGI-------VS..GCNGD
gi|301618337|gb|XP_002938575|   .....................P-...........-RMISENMFCAGFLEGG------KG..SCHGD
gi|301611781|gb|XP_002935401|   .....................G-...........-NNITGTMICAGAAG--------SS..SCMGD
gi|56971185|gb|AAH88769|        .....................G-...........-NKIHSTMICAGASG--------AS..SCMGD
gi|58743375|ref|NP_001011477|   .....................G-...........-NKIHSTMICAGASG--------AS..SCMGD
gi|301611783|gb|XP_002935402|   .....................G-...........-NNITGTMICAGAAG--------SS..SCMGD
gi|301606691|gb|XP_002932950|   .....................VY...........NGAITPRMMCAGYLQGQ------ID..SCQGD
gi|57870463|gb|AAH89075|        .....................G-...........-SKILNTMVCAGASG--------AS..SCMGD
gi|62751938|ref|NP_001015686|   .....................G-...........-SKILNTMVCAGASG--------AS..SCMGD
gi|301610206|gb|XP_002934644|   .....................WY...........NGGIHDDNLCAGYEQGG------PD..VCMGD
gi|159155760|gb|AAI54947|       .....................PR...........-DTVTDNMLCAGNMAGG------ED..TCVGD
gi|301632763|gb|XP_002945450|   .....................PR...........-DTVTDNMLCAGNMAGG------ED..TCVGD
gi|301623527|gb|XP_002941067|   .....................PS...........-DIITDNMLCAGNMAGG------ED..TCVGD
gi|56611133|gb|AAH87787|        .....................R-...........-FSIYANMFCAGYSDES------KD..TCQGD
gi|58332150|ref|NP_001011223|   .....................R-...........-FSIYANMFCAGYSDES------KD..TCQGD
gi|301620772|gb|XP_002939745|   .....................HIgtnvpss....TAIIPSDQICAGYAAGQ------KD..SCQGD
gi|301614103|gb|XP_002936536|   .....................AY...........NGQITASMICAGYLSGG------VD..TCQGD
gi|60552068|gb|AAH91088|        .....................WW...........GDGVRTNMICAGGDGI-------TS..SCNGD
gi|301627389|gb|XP_002942852|   .....................WW...........GDGVRTNMICAGGDGI-------TS..SCNGD
gi|301623007|gb|XP_002940814|   .....................PY...........QSIIMWDMICAGYKAGR------RG..SCQGD
gi|301612271|gb|XP_002935645|   .....................WY...........NGKIEEYNLCAGHKEGK------ID..SCQGD
gi|301603857|gb|XP_002931605|   .....................WY...........DGAIGEYNLCAGHEKGG------ID..SCQGD
gi|301615211|gb|XP_002937069|   .....................WY...........NGKVYPYNLCAGHKEGK------ID..SCQGD
gi|301615213|gb|XP_002937070|   .....................WY...........NGKVYPYNLCAGHKEGK------ID..SCQGD
gi|301603863|gb|XP_002931607|   .....................WY...........DGSIGEYNLCAGHEKGG------ID..SCQGD
gi|301627010|gb|XP_002942670|   .....................WW...........GATVKRSMVCAGGDI--------RS..VCNGD
gi|56972340|gb|AAH88057|        .....................WW...........GATVKRSMVCAGGDI--------RS..VCNGD
gi|58332702|ref|NP_001011426|   .....................WW...........GATVKRSMVCAGGDI--------RS..VCNGD
gi|39850054|gb|AAH64277|        .....................G-...........-NNITGTMICAGAAG--------SS..SCMGD
gi|301615217|gb|XP_002937076|   .....................WY...........NGKVYPYNLCAGHKEGK------ID..SCQGD
gi|301630725|gb|XP_002944467|   .....................WY...........NGGIHDDNLCAGYEQGG------PD..VCMGD
gi|60552029|gb|AAH91010|        .....................LS...........NQEVTQNMLCAGDTRNL------DD..ACKGD
gi|71896209|ref|NP_001025574|   .....................LS...........NQEVTQNMLCAGDTRNL------DD..ACKGD
gi|301620748|gb|XP_002939734|   .....................SR...........VANITDNMICAGYVSGG------KG..ICQGD
gi|301615956|gb|XP_002937430|   .....................L-...........-GGIDESMLCTATPGAPF-----KG..FCDGD
gi|301622787|gb|XP_002940708|   .....................G-...........-GAITNTMLCAATPGVLA-----KG..FCSGD
gi|56789422|gb|AAH88038|        .....................G-...........-GAITNTMLCAATPGVLA-----KG..FCSGD
gi|56611135|gb|AAH87810|        .....................WW...........GEMNEKTLVCAGAAG--------KA..ACNGD
gi|301624444|gb|XP_002941509|   .....................NMkndynit....GDVITNDTICARDIHGV------HR..ICRGD
gi|301615068|gb|XP_002937000|   .....................IH...........GERMLPGMLCAGFMEGG------VD..ACQGD
gi|301618415|gb|XP_002938616|   .....................YL...........NGRVTDRELCAGVIQGG------VD..SCQGD
gi|301627689|gb|XP_002943002|   .....................MY...........NGAITSSMICAGYPKGG------VD..SCQGD
gi|58477045|gb|AAH89660|        .....................T-...........-FAITENMFCAGFDTEV------KD..ACQGD
gi|62751697|ref|NP_001015728|   .....................T-...........-FAITENMFCAGFDTEV------KD..ACQGD
gi|301622330|gb|XP_002940490|   .....................FW...........GDRIRESMICAGFRNVGGP----PA..ACQGD
gi|301620762|gb|XP_002939724|   .....................ESkgv........GPLVGAGMICAVDILGR------SG..PCLGD
gi|301614101|gb|XP_002936535|   .....................VY...........NGTITSSMICAGYLNGT------ID..TCKGD
gi|57032953|gb|AAH88892|        .....................NMkndynit....GDVITNDTICARDIHGV------HR..ICRGD
gi|301620357|gb|XP_002939545|   .....................SY...........GKHIDGSMLCAGLAQGG------VD..SCQGD
gi|58477078|gb|AAH89729|        .....................SY...........GKHIDGSMLCAGLAQGG------VD..SCQGD
gi|58476369|gb|AAH89702|        .....................DNkgv........GSFIKDDMICAVDILGQ------RG..PCLGD
gi|301624442|gb|XP_002941516|   .....................F-...........-SEIQPDMICAGDSSGG------KD..SCQGD
gi|56585195|gb|AAH87729|        .....................WW...........GPSIKTTMVCAGGDI--------RA..GCNGD
gi|56971746|gb|AAH88036|        .....................WW...........GPSIKTTMVCAGGDI--------RA..GCNGD
gi|58332692|ref|NP_001011421|   .....................WW...........GPSIKTTMVCAGGDI--------RA..GCNGD
gi|301614099|gb|XP_002936522|   .....................VY...........NGSITPSMLCADGLYGW------IG..SCQGD
gi|301627056|gb|XP_002942694|   .....................WW...........WGTVKPNMICAGGTGV-------TA..SCYGD
gi|301620744|gb|XP_002939732|   .....................HTyaggaa.....QAEIRNDMICTGIPQGG------MG..ACQGD
gi|301627687|gb|XP_002943001|   .....................VY...........GGAISPTMMCAGYLSGG------TD..TCQGD
gi|301620752|gb|XP_002939736|   .....................F-...........-SEIQPDMICAGDSSGG------KD..SCQGD
gi|301620760|gb|XP_002939740|   .....................DNkgv........GSFIKDDMICAVDILGQ------RG..PCLGD
gi|301614101|gb|XP_002936535|   .....................MY...........NEEITPSMICAGYLSGG------VG..SCQGD
gi|301612617|gb|XP_002935812|   .....................K-...........-GKFTNRMVCAGTLFEDRL----ID..SCQGD
gi|57032843|gb|AAH88882|        .....................YW...........GSTVKSTMVCAGGDGV-------RS..GCQGD
gi|58332834|ref|NP_001011493|   .....................YW...........GSTVKSTMVCAGGDGV-------RS..GCQGD
gi|62531104|gb|AAH92553|        .....................WW...........GSSVKTTMVCAGGDGV-------RS..SCNGD
gi|71895833|ref|NP_001025669|   .....................WW...........GSSVKTTMVCAGGDGV-------RS..SCNGD
gi|113931254|ref|NP_001039074|  .....................G-...........-GQILDTMLCAGKIAGG------AD..TCQGD
gi|89273918|gb|CAJ81839|        .....................G-...........-GQILDTMLCAGKIAGG------AD..TCQGD
gi|301614097|gb|XP_002936534|   .....................VY...........NGSITPSMLCADARHGR------IG..SCQGD
gi|187469575|gb|AAI67128|       .....................YW...........GSTVKTSMVCAGGDGV-------TA..GCNGD
gi|301608337|gb|XP_002933738|   .....................YW...........GSTVKTSMVCAGGDGV-------TA..GCNGD
gi|62859195|ref|NP_001016980|   .....................NIkpsads.....MGSIQPDMICAGSAAGS------VD..ACQGD
gi|89272057|gb|CAJ83340|        .....................NIkpsads.....MGSIQPDMICAGSAAGS------VD..ACQGD
gi|134023759|gb|AAI35327|       .....................ESrsg........NYSVTENMFCAGYYEGG------KD..TCLGD
gi|147901778|ref|NP_001090874|  .....................ESrsg........NYSVTENMFCAGYYEGG------KD..TCLGD
gi|301608335|gb|XP_002933737|   .....................YW...........GSTVKSTMVCAGGDGV-------RS..GCQGD
gi|161612048|gb|AAI56020|       .....................YW...........GSTVKSTMVCAGGDGV-------RS..GCQGD
gi|56971188|gb|AAH88782|        .....................WW...........GSTVKTTMVCADGAGI-------RS..SCNGD
gi|58332812|ref|NP_001011481|   .....................WW...........GSTVKTTMVCADGAGI-------RS..SCNGD
gi|66990056|gb|AAH98090|        .....................K-...........-ERFLDKMECAGTYDGS------ID..ACKGD
gi|73853846|ref|NP_001027508|   .....................K-...........-ERFLDKMECAGTYDGS------ID..ACKGD
gi|54035177|gb|AAH84139|        .....................AKlda........QYIVTENMICAGFEIGV------KD..SCAGD
gi|58332348|ref|NP_001011037|   .....................AKlda........QYIVTENMICAGFEIGV------KD..SCAGD
gi|56789096|gb|AAH88027|        .....................P-...........--RLSDGMICAGSNNQI------KD..SSQGD
gi|353523845|ref|NP_001238808|  .....................P-...........--RLSDGMICAGSNNQI------KD..SSQGD
gi|301610620|gb|XP_002934851|   .....................P-...........--RLSDGMICAGSNNQI------KD..SSQGD
gi|301627008|gb|XP_002942673|   .....................WW...........GTKVKRSMVCAGGDI--------RS..VCNGD
gi|39794386|gb|AAH64208|        .....................YY...........DNEITANMICAGESR--------KD..SCEGD
gi|45361487|ref|NP_989320|      .....................YY...........DNEITANMICAGESR--------KD..SCEGD
gi|82237461|sp|Q6P326|          .....................YY...........DNEITANMICAGESR--------KD..SCEGD
gi|301619167|gb|XP_002938973|   .....................L-...........-GAIQEYHLCASQKAN-------MK..SCQGD
gi|56789072|gb|AAH88011|        .....................SP...........-KKMHTNLMCAGFAQDD------KD..SCQGD
gi|58332288|ref|NP_001011293|   .....................SP...........-KKMHTNLMCAGFAQDD------KD..SCQGD
gi|113205726|ref|NP_001037931|  .....................Q-...........-GILGENHLCAGHRKGP------EK..TCNGD
gi|89266985|gb|CAJ81306|        .....................Q-...........-GILGENHLCAGHRKGP------EK..TCNGD
gi|301619169|gb|XP_002938974|   .....................H-...........-GAIKENNLCASQNSTN------MT..SCQGD
gi|301623913|gb|XP_002941253|   .....................GG...........KGYFTPNMLCAGSDVG-------KD..SCNGD
gi|163915777|gb|AAI57637|       .....................FY...........GEKFTSNMLCAADKR--------KD..TCDGD
gi|166158186|ref|NP_001107486|  .....................FY...........GEKFTSNMLCAADKR--------KD..TCDGD
gi|301626232|gb|XP_002942299|   .....................V-...........-SGVTDNNVCAGKAG--------AT..SCMGD
gi|66396569|gb|AAH96515|        .....................NKkrpirnpsheeRYLFSRNMFCAGFPEGS---LNKGD..SCRGD
gi|301623915|gb|XP_002941259|   .....................NKkrpirnpsheeRYLFSRNMFCAGFPEGS---LNKGD..SCRGD
gi|66396598|gb|AAH96508|        .....................GG...........KGYFTPNMLCAGSDVG-------KD..SCNGD
gi|301618553|gb|XP_002938678|   .....................YW...........WFQLKQSMICAGYILPDEL----KS..VCQGD
gi|301619614|gb|XP_002939175|   .....................NY...........AGQISPRMLCAGYPDGR------AD..SCQGD
gi|301623919|gb|XP_002941255|   .....................RQ...........KYFLSKNMFCAGFPEGS---LNKGD..SCQGD
gi|301623917|gb|XP_002941260|   .....................KYre.........KYPLSRNMFCAGFPEGS---LNKGD..SCSGD
gi|49899920|gb|AAH76933|        .....................--...........-----PNNICTGVFMQQ------AG..ICFGD
gi|55742037|ref|NP_001006847|   .....................--...........-----PNNICTGVFMQQ------AG..ICFGD
gi|163915656|gb|AAI57668|       .....................KKf..........KTEISTNMLCAGAPKKSD---KKYD..ACQGD
gi|165973394|ref|NP_001107158|  .....................KKf..........KTEISTNMLCAGAPKKSD---KKYD..ACQGD
gi|213627368|gb|AAI71196|       .....................KKf..........KTEISTNMLCAGAPKKSD---KKYD..ACQGD
gi|301622373|gb|XP_002940514|   .....................IY...........GGVIKPSMVCAGFLEGG------VD..TCQ--
gi|301623711|gb|XP_002941159|   .....................KP...........LINITRNMICTSENVEV------KG..TCGGD
gi|301609058|gb|XP_002934098|   .....................QTl..........ELLVTDEMICAGFKEGG------KD..ACSGD
gi|301607053|gb|XP_002933130|   .....................PE...........-YNITDNMVCGGYEEGG------ID..TCQGD
gi|301620754|gb|XP_002939737|   .....................KSsskdd......GNDITDDMICAMNIHEG------RD..SCQGD
gi|301631044|gb|XP_002944619|   .....................WW...........FINVKTSMICAGGDGN-------VA..SCYGD
gi|301629851|gb|XP_002944046|   .....................PS...........-DIITDNMLCAGNMAGG------KD..TCVGD
gi|301629862|gb|XP_002944051|   .....................R-...........-GLFTENMFCAGFLEGG------KD..SCQ--
gi|301619787|gb|XP_002939269|   .....................IY...........GAEISENMFCAGYFDCT------ID..SCQGD
gi|301627058|gb|XP_002942695|   .....................WW...........FINVKTSMICAGGDGN-------VA..SC---
gi|301629849|gb|XP_002944045|   .....................PD...........-DIITDNMLCAGDVAGG------KD..TCGGD
gi|301626232|gb|XP_002942299|   .....................AQ...........----GCRLSYTGNSEYHSFVLLFPS..TIQGD
gi|301609784|gb|XP_002934450|   .....................EQ...........-TRIDKKILCAGYKRGK------ID..SCKGD
gi|301631575|gb|XP_002944873|   .....................FW...........GDRIRESMICAGFRNVGGP----PA..ACQGD
gi|301607830|gb|XP_002933508|   .....................DM...........-KTITSRMLCAGYESGT------ID..SCM--
gi|301620748|gb|XP_002939734|   .....................STpstk.......AAISPNLMICAGYIDGG------KD..TCQGD
gi|301623709|gb|XP_002941155|   .....................KS...........KSKITKDMMCTRDKGK-------RG..FCNGD
gi|301609490|gb|XP_002934300|   .....................R-...........-SQFTGRMLCAGSVKTQKH----VD..SCQGD
gi|301607063|gb|XP_002933142|   .....................KG...........KITVNESEICAMSETAN------IG..PCERD
gi|116487755|gb|AAI25706|       .....................L-...........-GLRNSDMDYIQTD---------AI..INYGN
gi|134023797|gb|AAI35435|       .....................L-...........-GLRNSDMDYIQTD---------AI..INYGN
gi|350276152|ref|NP_001072730|  .....................L-...........-GLRNSDMDYIQTD---------AI..INYGN
gi|301620766|gb|XP_002939742|   .....................QTpnsygts....SISVHSDMICAGFTNGG------KD..SCQGD
gi|301609058|gb|XP_002934098|   .....................QTl..........ELLVTDEMICAGFKEGG------KD..ACSGD
gi|301606403|gb|XP_002932829|   .....................L-...........-GLKDSDMEYIQTD---------AI..INYGN
gi|163915807|gb|AAI57677|       .....................P-...........-RVNTKKCICAKNTDK-------KS..SCRGD
gi|166158294|ref|NP_001107513|  .....................P-...........-RVNTKKCICAKNTDK-------KS..SCRGD
gi|213624433|gb|AAI71092|       .....................P-...........-RVNTKKCICAKNTDK-------KS..SCRGD
gi|213625671|gb|AAI71088|       .....................P-...........-RVNTKKCICAKNTDK-------KS..SCRGD
gi|301620338|gb|XP_002939538|   .....................WY...........NGRIKEYNLCAGFEHGG------PD..TCDGD
gi|301622789|gb|XP_002940709|   .....................G-...........-GAITNTMLCAATPGVLA-----KG..FCSGD
gi|301603859|gb|XP_002931606|   .....................WY...........DGAIGEYNLCAGHEKGG------ID..SCQGD
gi|301618560|gb|XP_002938688|   .....................L-...........-GLRDSDMDYVQTD---------AI..INYGN
gi|49522408|gb|AAH75430|        .....................GI...........SVSVTESMFCAKQEPRPS-----PS..ICPSE
gi|52345796|ref|NP_001004944|   .....................GI...........SVSVTESMFCAKQEPRPS-----PS..ICPSE
gi|82183464|sp|Q6DIV5|          .....................GI...........SVSVTESMFCAKQEPRPS-----PS..ICPSE
gi|301614097|gb|XP_002936534|   .....................--...........---------NAGYLVGV------PP..LKEGD
gi|301624064|gb|XP_002941330|   .....................VY...........NGQITASMICAGYLSGG------VD..SCQGD
gi|301631613|gb|XP_002944892|   .....................--...........-------------------------..-----
gi|301631166|gb|XP_002944677|   .....................G-...........-NNITGTMICAGAAG--------SS..SCMGD
gi|301614089|gb|XP_002936531|   .....................RSq..........RNKVLDNEMCTKPVPVD------VG..ACEGD
gi|301623570|gb|XP_002941088|   .....................--...........-------------------------..-----
gi|301618553|gb|XP_002938678|   .....................FW...........WSQLTTSMICAGFESAEKL----KS..ECRNE
gi|169642095|gb|AAI60801|       .....................L-...........--GLSNSNMDYIQTD--------AT..IDFGN
gi|288684101|ref|NP_001165762|  .....................L-...........--GLSNSNMDYIQTD--------AT..IDFGN
gi|301627723|gb|XP_002943019|   .....................NP...........VLLVSSRHLCVEGE----------M..SCKGE
gi|169642366|gb|AAI60557|       .....................N-...........-VTQTNRMFCGVSHEA-------ID..SEL-S
gi|56789309|gb|AAH88065|        .....................N-...........-VTQTNRMFCGVSHEA-------ID..SEL-S
gi|313851093|ref|NP_001116189|  .....................N-...........-VTQTNRMFCGVSHEA-------ID..SEL-S
gi|301627727|gb|XP_002943021|   gskrtacleaakkapelknvtDI...........EDAVTEQFLCTGGIEPV------VDppVCKGD
gi|301620760|gb|XP_002939740|   .....................QVpspidpk....TYVISNDMLCAGFIDGG------KD..SCQGD
gi|301614097|gb|XP_002936534|   .....................--...........-------------------------..-----
gi|301632426|gb|XP_002945286|   .....................P-...........-GETTNNMICLGFLEGG------KD..SCQGD
gi|301603859|gb|XP_002931606|   .....................--...........-------------------------..-----
gi|169641896|gb|AAI60561|       .....................--...........-------------------------..-----
gi|187607137|ref|NP_001120287|  .....................--...........-------------------------..-----
gi|301613000|gb|XP_002936003|   .....................--...........-SGVLSSVISIGDVPVM--LQTSCA..VHGGS
gi|301620752|gb|XP_002939736|   .....................DPnit........GVYITDQMICARDILGG------KD..SCQDA
gi|301612998|gb|XP_002936002|   .....................--...........-SGVLSSVISIGDVPVM--LQTSCA..VHGGS
gi|160774415|gb|AAI55421|       .....................--...........-------RFCEVTDETYDLLYQQCD..AQPGA
gi|163915255|ref|NP_001106591|  .....................--...........-------RFCEVTDETYDLLYQQCD..AQPGA
gi|301618176|gb|XP_002938505|   .....................--...........-------RFCRVSEESTDLFYQYCD..AEPGS
gi|301610794|gb|XP_002934945|   .....................--...........-------RSCRVKQQTAHLLYQHCD..AQPGA
gi|301630837|gb|XP_002944523|   .....................--...........-TSLKPNMICAGGDGI-------IS..SCYGD
gi|163916178|gb|AAI57579|       .....................--...........-----------------------AT..IDFGN
gi|166158059|ref|NP_001107438|  .....................--...........-----------------------AT..IDFGN
gi|163915732|gb|AAI57581|       .....................--...........-----------------------AT..IDFGN
gi|288684088|ref|NP_001165761|  .....................--...........-----------------------AT..IDFGN
gi|163915698|gb|AAI57530|       .....................--...........-----------------------AT..IDFGN
gi|166158009|ref|NP_001107414|  .....................--...........-----------------------AT..IDFGN
gi|301618333|gb|XP_002938578|   .....................--...........-------------------------..-----
gi|49900216|gb|AAH76994|        .....................--...........-------------------------..--NAD
gi|52346064|ref|NP_001005075|   .....................--...........-------------------------..--NAD
gi|301612998|gb|XP_002936002|   .....................--...........----------NTAGDRNVVLLTDAR..CLPGS
gi|301613000|gb|XP_002936003|   .....................--...........----------NTAGDRNVVLLTDAR..CLPGS
gi|301630168|gb|XP_002944198|   .....................--...........-----------------------AA..IDFGN
gi|301615558|gb|XP_002937233|   .....................--...........-------------------------..-----


                                    220               230            240                            
                                      |                 |              |                            
d1a5ia_                           SGGPLVC......MN..DNHMTLLGIIS...WGV..GCGEKD...........VP..........G
gi|62201369|gb|AAH93474|        SGGPLVC......NV..NNTWWQYGIIS...WGI..GCAEAN...........AP..........G
gi|71895773|ref|NP_001025685|   SGGPLVC......NV..NNTWWQYGIIS...WGI..GCAEAN...........AP..........G
gi|301620776|gb|XP_002939747|   SGGALVC......KI..QRVWYQIGIVS...WGD..GCAIAN...........RP..........G
gi|45708911|gb|AAH67937|        SGGPLVC......NT..SNTWLQFGIVS...WGL..GCAEPN...........QP..........G
gi|47575768|ref|NP_001001228|   SGGPLVC......NT..SNTWLQFGIVS...WGL..GCAEPN...........QP..........G
gi|301620758|gb|XP_002939739|   SGGPLVC......AA..ANQWYLVGVVS...FGD..GCGQPN...........RP..........G
gi|301623566|gb|XP_002941080|   SGGPLVC......DG..----ELFGVVS...WGY..GCATKG...........YP..........G
gi|301620778|gb|XP_002939748|   SGGPLVC......NV..NNVWLQFGIVS...WGY..GCAEPN...........KP..........G
gi|49670651|gb|AAH75423|        SGGPLVC......DG..----ELFGVVS...WGH..ECAKKG...........YP..........G
gi|52345790|ref|NP_001004941|   SGGPLVC......DG..----ELFGVVS...WGH..ECAKKG...........YP..........G
gi|49522964|gb|AAH75293|        SGGALVC......KI..QRVWYQIGIVS...WGD..GCAIAN...........RP..........G
gi|54020930|ref|NP_001005710|   SGGALVC......KI..QRVWYQIGIVS...WGD..GCAIAN...........RP..........G
gi|59808136|gb|AAH89741|        SGGPVVC......NG..----QLQGVVS...WGY..GCAQRN...........YP..........G
gi|62752849|ref|NP_001015792|   SGGPVVC......NG..----QLQGVVS...WGY..GCAQRN...........YP..........G
gi|301621490|gb|XP_002940084|   SGGPLVC......EEp.SGKFFLAGIVS...WGV..GCAEAR...........RP..........G
gi|301628802|gb|XP_002943535|   SGGPVVC......NG..----QLQGIVS...WGI..GCAQRN...........YP..........G
gi|111307978|gb|AAI21657|       SGGPHAT......QY..KNTHFLTGIVS...WGL..GCAKKE...........KY..........G
gi|118403542|ref|NP_001072819|  SGGPHAT......QY..KNTHFLTGIVS...WGL..GCAKKE...........KY..........G
gi|163916428|gb|AAI57199|       SGGPHAT......QY..KNTHFLTGIVS...WGL..GCAKKE...........KY..........G
gi|159155191|gb|AAI54713|       SGGPFVC......YNteRMRFYQMGITS...FGY..GCGKPN...........FP..........G
gi|163915041|ref|NP_001106508|  SGGPFVC......YNteRMRFYQMGITS...FGY..GCGKPN...........FP..........G
gi|301626232|gb|XP_002942299|   SGGPLVCg.....NT..KEQYFIYGLVS...WGE..GCGQVY...........KP..........G
gi|169642526|gb|AAI60565|       SGGPFAV......LF..HDTWFLVGVVS...WGD..GCAEKG...........KY..........G
gi|187607167|ref|NP_001120289|  SGGPFAV......LF..HDTWFLVGVVS...WGD..GCAEKG...........KY..........G
gi|301620740|gb|XP_002939730|   SGGPVVC......QE..GKRWYLAGVVS...FGA..GCALLY...........RP..........G
gi|49522964|gb|AAH75293|        SGGPLVC......KL..QGIWYQIGIVS...WGE..GCAIAK...........RP..........G
gi|54020930|ref|NP_001005710|   SGGPLVC......KL..QGIWYQIGIVS...WGE..GCAIAK...........RP..........G
gi|56611173|gb|AAH87759|        SGGPVVC......DG..----ELQGVVS...WGR..GCALPG...........YP..........G
gi|58332122|ref|NP_001011209|   SGGPVVC......DG..----ELQGVVS...WGR..GCALPG...........YP..........G
gi|301620750|gb|XP_002939735|   VGGPLVC......PK..DGRWYLAGVVS...GGD..GCGKPN...........RP..........G
gi|301620756|gb|XP_002939738|   SGGPLVC......TQ..NSRWYLVGAVS...FGE..GCGQPN...........RP..........G
gi|301621490|gb|XP_002940084|   AGGPLAC......REp.SGRWFLAGITS...WGY..GCARPY...........FP..........G
gi|301620768|gb|XP_002939743|   SGGPLAC......KS..GNYWFLTGIVS...WGD..GCAQPN...........RP..........G
gi|56541274|gb|AAH87610|        SGGPVVC......NG..----ELQGVVS...WGI..GCAQRN...........YP..........G
gi|58332100|ref|NP_001011202|   SGGPVVC......NG..----ELQGVVS...WGI..GCAQRN...........YP..........G
gi|58476395|gb|AAH89747|        SGGPFVM......KDpdTGRWVQLGIVS...WGE..GCDRDN...........KY..........G
gi|62751950|ref|NP_001015797|   SGGPFVM......KDpdTGRWVQLGIVS...WGE..GCDRDN...........KY..........G
gi|301623009|gb|XP_002940815|   SGGPLVC......PW..NGSWILAGIVS...WGF..GCAVPN...........RP..........G
gi|301609429|gb|XP_002934284|   SGSPLVC......KTa.SGRWFQAGLVS...WGA..GCGIPR...........YF..........G
gi|301628804|gb|XP_002943536|   SGGPVVC......NG..----QLQGIVS...WGI..GCAQRN...........YP..........G
gi|301628800|gb|XP_002943534|   SGGPVVC......NG..----QLQGIVS...WGI..GCAQRN...........YP..........G
gi|301623523|gb|XP_002941065|   SGGPLVC......NS..----MVHGITS...WGNt.PCGVAN...........KP..........G
gi|301614043|gb|XP_002936502|   SGGPLVT......LK..SGRWVLIGIVS...FGY..GCALPN...........KP..........G
gi|301620764|gb|XP_002939741|   SGGPLVC......ST..SGQWFLAGVVS...FGD..GCGQAY...........RP..........G
gi|56611148|gb|AAH87751|        SGGPLVC......NG..----ELYGVVS...WGQ..GCAERN...........AP..........G
gi|58332104|ref|NP_001011204|   SGGPLVC......NG..----ELYGVVS...WGQ..GCAERN...........AP..........G
gi|89269870|gb|CAJ83405|        SGGPLVC......QL..QGVWYQIGIVS...WGD..GCAQAS...........RP..........G
gi|166796549|gb|AAI58898|       SGGPLVC......QL..QGVWYQIGIVS...WGD..GCAQAS...........RP..........G
gi|167908783|ref|NP_001016055|  SGGPLVC......QL..QGVWYQIGIVS...WGD..GCAQAS...........RP..........G
gi|213627780|gb|AAI71053|       SGGPLVC......QL..QGVWYQIGIVS...WGD..GCAQAS...........RP..........G
gi|301623529|gb|XP_002941068|   SGGPLVC......NG..----ELHGITS...WGDy.VCGCPN...........KP..........G
gi|56611170|gb|AAH87830|        SGGPLVC......NG..----ELYGVVS...WGW..GCAQRN...........AP..........G
gi|58332206|ref|NP_001011251|   SGGPLVC......NG..----ELYGVVS...WGW..GCAQRN...........AP..........G
gi|58476361|gb|AAH89695|        SGGPMVT......KF..GETWFLVGLVS...WGE..GCGRLN...........NF..........G
gi|62751546|ref|NP_001015759|   SGGPMVT......KF..GETWFLVGLVS...WGE..GCGRLN...........NF..........G
gi|56270387|gb|AAH87611|        SGGPLVC......SS..SGQWFLAGVVS...FGE..GCGQAY...........RP..........G
gi|58332094|ref|NP_001011195|   SGGPLVC......SS..SGQWFLAGVVS...FGE..GCGQAY...........RP..........G
gi|301620770|gb|XP_002939744|   SGGPLVC......NV..QGVWYQVGIVS...WGE..GCALAN...........SP..........G
gi|301623525|gb|XP_002941066|   SGGPLVC......NE..----ELHGITS...WGDl.VCGSPD...........KP..........G
gi|56541161|gb|AAH87563|        SGGPVVC......NG..----ELQGVVS...WGY..GCAQRN...........YP..........G
gi|58332102|ref|NP_001011199|   SGGPVVC......NG..----ELQGVVS...WGY..GCAQRN...........YP..........G
gi|56971223|gb|AAH88079|        SGGPLIC......NG..----ELYGAVS...WGGs.YCISKN...........SP..........G
gi|58332720|ref|NP_001011435|   SGGPLIC......NG..----ELYGAVS...WGGs.YCISKN...........SP..........G
gi|56556311|gb|AAH87753|        SGGPLVC......NG..----ELHGITS...WGDy.VCGSPN...........KP..........G
gi|301620774|gb|XP_002939746|   SGGPLVC......QL..QGIWYQIGIVS...WGE..GCAVRN...........RP..........G
gi|301621490|gb|XP_002940084|   SGGPLAC......EEs.PGIFFLAGIVS...WGI..GCAQAK...........KP..........G
gi|301618335|gb|XP_002938574|   SGGPLIC......NG..----ELYGAVS...WGGr.YCISKN...........SP..........G
gi|301627387|gb|XP_002942851|   SGGPLNC......QAa.GGAWEVHGIVS...FGSgiSCNYAK...........KP..........T
gi|51895949|gb|AAH80976|        SGGPLNC......QAa.GGAWEVHGIVS...FGSgiSCNYAK...........KP..........T
gi|56118865|ref|NP_001008077|   SGGPLNC......QAa.GGAWEVHGIVS...FGSgiSCNYAK...........KP..........T
gi|301618337|gb|XP_002938575|   SGGPLIC......NG..----ELYGAVS...WGGs.YCISKN...........SP..........G
gi|301611781|gb|XP_002935401|   SGGPLVC......QA..NDAWTLVGIVS...WGS..SMCATN...........SP..........G
gi|56971185|gb|AAH88769|        SGGPLVC......AR..NGAWVLAGIVS...WGS..STCSPS...........SP..........G
gi|58743375|ref|NP_001011477|   SGGPLVC......AR..NGAWVLAGIVS...WGS..STCSPS...........SP..........G
gi|301611783|gb|XP_002935402|   SGGPLVC......QA..NDAWTLVGIVS...WGS..SMCATN...........SP..........G
gi|301606691|gb|XP_002932950|   SGGPLVC......QQ..GGIWYLAGVTS...WGS..GCGQAN...........KP..........G
gi|57870463|gb|AAH89075|        SGGPLVC......QR..NGAWVLAGIVS...WGS..STCSPS...........SP..........G
gi|62751938|ref|NP_001015686|   SGGPLVC......QR..NGAWVLAGIVS...WGS..STCSPS...........SP..........G
gi|301610206|gb|XP_002934644|   SGGPLMC......KRkkAGIYYVVGIVS...WGG..LCGQPH...........SN..........G
gi|159155760|gb|AAI54947|       SGGPLVC......NG..----ELHGITS...WGDf.VCGSPN...........KP..........G
gi|301632763|gb|XP_002945450|   SGGPLVC......NG..----ELHGITS...WGDf.VCGSPN...........KP..........G
gi|301623527|gb|XP_002941067|   SGGPLVC......NG..----ELHGITS...WGDy.VCGCPN...........KP..........G
gi|56611133|gb|AAH87787|        SGGPHVT......EY..KNLWFLTGITS...WGE..KCAEKD...........KY..........G
gi|58332150|ref|NP_001011223|   SGGPHVT......EY..KNLWFLTGITS...WGE..KCAEKD...........KY..........G
gi|301620772|gb|XP_002939745|   SGGPLVC......KL..QGIWYQIGFVT...WGD..GCAIAN...........RP..........G
gi|301614103|gb|XP_002936536|   SGGPLVT......QT..NATWWLVGDTS...WGY..GCARAY...........KP..........G
gi|60552068|gb|AAH91088|        SGGPLNC......RNa.NGTWEVHGVVS...FGSaaGCNYPK...........KP..........S
gi|301627389|gb|XP_002942852|   SGGPLNC......RNa.NGTWEVHGVVS...FGSaaGCNYPK...........KP..........S
gi|301623007|gb|XP_002940814|   SGGPLVC......PW..NGSWLLAGIVS...WGF..GCAQPN...........KP..........G
gi|301612271|gb|XP_002935645|   SGGPLMC......RTk.SNDFAVVGVTS...WGS..GCARQQ...........RP..........G
gi|301603857|gb|XP_002931605|   SGGPLMCkt....QK..SRTYAVVGITS...WGS..GCARGK...........KP..........G
gi|301615211|gb|XP_002937069|   SGGPLMCkr....KT..SNDYIVVGVTS...WGI..GCARKQ...........RP..........G
gi|301615213|gb|XP_002937070|   SGGPLMCkr....KT..SNDYIVVGVTS...WGI..GCARKQ...........RP..........G
gi|301603863|gb|XP_002931607|   SGGPLMCkt....QK..SRTYAVVGITS...WGS..GCARGK...........KP..........G
gi|301627010|gb|XP_002942670|   SGGPLNC......QGa.DGRWYVHGVTS...FGSgyGCNTLK...........KP..........S
gi|56972340|gb|AAH88057|        SGGPLNC......QGa.DGRWYVHGVTS...FGSgyGCNTLK...........KP..........S
gi|58332702|ref|NP_001011426|   SGGPLNC......QGa.DGRWYVHGVTS...FGSgyGCNTLK...........KP..........S
gi|39850054|gb|AAH64277|        SGGPLVC......QA..NDAWTLVGIVS...WGS..SMCSTS...........TP..........A
gi|301615217|gb|XP_002937076|   SGGPLMCkr....KT..SNDYIVVGVTS...WGI..GCARKQ...........RP..........G
gi|301630725|gb|XP_002944467|   SGGPLMC......KRkkAGIYYVVGIVS...WGG..LCGQPH...........SN..........G
gi|60552029|gb|AAH91010|        SGGPLVC......PH..EGRMHLMGIVS...WGI..GCGKKD...........TP..........G
gi|71896209|ref|NP_001025574|   SGGPLVC......PH..EGRMHLMGIVS...WGI..GCGKKD...........TP..........G
gi|301620748|gb|XP_002939734|   SGGPLVC......AQ..ADRWYLAGIVS...FGI..PCEQKY...........YP..........S
gi|301615956|gb|XP_002937430|   SGGPLVC......GD..----RVEGVVS...FSGs.YCGDPH...........TP..........D
gi|301622787|gb|XP_002940708|   SGGPLVC......RN..----RLEGAVS...FSGr.FCGNAM...........FP..........D
gi|56789422|gb|AAH88038|        SGGPLVC......RN..----RLEGAVS...FSGr.FCGNAM...........FP..........D
gi|56611135|gb|AAH87810|        SGGPLNC......QSp.DGRWFVHGVTS...FGPg.ACNLPK...........RP..........S
gi|301624444|gb|XP_002941509|   GGGPLAC......PA..GNSWYVVGVAS...FVV..LCGEMG...........HP..........G
gi|301615068|gb|XP_002937000|   SGGPLVC......EV..DGRIELHGVVS...WGS..GCAEEN...........KP..........G
gi|301618415|gb|XP_002938616|   SGGPLSC......FD..GEKYVLQGVTS...WGL..GCAQPM...........KP..........G
gi|301627689|gb|XP_002943002|   SGGPLVT......KT..NSLWWLVGDTS...WGD..GCANVY...........RP..........G
gi|58477045|gb|AAH89660|        SGGPHVT......PF..KGTYFVTGIVS...WGE..GCARKG...........KF..........G
gi|62751697|ref|NP_001015728|   SGGPHVT......PF..KGTYFVTGIVS...WGE..GCARKG...........KF..........G
gi|301622330|gb|XP_002940490|   SGGPLVC......QDg.RGRWEVHGIVS...FGPv.GCTVEN...........KP..........S
gi|301620762|gb|XP_002939724|   SGGPLVC......YK..GGQQFLVGVVT...FAS..GCGG-E...........PP..........A
gi|301614101|gb|XP_002936535|   SGGPLVT......QT..NGTWWLVGDTS...WGY..GCARAN...........KP..........G
gi|57032953|gb|AAH88892|        GGGPLAC......PA..GNSWYVVGVAS...FVV..LCGEMG...........HP..........G
gi|301620357|gb|XP_002939545|   SGGPLTC......ER..KGVSYIAGVVS...WGE..GCGLKD...........KP..........G
gi|58477078|gb|AAH89729|        SGGPLTC......ER..KGVSYIAGVVS...WGE..GCGLKD...........KP..........G
gi|58476369|gb|AAH89702|        GGGPLVT......YQ..NKQWNLVGVAS...FGF..GCGN-E...........NP..........A
gi|301624442|gb|XP_002941516|   GGGPLVC......SA..GGQWYLVGVII...FGT..GCGRKD...........YP..........G
gi|56585195|gb|AAH87729|        SGGPLNC......RAa.DGTWHVHGIAS...FVSglGCNALK...........KP..........T
gi|56971746|gb|AAH88036|        SGGPLNC......RAa.DGTWHVHGIAS...FVSglGCNALK...........KP..........T
gi|58332692|ref|NP_001011421|   SGGPLNC......RAa.DGTWHVHGIAS...FVSglGCNALK...........KP..........T
gi|301614099|gb|XP_002936522|   AGGPLVT......KT..NGTWWLVGDTS...WGV..GCAQPN...........TP..........G
gi|301627056|gb|XP_002942694|   SGGPLNC......KNt.DGAWEVHGVVS...FGSaaGCNYYK...........KP..........S
gi|301620744|gb|XP_002939732|   SGGPVSC......LK..DGLWYLVGVVS...FAA..GCGLPN...........RP..........G
gi|301627687|gb|XP_002943001|   SGGPLVT......KT..NSLWWLVGDTS...WGY..GCATAN...........KP..........G
gi|301620752|gb|XP_002939736|   GGGPLVC......SA..GGQWYLVGVII...FGT..GCGRKD...........YP..........G
gi|301620760|gb|XP_002939740|   GGGPLVT......YQ..NKQWNLVGVAS...FGF..GCGN-E...........NP..........A
gi|301614101|gb|XP_002936535|   SGGPLVT......KT..NGTWWLVGDTS...WGY..GCARAN...........KP..........G
gi|301612617|gb|XP_002935812|   SGGPLMC......QRs.NGQWIIVGITS...WGY..GCGRKG...........YP..........G
gi|57032843|gb|AAH88882|        SGGPLNC......PV..NGVYQVHGVTS...FVSssGCSTYL...........KP..........T
gi|58332834|ref|NP_001011493|   SGGPLNC......PV..NGVYQVHGVTS...FVSssGCSTYL...........KP..........T
gi|62531104|gb|AAH92553|        SGGPLNC......AV..NGVYQVHGIVS...FGSasGCNISR...........KP..........S
gi|71895833|ref|NP_001025669|   SGGPLNC......AV..NGVYQVHGIVS...FGSasGCNISR...........KP..........S
gi|113931254|ref|NP_001039074|  SGGPLVS......LGq.SSHWEQVGIVS...WGD..GCGRPN...........RV..........G
gi|89273918|gb|CAJ81839|        SGGPLVS......LGq.SSHWEQVGIVS...WGD..GCGRPN...........RV..........G
gi|301614097|gb|XP_002936534|   GGGPLVT......ET..NGTWWLVGETS...WGV..GCAQPN...........KP..........G
gi|187469575|gb|AAI67128|       SGGPLNC......PN..NGVYEVHGIAS...FVSslGCNAYL...........KP..........T
gi|301608337|gb|XP_002933738|   SGGPLNC......PN..NGVYEVHGIAS...FVSslGCNAYL...........KP..........T
gi|62859195|ref|NP_001016980|   SGGPLTC......TV..NGKAYLAAVVS...WGD..ECGAQN...........KP..........G
gi|89272057|gb|CAJ83340|        SGGPLTC......TV..NGKAYLAAVVS...WGD..ECGAQN...........KP..........G
gi|134023759|gb|AAI35327|       SGGAFIM......QDtdTKRWVAQGLVS...WGGpeECGSKQ...........VY..........G
gi|147901778|ref|NP_001090874|  SGGAFIM......QDtdTKRWVAQGLVS...WGGpeECGSKQ...........VY..........G
gi|301608335|gb|XP_002933737|   SGGPLNC......PV..NGVYQVHGVTS...FVAaaGCNTYL...........KP..........T
gi|161612048|gb|AAI56020|       SGGPLNC......PV..NGVYQVHGVTS...FVAaaGCNTYL...........KP..........T
gi|56971188|gb|AAH88782|        SGGPLNC......AV..NGVYQVHGIVS...FGSasGCNIVQ...........KP..........S
gi|58332812|ref|NP_001011481|   SGGPLNC......AV..NGVYQVHGIVS...FGSasGCNIVQ...........KP..........S
gi|66990056|gb|AAH98090|        SGGPLVCy.....DV..NNVAYVWGIVS...WGE..NCGVPG...........FP..........G
gi|73853846|ref|NP_001027508|   SGGPLVCy.....DV..NNVAYVWGIVS...WGE..NCGVPG...........FP..........G
gi|54035177|gb|AAH84139|        SGGALAF......MNaeSKKWFVGGIVS...WGV..GCGVAR...........QY..........G
gi|58332348|ref|NP_001011037|   SGGALAF......MNaeSKKWFVGGIVS...WGV..GCGVAR...........QY..........G
gi|56789096|gb|AAH88027|        SGGPLVC......KE..----ALAGIVS...FGF..N----H...........PP..........G
gi|353523845|ref|NP_001238808|  SGGPLVC......KE..----ALAGIVS...FGF..N----H...........PP..........G
gi|301610620|gb|XP_002934851|   SGGPLVC......KE..----ALAGIVS...FGF..N----H...........PP..........G
gi|301627008|gb|XP_002942673|   SGGPLNC......QGa.DGRWYVHGVAS...FVHgyGCNTLK...........KP..........S
gi|39794386|gb|AAH64208|        SGGPLVC......DG..----IAVAIVQ...GGFr.KCGNPT...........KP..........G
gi|45361487|ref|NP_989320|      SGGPLVC......DG..----IAVAIVQ...GGFr.KCGNPT...........KP..........G
gi|82237461|sp|Q6P326|          SGGPLVC......DG..----IAVAIVQ...GGFr.KCGNPT...........KP..........G
gi|301619167|gb|XP_002938973|   SAAPLMC......KRktSTIFSVIGIAS...WGS..GCSQIN...........SP..........G
gi|56789072|gb|AAH88011|        AGGPLIC......KG..----ELYGIIL...WGN..ECSGRG...........IP..........G
gi|58332288|ref|NP_001011293|   AGGPLIC......KG..----ELYGIIL...WGN..ECSGRG...........IP..........G
gi|113205726|ref|NP_001037931|  RGSPLMCrt....KK..NNVYSVIGILN...WGS..GCGQTR...........SP..........G
gi|89266985|gb|CAJ81306|        RGSPLMCrt....KK..NNVYSVIGILN...WGS..GCGQTR...........SP..........G
gi|301619169|gb|XP_002938974|   SAGPLMC......KI..KKVFSVIGIAS...WGS..GCSQIN...........SP..........G
gi|301623913|gb|XP_002941253|   SGGPLMFtdp...QD..SSKMYMAGIVS...WGPr.DCGT--...........-Y..........G
gi|163915777|gb|AAI57637|       SGGPLLY......RG..----IVVGITS...NGGk.KCGSSR...........KP..........G
gi|166158186|ref|NP_001107486|  SGGPLLY......RG..----IVVGITS...NGGk.KCGSSR...........KP..........G
gi|301626232|gb|XP_002942299|   SGGPLIC......KM..EERYYLVGVVS...WGS..SECNVN...........AP..........G
gi|66396569|gb|AAH96515|        SGGAYTT......QNk.QDTWVATGLVS...WGF..GCGQG-...........-Y..........G
gi|301623915|gb|XP_002941259|   SGGAYTT......QNk.QDTWVATGLVS...WGF..GCGQG-...........-Y..........G
gi|66396598|gb|AAH96508|        SGGPLMFtdp...QD..SSKMYMAGIVS...WGPr.DCGT--...........-Y..........G
gi|301618553|gb|XP_002938678|   SGGPLVCpst...SQ..SGIWEVHGITS...FGPi.GCIMDK...........KP..........S
gi|301619614|gb|XP_002939175|   SGGPLVC......QE..GGLWWQVGIVS...WGE..GCGRPN...........RP..........G
gi|301623919|gb|XP_002941255|   SGGAYTTp.....NK..QDTWVATGLVS...WGF..NCGQG-...........-Y..........G
gi|301623917|gb|XP_002941260|   SGGAYTT......QNk.QDTWVATGLVS...WGF..DCGRG-...........-Y..........G
gi|49899920|gb|AAH76933|        SGGPLVC......NG..----VIQGITS...FIIr.SCGNGV...........TP..........D
gi|55742037|ref|NP_001006847|   SGGPLVC......NG..----VIQGITS...FIIr.SCGNGV...........TP..........D
gi|163915656|gb|AAI57668|       SGGPLIC......GK..----EFSGIVS...FGK..KCGDPK...........YP..........G
gi|165973394|ref|NP_001107158|  SGGPLIC......GK..----EFSGIVS...FGK..KCGDPK...........YP..........G
gi|213627368|gb|AAI71196|       SGGPLIC......GK..----EFSGIVS...FGK..KCGDPK...........YP..........G
gi|301622373|gb|XP_002940514|   -------......--..-----------...---..------...........--..........-
gi|301623711|gb|XP_002941159|   SGGPLIC......NG..----SLRGLTS...FGMp.ECALPG...........DA..........S
gi|301609058|gb|XP_002934098|   SGGPMVT......QNhlNNHWYLAGTVS...WGV..GCGQYD...........KY..........G
gi|301607053|gb|XP_002933130|   SGGPMMC......QQ..NNEWFLVGVTS...FGY..GCAQPS...........RP..........G
gi|301620754|gb|XP_002939737|   GGGPLVC......YE..NDRWYLIGLVS...FGI..GCGS-S...........YP..........G
gi|301631044|gb|XP_002944619|   SGGPLNC......KNa.DGVWEVHGVVS...FGSasGCNINK...........KP..........S
gi|301629851|gb|XP_002944046|   SGGPLVC......NG..----ELHGITS...WGDl.VCGSPN...........KP..........G
gi|301629862|gb|XP_002944051|   -------......--..-----------...---..------...........--..........-
gi|301619787|gb|XP_002939269|   PGGPPAC......EK..DKKSHLWGIFP...WGK..RCGNPN...........KP..........G
gi|301627058|gb|XP_002942695|   -------......--..-----------...---..------...........--..........-
gi|301629849|gb|XP_002944045|   SGGPLVC......NE..----ELHGITS...WGDl.VCGSPD...........KP..........G
gi|301626232|gb|XP_002942299|   SGGPLVC......RRr.SGVWFLAGCVS...WGV..GCGRIWgdkktgrtqlgSP..........A
gi|301609784|gb|XP_002934450|   SGGPLAC......VV..DEIWYLTGITS...WGE..GCARPG...........KP..........G
gi|301631575|gb|XP_002944873|   SGGPLVC......QDg.RGRWEVHGIVS...FGPv.GCTVEN...........KP..........S
gi|301607830|gb|XP_002933508|   -------......--..-----------...---..------...........--..........-
gi|301620748|gb|XP_002939734|   SGGPLVC......SE..NNRWYLGGIVS...YGA..SCGKPY...........RP..........G
gi|301623709|gb|XP_002941155|   GGGPLIC......NR..----ILTGVIS...FGPl.ICGMEN...........GA..........N
gi|301609490|gb|XP_002934300|   SGGPLVC......ERs.GGSWIVYGVTS...WGY..GCGVKD...........SP..........G
gi|301607063|gb|XP_002933142|   YGGPLIC......EE..NRTHLVQGVII...PGR..GCAIQK...........RP..........V
gi|116487755|gb|AAI25706|       SGGPLVNl.....DG..----EVIGINT...---..------...........--..........-
gi|134023797|gb|AAI35435|       SGGPLVNl.....DG..----EVIGINT...---..------...........--..........-
gi|350276152|ref|NP_001072730|  SGGPLVNl.....DG..----EVIGINT...---..------...........--..........-
gi|301620766|gb|XP_002939742|   SGGPLVC......ST..NGQWFLAGVVS...FGE..GCGQAY...........RP..........G
gi|301609058|gb|XP_002934098|   SGGPMVT......QNhlNNHWYLAGTVS...WGV..GCGQYD...........KY..........G
gi|301606403|gb|XP_002932829|   SGGPLVNl.....DG..----EVIGINT...---..------...........--..........-
gi|163915807|gb|AAI57677|       SGGPLFC......NQ..----YLHGLVN...GGNe.KCTG--...........-P..........R
gi|166158294|ref|NP_001107513|  SGGPLFC......NQ..----YLHGLVN...GGNe.KCTG--...........-P..........R
gi|213624433|gb|AAI71092|       SGGPLFC......NQ..----YLHGLVN...GGNe.KCTG--...........-P..........R
gi|213625671|gb|AAI71088|       SGGPLFC......NQ..----YLHGLVN...GGNe.KCTG--...........-P..........R
gi|301620338|gb|XP_002939538|   SGGPLMC......KRmkAKTYYIVGIAS...WGG..LCGHSY...........RN..........G
gi|301622789|gb|XP_002940709|   SGGPLVC......RN..----RLEGAVS...FSGr.FCGNAM...........FP..........D
gi|301603859|gb|XP_002931606|   SGGPLMCkt....QK..SRTYAVVGITS...WGS..GCARGK...........KP..........G
gi|301618560|gb|XP_002938688|   SGGPLVNl.....DG..----EVIGINT...---..------...........--..........-
gi|49522408|gb|AAH75430|        TGGITTVllpsptSP..EGSWHLIGLVS...WGYd.KSCRKD...........LY..........T
gi|52345796|ref|NP_001004944|   TGGITTVllpsptSP..EGSWHLIGLVS...WGYd.KSCRKD...........LY..........T
gi|82183464|sp|Q6DIV5|          TGGITTVllpsptSP..EGSWHLIGLVS...WGYd.KSCRKD...........LY..........T
gi|301614097|gb|XP_002936534|   SGGPLVT......KT..NGTWWLVGDTS...WGI..GCARPN...........KP..........G
gi|301624064|gb|XP_002941330|   SGGPLVT......KT..NGTWWLVGDTS...WGY..GCAQPN...........KP..........G
gi|301631613|gb|XP_002944892|   -------......--..-----------...---..------...........--..........-
gi|301631166|gb|XP_002944677|   SGGPLVC......QA..NDAWTLVGIVS...WG-..------...........--..........-
gi|301614089|gb|XP_002936531|   YGGPLAC......LT..HDCWVLEGVIV...PAR..GCGKKN...........QP..........A
gi|301623570|gb|XP_002941088|   -------......--..-----------...---..------...........--..........-
gi|301618553|gb|XP_002938678|   AEGALFC......KSsaDAAWEIHGIAS...FGPs.DCVVDK...........KP..........P
gi|169642095|gb|AAI60801|       SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|288684101|ref|NP_001165762|  SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|301627723|gb|XP_002943019|   SGGSLFVhl....RG..RRRFFQVGVLS...FGIfnPCSRPG...........QRelpppgseprD
gi|169642366|gb|AAI60557|       EGGHLAV......QH..NGVWFLGGIMG...SWQ..PTLLNK...........GV..........F
gi|56789309|gb|AAH88065|        EGGHLAV......QH..NGVWFLGGIMG...SWQ..PTLLNK...........GV..........F
gi|313851093|ref|NP_001116189|  EGGHLAV......QH..NGVWFLGGIMG...SWQ..PTLLNK...........GV..........F
gi|301627727|gb|XP_002943021|   SGGPLII......PV..RRRYVQV----...---..------...........--..........-
gi|301620760|gb|XP_002939740|   SGGPLVC......AE..ANRWYLVGIVS...FGV..GCGQPN...........RP..........G
gi|301614097|gb|XP_002936534|   -------......--..-----------...---..------...........--..........-
gi|301632426|gb|XP_002945286|   SGGPVVC......NG..----ELQGVVS...WGY..GCAQRN...........YP..........G
gi|301603859|gb|XP_002931606|   -------......--..-----------...---..------...........--..........-
gi|169641896|gb|AAI60561|       -------......--..-----------...---..------...........--..........-
gi|187607137|ref|NP_001120287|  -------......--..-----------...---..------...........--..........-
gi|301613000|gb|XP_002936003|   SGGPVFS......SH..TG--ELLGIVA...SNT..------...........--..........-
gi|301620752|gb|XP_002939736|   TGRSLVC......PD..-----------...---..------...........--..........-
gi|301612998|gb|XP_002936002|   SGGPVFS......SH..TG--ELLGIVA...SNT..------...........--..........-
gi|160774415|gb|AAI55421|       SGSGVYVrmwkrqKQ..KWERKIIGIFSghqWVD..KDGDKQ...........DF..........N
gi|163915255|ref|NP_001106591|  SGSGVYVrmwkrqKQ..KWERKIIGIFSghqWVD..KDGDKQ...........DF..........N
gi|301618176|gb|XP_002938505|   SGSGIYIrlkepnKK..KWRRKIIAIYSghqWVD..VNNQQQ...........DY..........N
gi|301610794|gb|XP_002934945|   SGSGVYGrlwn..KG..RWVRKVIGIFSghqWVE..VFGQPR...........EY..........N
gi|301630837|gb|XP_002944523|   SGGPLNC......KNa.DGGWEVHGVVS...FGSsaGCNYAK...........KP..........S
gi|163916178|gb|AAI57579|       SGGPLTNl.....DG..----EVIGINT...MK-..------...........--..........-
gi|166158059|ref|NP_001107438|  SGGPLTNl.....DG..----EVIGINT...MK-..------...........--..........-
gi|163915732|gb|AAI57581|       SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|288684088|ref|NP_001165761|  SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|163915698|gb|AAI57530|       SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|166158009|ref|NP_001107414|  SGGPLINl.....DG..----EVIGINT...M--..------...........--..........-
gi|301618333|gb|XP_002938578|   -------......--..-----------...---..------...........--..........-
gi|49900216|gb|AAH76994|        SGGPLSSv.....EL..NNKVYLAGIVS...WGE..GCARRN...........KP..........G
gi|52346064|ref|NP_001005075|   SGGPLSSv.....EL..NNKVYLAGIVS...WGE..GCARRN...........KP..........G
gi|301612998|gb|XP_002936002|   EGGGIFA......AE..RDRLCLVGIIV...VP-..------...........--..........-
gi|301613000|gb|XP_002936003|   EGGGIFA......AE..RDRLCLVGIIV...VP-..------...........--..........-
gi|301630168|gb|XP_002944198|   SGGPLVN......LV..KRRY-------...---..------...........--..........-
gi|301615558|gb|XP_002937233|   -------......--..----------I...---..------...........--..........-


                                  250        260                                       
                                    |          |                                       
d1a5ia_                           VYTKVTN.YLGWIRDNM--hl................................
gi|62201369|gb|AAH93474|        VYTKVQY.YDSWIKQYI--..................................
gi|71895773|ref|NP_001025685|   VYTKVQY.YDSWIKQYI--..................................
gi|301620776|gb|XP_002939747|   VYTLVPA.YQSWLSS----y.................................
gi|45708911|gb|AAH67937|        VYTNVQY.YLTWIQEL---v.................................
gi|47575768|ref|NP_001001228|   VYTNVQY.YLTWIQEL---v.................................
gi|301620758|gb|XP_002939739|   VYVRVTA.YLDWIESYI--..................................
gi|301623566|gb|XP_002941080|   VYTKVCH.YIDWVNDIM--ed................................
gi|301620778|gb|XP_002939748|   VYTKVQY.YQDWLKTK---v.................................
gi|49670651|gb|AAH75423|        VYTKVCH.YIDWVNDIM--ed................................
gi|52345790|ref|NP_001004941|   VYTKVCH.YIDWVNDIM--ed................................
gi|49522964|gb|AAH75293|        VYTLVPA.YQSWLSS----y.................................
gi|54020930|ref|NP_001005710|   VYTLVPA.YQSWLSS----y.................................
gi|59808136|gb|AAH89741|        VYTKVCN.YVSWIQNTI--a.................................
gi|62752849|ref|NP_001015792|   VYTKVCN.YVSWIQNTI--a.................................
gi|301621490|gb|XP_002940084|   VYVRVSK.IRNWILDII--s.................................
gi|301628802|gb|XP_002943535|   VYAKVCN.YNSWIQSTI--a.................................
gi|111307978|gb|AAI21657|       VYTRVSR.YTEWIKENM--d.................................
gi|118403542|ref|NP_001072819|  VYTRVSR.YTEWIKENM--d.................................
gi|163916428|gb|AAI57199|       VYTRVSR.YTEWIKENM--d.................................
gi|159155191|gb|AAI54713|       VYTKVES.YVSWIKAHM--a.................................
gi|163915041|ref|NP_001106508|  VYTKVES.YVSWIKAHM--a.................................
gi|301626232|gb|XP_002942299|   VYTKVRL.FLTWIQ-----k.................................
gi|169642526|gb|AAI60565|       VYTRVAN.YMPWIKETI--..................................
gi|187607167|ref|NP_001120289|  VYTRVAN.YMPWIKETI--..................................
gi|301620740|gb|XP_002939730|   VNTLVTA.YVDWIKSK---v.................................
gi|49522964|gb|AAH75293|        VYTLVPA.YYSWV------i.................................
gi|54020930|ref|NP_001005710|   VYTLVPA.YYSWV------i.................................
gi|56611173|gb|AAH87759|        VYTKVCN.YLSWIRDTI--an................................
gi|58332122|ref|NP_001011209|   VYTKVCN.YLSWIRDTI--an................................
gi|301620750|gb|XP_002939735|   IYTRVSS.YIKWITG----v.................................
gi|301620756|gb|XP_002939738|   VYTRLTT.YYDWILS----y.................................
gi|301621490|gb|XP_002940084|   VYTRITS.VRNWIGQN---l.................................
gi|301620768|gb|XP_002939743|   VYTKVSS.FSSWINQY---..................................
gi|56541274|gb|AAH87610|        VYAKVCN.YNSWIQSTI--a.................................
gi|58332100|ref|NP_001011202|   VYAKVCN.YNSWIQSTI--a.................................
gi|58476395|gb|AAH89747|        FYVHVHR.MRKWIMKTV--e.................................
gi|62751950|ref|NP_001015797|   FYVHVHR.MRKWIMKTV--e.................................
gi|301623009|gb|XP_002940815|   VYTSVPA.YSAWLQEYI--..................................
gi|301609429|gb|XP_002934284|   VYSRITR.LVQWIESIT--..................................
gi|301628804|gb|XP_002943536|   VYAKVCN.YNSWIQSTI--a.................................
gi|301628800|gb|XP_002943534|   VYTKVCN.YNSWIQSTI--a.................................
gi|301623523|gb|XP_002941065|   IYTKICN.YIAWIQDTI--a.................................
gi|301614043|gb|XP_002936502|   VYSRITY.LRNWITA----h.................................
gi|301620764|gb|XP_002939741|   VYTLMPS.YTDWIVSY---a.................................
gi|56611148|gb|AAH87751|        VYAKVCN.YLGWVQDII--en................................
gi|58332104|ref|NP_001011204|   VYAKVCN.YLGWVQDII--en................................
gi|89269870|gb|CAJ83405|        VYTLVPN.FKSWLS-----s.................................
gi|166796549|gb|AAI58898|       VYTLVPN.FKSWLS-----s.................................
gi|167908783|ref|NP_001016055|  VYTLVPN.FKSWLS-----s.................................
gi|213627780|gb|AAI71053|       VYTLVPN.FKSWLS-----s.................................
gi|301623529|gb|XP_002941068|   IFAKVFN.YLNWISDIMQ-ne................................
gi|56611170|gb|AAH87830|        VYAKVCN.YLRWVQNII--en................................
gi|58332206|ref|NP_001011251|   VYAKVCN.YLRWVQNII--en................................
gi|58476361|gb|AAH89695|        VYTKVSR.YLDWIAQKM--..................................
gi|62751546|ref|NP_001015759|   VYTKVSR.YLDWIAQKM--..................................
gi|56270387|gb|AAH87611|        VYTLMPS.YTDWIVSY---a.................................
gi|58332094|ref|NP_001011195|   VYTLMPS.YTDWIVSY---a.................................
gi|301620770|gb|XP_002939744|   VYTLVPN.YRSWLS-----s.................................
gi|301623525|gb|XP_002941066|   VFAKVSN.YIDWISDVM--ene...............................
gi|56541161|gb|AAH87563|        VYTKVCN.YNSWIQSTI--a.................................
gi|58332102|ref|NP_001011199|   VYTKVCN.YNSWIQSTI--a.................................
gi|56971223|gb|AAH88079|        VYAKVCN.YLDWIKNIT--en................................
gi|58332720|ref|NP_001011435|   VYAKVCN.YLDWIKNIT--en................................
gi|56556311|gb|AAH87753|        IFAKVFN.YLNWISDIMQ-ne................................
gi|301620774|gb|XP_002939746|   VYTLVPA.YYSWV------i.................................
gi|301621490|gb|XP_002940084|   VYSRVTK.LKDWILDTV--a.................................
gi|301618335|gb|XP_002938574|   VYAKVCN.YLDWIKNIT--en................................
gi|301627387|gb|XP_002942851|   VFTRVSA.YNDWISEKI--a.................................
gi|51895949|gb|AAH80976|        VFTRVSA.YNDWISEKI--a.................................
gi|56118865|ref|NP_001008077|   VFTRVSA.YNDWISEKI--a.................................
gi|301618337|gb|XP_002938575|   VYAKVCN.YLDWIKNIT--en................................
gi|301611781|gb|XP_002935401|   VYARVTV.LRSWVDEIV--a.................................
gi|56971185|gb|AAH88769|        VYARVST.LRSWMDQIV--a.................................
gi|58743375|ref|NP_001011477|   VYARVST.LRSWMDQIV--a.................................
gi|301611783|gb|XP_002935402|   VYARVTV.LRSWVDEIV--a.................................
gi|301606691|gb|XP_002932950|   VYSNVNA.FLQWIYKQI--e.................................
gi|57870463|gb|AAH89075|        VYARVST.LRSWMDQTI--a.................................
gi|62751938|ref|NP_001015686|   VYARVST.LRSWMDQTI--a.................................
gi|301610206|gb|XP_002934644|   VYTSVQD.FEQWIFNK---t.................................
gi|159155760|gb|AAI54947|       IFAKVFN.YIDWINNIMQ-n.................................
gi|301632763|gb|XP_002945450|   IFAKVFN.YIDWINNIMQ-n.................................
gi|301623527|gb|XP_002941067|   IFAKVFN.YLNWISDIIQ-n.................................
gi|56611133|gb|AAH87787|        VYTRLSR.FTDWIRTTT--k.................................
gi|58332150|ref|NP_001011223|   VYTRLSR.FTDWIRTTT--k.................................
gi|301620772|gb|XP_002939745|   VYTLVPA.YQSWLSS----y.................................
gi|301614103|gb|XP_002936536|   VYGNMTT.FLDWIY-----lqm...............................
gi|60552068|gb|AAH91088|        VFSRVSE.FNSWISTTI--..................................
gi|301627389|gb|XP_002942852|   VFSRVSE.FNSWISTTI--..................................
gi|301623007|gb|XP_002940814|   VYTSVPA.YSAWIQEY---v.................................
gi|301612271|gb|XP_002935645|   IYSSIQY.FTEWINTK---l.................................
gi|301603857|gb|XP_002931605|   VYTSTKY.FIKWIASKV--e.................................
gi|301615211|gb|XP_002937069|   IYISTQY.FNEWIESKI--t.................................
gi|301615213|gb|XP_002937070|   IYISTQY.FNEWIESKI--t.................................
gi|301603863|gb|XP_002931607|   VYTSTKY.FIKWIASKV--e.................................
gi|301627010|gb|XP_002942670|   VFTRVSA.FNSWIQQTI--sen...............................
gi|56972340|gb|AAH88057|        VFTRVSA.FNSWIQQTI--sen...............................
gi|58332702|ref|NP_001011426|   VFTRVSA.FNSWIQQTI--sen...............................
gi|39850054|gb|AAH64277|        VYARVAV.LRSWVDEIV--a.................................
gi|301615217|gb|XP_002937076|   IYISTQY.FNEWIESKI--t.................................
gi|301630725|gb|XP_002944467|   VYTSVQD.FEQWIFNKT--s.................................
gi|60552029|gb|AAH91010|        VYTRVTR.YTNWIREHT--g.................................
gi|71896209|ref|NP_001025574|   VYTRVTR.YTNWIREHT--g.................................
gi|301620748|gb|XP_002939734|   VYGRSNA.FVDWITT----lv................................
gi|301615956|gb|XP_002937430|   VYTRVTS.FLDWIQETI--s.................................
gi|301622787|gb|XP_002940708|   VYTRVSS.YLPWIETVIR-q.................................
gi|56789422|gb|AAH88038|        VYTRVSS.YLPWIETVIR-q.................................
gi|56611135|gb|AAH87810|        VFTRVSE.YNDWVQEIMD-k.................................
gi|301624444|gb|XP_002941509|   VYTSVPY.YMDWIQEY---v.................................
gi|301615068|gb|XP_002937000|   VYTAVTS.YTDWIRANI--..................................
gi|301618415|gb|XP_002938616|   VYVRVSK.FIPWIQKTMN-q.................................
gi|301627689|gb|XP_002943002|   VYGNMTV.FLQWIYL----qmq...............................
gi|58477045|gb|AAH89660|        VYTKVSK.LHRWLKGVL--kkn...............................
gi|62751697|ref|NP_001015728|   VYTKVSK.LHRWLKGVL--kkn...............................
gi|301622330|gb|XP_002940490|   VFTKTST.YIPWIEA----t.................................
gi|301620762|gb|XP_002939724|   VYTSVSA.YLDWIKNYM--e.................................
gi|301614101|gb|XP_002936535|   VYGNMTT.FLGWIYL----qmr...............................
gi|57032953|gb|AAH88892|        VYTSVPY.YMDWIQEY---v.................................
gi|301620357|gb|XP_002939545|   VYAHTYR.FVQWIQNIMR-..................................
gi|58477078|gb|AAH89729|        VYAHTYR.FVQWIQNIMR-..................................
gi|58476369|gb|AAH89702|        VYTSVRA.YIDWIQQYM--..................................
gi|301624442|gb|XP_002941516|   VYTSVAP.HTEWIEKS---i.................................
gi|56585195|gb|AAH87729|        VFTRVSA.FNDWIDNIIR-n.................................
gi|56971746|gb|AAH88036|        VFTRVSA.FNDWIDNIIR-n.................................
gi|58332692|ref|NP_001011421|   VFTRVSA.FNDWIDNIIR-n.................................
gi|301614099|gb|XP_002936522|   VYGNMAM.FVEWIY-----lqm...............................
gi|301627056|gb|XP_002942694|   VFTRVSD.FNGWICETI--..................................
gi|301620744|gb|XP_002939732|   VNTLVPS.FSDWIVQN---..................................
gi|301627687|gb|XP_002943001|   VYGNVTV.FLEWIY-----lqm...............................
gi|301620752|gb|XP_002939736|   VYTSVAP.HTEWIEKS---i.................................
gi|301620760|gb|XP_002939740|   VYTSVRA.YIDWIQQYI--..................................
gi|301614101|gb|XP_002936535|   VYGNMTM.FSGWIYL----qmr...............................
gi|301612617|gb|XP_002935812|   VYTKVSK.FTPWIK-----k.................................
gi|57032843|gb|AAH88882|        VFTRVSA.YIGWINNNI--..................................
gi|58332834|ref|NP_001011493|   VFTRVSA.YIGWINNNI--..................................
gi|62531104|gb|AAH92553|        VFTRVSA.YIAWINN----..................................
gi|71895833|ref|NP_001025669|   VFTRVSA.YIAWINN----..................................
gi|113931254|ref|NP_001039074|  VYTDVQS.FLNWIYGVMK-..................................
gi|89273918|gb|CAJ81839|        VYTDVQS.FLNWIYGVMK-..................................
gi|301614097|gb|XP_002936534|   VYGNMTS.FLGWIY-----lqm...............................
gi|187469575|gb|AAI67128|       VFTRVSA.YIDWINSNI--..................................
gi|301608337|gb|XP_002933738|   VFTRVSA.YIDWINSV---..................................
gi|62859195|ref|NP_001016980|   VYILISA.YASWIQ-----g.................................
gi|89272057|gb|CAJ83340|        VYILISA.YASWIQ-----g.................................
gi|134023759|gb|AAI35327|       VYTKVSN.FVDWVDDKL--k.................................
gi|147901778|ref|NP_001090874|  VYTKVSN.FVDWVDDKL--k.................................
gi|301608335|gb|XP_002933737|   VFTRVSA.YIGWINANI--..................................
gi|161612048|gb|AAI56020|       VFTRVSA.YIGWINANI--..................................
gi|56971188|gb|AAH88782|        VFTRVSA.YIAWINS----..................................
gi|58332812|ref|NP_001011481|   VFTRVSA.YIAWINS----..................................
gi|66990056|gb|AAH98090|        VYTKVAH.YYEWISHQV--g.................................
gi|73853846|ref|NP_001027508|   VYTKVAH.YYEWISHQV--g.................................
gi|54035177|gb|AAH84139|        VYTKVTN.YLDWIEKTI--q.................................
gi|58332348|ref|NP_001011037|   VYTKVTN.YLDWIEKTI--q.................................
gi|56789096|gb|AAH88027|        VYARVGR.YLDWIKKTI--s.................................
gi|353523845|ref|NP_001238808|  VYARVGR.YLDWIKKTI--se................................
gi|301610620|gb|XP_002934851|   VYARVGR.YLDWIKKTI--s.................................
gi|301627008|gb|XP_002942673|   VFTRVSA.FNSWIQQTI--s.................................
gi|39794386|gb|AAH64208|        IYTLIEP.YKSWIMESM--..................................
gi|45361487|ref|NP_989320|      IYTLIEP.YKSWIMESM--..................................
gi|82237461|sp|Q6P326|          IYTLIEP.YKSWIMESM--..................................
gi|301619167|gb|XP_002938973|   IYTSTKD.FVKWMVEK---v.................................
gi|56789072|gb|AAH88011|        VYLKVCN.FTNWMQNIIN-n.................................
gi|58332288|ref|NP_001011293|   VYLKVCN.FTNWMQNIIN-n.................................
gi|113205726|ref|NP_001037931|  VYSPIQS.HIKWIVEKV--kn................................
gi|89266985|gb|CAJ81306|        VYSPIQS.HIKWIVEKV--kn................................
gi|301619169|gb|XP_002938974|   VFISTQS.FVKWMVDTI--..................................
gi|301623913|gb|XP_002941253|   LYTKVDN.YLDWIEETI--..................................
gi|163915777|gb|AAI57637|       LYTIISH.YASWIDTT---t.................................
gi|166158186|ref|NP_001107486|  LYTIISH.YASWIDTT---t.................................
gi|301626232|gb|XP_002942299|   VYTLTSA.FMDWISQHM--d.................................
gi|66396569|gb|AAH96515|        FYTKVSN.YVEWIKSYVG-e.................................
gi|301623915|gb|XP_002941259|   FYTKVSN.YVEWIKSYVG-e.................................
gi|66396598|gb|AAH96508|        LYTKVDN.YLDWIEETI--..................................
gi|301618553|gb|XP_002938678|   VFTRASA.HLDWIDQIIK-k.................................
gi|301619614|gb|XP_002939175|   VYTNLTE.VLDWVYH----rl................................
gi|301623919|gb|XP_002941255|   IYTKVSN.YVDWIKSYT--e.................................
gi|301623917|gb|XP_002941260|   FYTKVSN.YVEWIKSYIE-k.................................
gi|49899920|gb|AAH76933|        FFSRVSL.FRRFIDDAI--n.................................
gi|55742037|ref|NP_001006847|   FFSRVSL.FRRFIDDAI--n.................................
gi|163915656|gb|AAI57668|       IFTRLTArYLQWIRDVT--g.................................
gi|165973394|ref|NP_001107158|  IFTRLTArYLQWIRDVT--g.................................
gi|213627368|gb|AAI71196|       IFTRLTArYLQWIRDVT--g.................................
gi|301622373|gb|XP_002940514|   -------.-----------..................................
gi|301623711|gb|XP_002941159|   VYAKLNRnIIRWINKII--s.................................
gi|301609058|gb|XP_002934098|   VYSDVYK.SLDWIKE----kr................................
gi|301607053|gb|XP_002933130|   VYVRVTE.FTNWIKSFI--..................................
gi|301620754|gb|XP_002939737|   VYSSVPA.HMEWIRSFI--..................................
gi|301631044|gb|XP_002944619|   VFTRVSN.YNSWIDQ----..................................
gi|301629851|gb|XP_002944046|   IFAKVFN.YLNWISDIIQ-n.................................
gi|301629862|gb|XP_002944051|   -------.-----------..................................
gi|301619787|gb|XP_002939269|   GYPKISH.YLDWIN-----p.................................
gi|301627058|gb|XP_002942695|   -------.-----------y.................................
gi|301629849|gb|XP_002944045|   VFTKVSN.YIDWISDIM--ene...............................
gi|301626232|gb|XP_002942299|   IYSRVSS.LLEFL------r.................................
gi|301609784|gb|XP_002934450|   VYTRVSE.FTDWIIEHT--..................................
gi|301631575|gb|XP_002944873|   VFTKTST.YIPWIEA----t.................................
gi|301607830|gb|XP_002933508|   -------.-----------..................................
gi|301620748|gb|XP_002939734|   VNTFLPP.FIGWIESTV--..................................
gi|301623709|gb|XP_002941155|   VYTRLTSnYIKWIKKET--k.................................
gi|301609490|gb|XP_002934300|   VYTKVSA.FIPWIKSVT--n.................................
gi|301607063|gb|XP_002933142|   IFVRVAY.YAKWIHKIM--..................................
gi|116487755|gb|AAI25706|       -------.-----------lkvtagisfaipsdkirkflae............
gi|134023797|gb|AAI35435|       -------.-----------lkvtagisfaipsdkirkflae............
gi|350276152|ref|NP_001072730|  -------.-----------lkvtagisfaipsdkirkflae............
gi|301620766|gb|XP_002939742|   VYTLMPS.YTDWIVSN---..................................
gi|301609058|gb|XP_002934098|   VYSDVYK.SLDWIKE----ks................................
gi|301606403|gb|XP_002932829|   -------.-----------lkvtagisfaipsdrirqflae............
gi|163915807|gb|AAI57677|       LFTNVFS.HIEWINKIL--kn................................
gi|166158294|ref|NP_001107513|  LFTNVFS.HIEWINKIL--kn................................
gi|213624433|gb|AAI71092|       LFTNVFS.HIEWINKIL--kn................................
gi|213625671|gb|AAI71088|       LFTNVFS.HIEWINKIL--kn................................
gi|301620338|gb|XP_002939538|   VYTATQY.FKEWILDKIK-n.................................
gi|301622789|gb|XP_002940709|   VYTRVSS.YLPWIETVIR-q.................................
gi|301603859|gb|XP_002931606|   VYTSTKY.FIKWIASKV--e.................................
gi|301618560|gb|XP_002938688|   -------.-----------lkvaagisfaipsdritkfmte............
gi|49522408|gb|AAH75430|        GYTKVVT.FKEWLEKNMK-..................................
gi|52345796|ref|NP_001004944|   GYTKVVT.FKEWLEKNMK-..................................
gi|82183464|sp|Q6DIV5|          GYTKVVT.FKEWLEKNMK-..................................
gi|301614097|gb|XP_002936534|   VYGNMTI.FVEWIY-----lqm...............................
gi|301624064|gb|XP_002941330|   VYGNMTS.FLGWIYLQ---mr................................
gi|301631613|gb|XP_002944892|   -------.-----------v.................................
gi|301631166|gb|XP_002944677|   -------.-----------..................................
gi|301614089|gb|XP_002936531|   IFTRVSV.YVDWINKVMK-..................................
gi|301623570|gb|XP_002941088|   -------.-----------lla...............................
gi|301618553|gb|XP_002938678|   VFTRVSA.YKDWIENAIQ-ky................................
gi|169642095|gb|AAI60801|       -------.-----------kvtagisfaipsdrvclfldrsadkqk.......
gi|288684101|ref|NP_001165762|  -------.-----------kvtagisfaipsdrvclfldrsadkqk.......
gi|301627723|gb|XP_002943019|   FYIDIMQ.ILPWMRKHIG-de................................
gi|169642366|gb|AAI60557|       SFTKLSR.YNMWLKQN---..................................
gi|56789309|gb|AAH88065|        SFTKLSR.YNMWLKQN---..................................
gi|313851093|ref|NP_001116189|  SFTKLSR.YNMWLKQN---..................................
gi|301627727|gb|XP_002943021|   -------.-----------..................................
gi|301620760|gb|XP_002939740|   VYTRLNA.YLDWIESYV--p.................................
gi|301614097|gb|XP_002936534|   -------.-----------..................................
gi|301632426|gb|XP_002945286|   VYTKVCN.YNSWIQSTI--a.................................
gi|301603859|gb|XP_002931606|   -------.-----------anv...............................
gi|169641896|gb|AAI60561|       -------.-----------nptvrrtattlpwc....................
gi|187607137|ref|NP_001120287|  -------.-----------nptvrrtattlpwc....................
gi|301613000|gb|XP_002936003|   -------.-----------rdnttgatyphlnfsipviileealqry......
gi|301620752|gb|XP_002939736|   -------.-----------hkhg..............................
gi|301612998|gb|XP_002936002|   -------.-----------rdnttgatyphlnfsipviileealqry......
gi|160774415|gb|AAI55421|       VAVRI--.-----------tpl...............................
gi|163915255|ref|NP_001106591|  VAVRI--.-----------tpl...............................
gi|301618176|gb|XP_002938505|   VAVRIT-.-----------plkyaqicyw........................
gi|301610794|gb|XP_002934945|   VAVRLT-.-----------ppkyaqicyw........................
gi|301630837|gb|XP_002944523|   VFSRVSD.YNSWIEETM--tn................................
gi|163916178|gb|AAI57579|       -------.-----------vtagisfaipsgrvrlfldrsadkqk........
gi|166158059|ref|NP_001107438|  -------.-----------vtagisfaipsgrvrlfldrsadkqk........
gi|163915732|gb|AAI57581|       -------.-----------kvtagisfaipl......................
gi|288684088|ref|NP_001165761|  -------.-----------kvtagisfaipl......................
gi|163915698|gb|AAI57530|       -------.-----------kvtagisfai........................
gi|166158009|ref|NP_001107414|  -------.-----------kvtagisfai........................
gi|301618333|gb|XP_002938578|   -------.-----------q.................................
gi|49900216|gb|AAH76994|        VYTRVAM.MRDWIRDKT--g.................................
gi|52346064|ref|NP_001005075|   VYTRVAM.MRDWIRDKT--g.................................
gi|301612998|gb|XP_002936002|   -------.-----------lcwkanewvgltvacsishilen...........
gi|301613000|gb|XP_002936003|   -------.-----------lcwkanewvgltvacsishilen...........
gi|301630168|gb|XP_002944198|   -------.-----------igvmmltlt.........................
gi|301615558|gb|XP_002937233|   -------.-----------lggvtrltesglsmvdwhlikemkppatqeewqa


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0034885 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes