SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Trypsin-like serine proteases alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0037607 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1fiw.1               ttc...........................................................................
ENSBTAP00000004737  ..............................................................................
ENSBTAP00000033392  ..............................................................................
ENSBTAP00000012503  vcttk.........................................................................
ENSBTAP00000026272  dctdgsdekd....................................................................
ENSBTAP00000055274  qc............................................................................
ENSBTAP00000000958  cd............................................................................
ENSBTAP00000010989  qc............................................................................
ENSBTAP00000027425  mkwasslqvllllllagsrlhknl......................................................
ENSBTAP00000042983  crdgsdeq......................................................................
ENSBTAP00000028354  vtlk..........................................................................
ENSBTAP00000027417  mrqvlaavllllllrsvsgtrggea.....................................................
ENSBTAP00000037246  vatvlllglfrngigavaaeadscgm....................................................
ENSBTAP00000023479  cs............................................................................
ENSBTAP00000037407  llalalllslvsaa................................................................
ENSBTAP00000002505  recg..........................................................................
ENSBTAP00000054149  llqcnyks......................................................................
ENSBTAP00000000788  llqcnyks......................................................................
ENSBTAP00000050450  nf............................................................................
ENSBTAP00000050393  idsssfrf......................................................................
ENSBTAP00000028731  d.............................................................................
ENSBTAP00000009636  llalalllslvsaa................................................................
ENSBTAP00000009406  ekkqvqdqtekelfe...............................................................
ENSBTAP00000004648  rlckmdnv......................................................................
ENSBTAP00000013434  gp............................................................................
ENSBTAP00000001642  t.............................................................................
ENSBTAP00000050246  ssfg..........................................................................
ENSBTAP00000004986  lsvcdcprgrflats...............................................................
ENSBTAP00000053077  sptqeeped.....................................................................
ENSBTAP00000021967  clgvlasllilaapatmdaiktagp.....................................................
ENSBTAP00000028678  c.............................................................................
ENSBTAP00000012036  vslrc.........................................................................
ENSBTAP00000000958  aq............................................................................
ENSBTAP00000033941  gal...........................................................................
ENSBTAP00000012346  tngtn.........................................................................
ENSBTAP00000000958  e.............................................................................
ENSBTAP00000033942  fq............................................................................
ENSBTAP00000011204  alvgaa........................................................................
ENSBTAP00000036577  ehilnsc.......................................................................
ENSBTAP00000052308  tatyhhqp......................................................................
ENSBTAP00000001674  pqcessf.......................................................................
ENSBTAP00000024677  ..............................................................................
ENSBTAP00000016644  tlahrcll......................................................................
ENSBTAP00000015915  llsycallgtaf..................................................................
ENSBTAP00000048279  qsfde.........................................................................
ENSBTAP00000036408  evafsrd.......................................................................
ENSBTAP00000054627  greqhg........................................................................
ENSBTAP00000005227  qsfde.........................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000048972  ieiaeqaqpsvrlsip..............................................................
ENSBTAP00000055314  aeqaaqpgvrlsip................................................................
ENSBTAP00000006095  k.............................................................................
ENSBTAP00000007060  vipy..........................................................................
ENSBTAP00000024680  tfsfllasav....................................................................
ENSBTAP00000051470  klillfgiifleqsksatlslpkvstcgqspvksqplny.......................................
ENSBTAP00000055795  klillfgiifleqsksatlslpkvstcgqspvksqplny.......................................
ENSBTAP00000052308  lnnc..........................................................................
ENSBTAP00000021789  sqvv..........................................................................
ENSBTAP00000019098  ..............................................................................
ENSBTAP00000046176  sqardahlecgerpmfarg...........................................................
ENSBTAP00000005163  qkdq..........................................................................
ENSBTAP00000054336  llvmtlpclghsvpvtlgpgsgrelv....................................................
ENSBTAP00000020053  ptl...........................................................................
ENSBTAP00000005785  mplpafa.......................................................................
ENSBTAP00000002923  gfshea........................................................................
ENSBTAP00000020025  ..............................................................................
ENSBTAP00000027772  dtrade........................................................................
ENSBTAP00000027594  v.............................................................................
ENSBTAP00000009746  fcwchegyalqadgvscaptveypcgkipvlekrngs.........................................
ENSBTAP00000020127  vra...........................................................................
ENSBTAP00000010816  efslacgqvfl...................................................................
ENSBTAP00000054342  tssvevng......................................................................
ENSBTAP00000020123  lltfalgsvaqedqgnk.............................................................
ENSBTAP00000027052  stgkltv.......................................................................
ENSBTAP00000007806  f.............................................................................
ENSBTAP00000054089  scevstvdy.....................................................................
ENSBTAP00000020121  lvlvaa........................................................................
ENSBTAP00000052855  clq...........................................................................
ENSBTAP00000050470  wa............................................................................
ENSBTAP00000002847  tkq...........................................................................
ENSBTAP00000050126  lvallspt......................................................................
ENSBTAP00000011718  fpe...........................................................................
ENSBTAP00000046936  srv...........................................................................
ENSBTAP00000023055  l.............................................................................
ENSBTAP00000027207  llsvtgslawg...................................................................
ENSBTAP00000025122  sl............................................................................
ENSBTAP00000017401  p.............................................................................
ENSBTAP00000002912  gge...........................................................................
ENSBTAP00000017359  lvallspt......................................................................
ENSBTAP00000016545  yykmlhnttgvytcsaqgvwmnevlgrsqp................................................
ENSBTAP00000017363  lfptee........................................................................
ENSBTAP00000017013  rekslp........................................................................
ENSBTAP00000005550  lllvllllnsgykgdstkpacgqpwwpknldls.............................................
ENSBTAP00000025732  pefgs.........................................................................
ENSBTAP00000012471  vllclhsllphtkvagttdgppvsa.....................................................
ENSBTAP00000013262  mkpllllvafll..................................................................
ENSBTAP00000051933  lccpqasvasvtgsw...............................................................
ENSBTAP00000011362  ..............................................................................
ENSBTAP00000017607  ar............................................................................
ENSBTAP00000006358  cgtpsepf......................................................................
ENSBTAP00000006807  sfflcfllagtymtpec.............................................................
ENSBTAP00000055802  alca..........................................................................
ENSBTAP00000014364  qlllllmafl....................................................................
ENSBTAP00000045833  lpkl..........................................................................
ENSBTAP00000039032  pgswg.........................................................................
ENSBTAP00000007060  kygihavdlksietvles............................................................
ENSBTAP00000052108  llvaf.........................................................................
ENSBTAP00000054089  ff............................................................................
ENSBTAP00000031726  wvsealllpand..................................................................
ENSBTAP00000002709  alwag.........................................................................
ENSBTAP00000051578  q.............................................................................
ENSBTAP00000011737  llll..........................................................................
ENSBTAP00000046934  ..............................................................................
ENSBTAP00000054275  aarav.........................................................................
ENSBTAP00000046937  ..............................................................................
ENSBTAP00000021566  c.............................................................................
ENSBTAP00000054098  c.............................................................................
ENSBTAP00000047813  glltlisqstsp..................................................................
ENSBTAP00000052086  llll..........................................................................
ENSBTAP00000055933  lll...........................................................................
ENSBTAP00000048088  afflppglglagi.................................................................
ENSBTAP00000053944  lll...........................................................................
ENSBTAP00000051737  allsptg.......................................................................
ENSBTAP00000029273  pedlc.........................................................................
ENSBTAP00000042196  qswrlklfilgavvlteglqaaq.......................................................
ENSBTAP00000039959  clllip........................................................................
ENSBTAP00000009800  tlglcgmvwehkdg................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000023490  vvngipt.......................................................................
ENSBTAP00000008335  klpe..........................................................................
ENSBTAP00000055870  gd............................................................................
ENSBTAP00000030635  ahqvlfd.......................................................................
ENSBTAP00000052308  mig...........................................................................
ENSBTAP00000011042  nfiadvvekiapavvhielfrklpfskrevpvas............................................
ENSBTAP00000026804  ynfiadvvektapavvyieilgrhpfsgrevpisngsgfvva....................................
ENSBTAP00000004564  nfiasvvekvapsvvhlqlfrrdrsplgsedvpv............................................
ENSBTAP00000055424  ..............................................................................
ENSBTAP00000056087  ..............................................................................
ENSBTAP00000046935  ..............................................................................
ENSBTAP00000016767  cispfyrrlgssrrtclrtgkwsgrapscipicgktenvsap....................................
ENSBTAP00000009798  vsqltdpicgvgnmsanasa..........................................................
ENSBTAP00000042196  cvacgslrre....................................................................
ENSBTAP00000004732  ..............................................................................
ENSBTAP00000049751  pl............................................................................
ENSBTAP00000022878  nsek..........................................................................
ENSBTAP00000049751  sqgtcghr......................................................................
ENSBTAP00000018804  scgiqksniavtseegl.............................................................
ENSBTAP00000041742  i.............................................................................
ENSBTAP00000054780  kv............................................................................
ENSBTAP00000039011  ylks..........................................................................
ENSBTAP00000024541  ps............................................................................
ENSBTAP00000042824  lsqvfehmldvsqltdpicgvgnmsanasa................................................
ENSBTAP00000051417  d.............................................................................
ENSBTAP00000025894  cqhfcypgpesytcscarghklgqdrrsclphdrca..........................................
ENSBTAP00000054781  sgrrhqagamgeaqksrkgllspghhpqkklpalllghsadlrpgefvvaigspfalqntvttgivstaqrdgrelgl
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000020194  iygydsrfsifgkdflln............................................................
ENSBTAP00000037916  pvrrkrqvygtdsrfsildkkfl.......................................................
ENSBTAP00000047553  mklttskqfsmykhyfgkvtensvsvaicerlvhlsksvgfmkwdnngntgnatcfvfndgfiftcrhvlhlivgegt
ENSBTAP00000003767  mklttskqfsmykhyfgkvtensvsvaicerlvhlsksvgfmkwdnngntgnatcfvfndgfiftcrhvlhlivgegt
ENSBTAP00000053065  ler...........................................................................
ENSBTAP00000055732  lsxpep........................................................................
ENSBTAP00000047875  avlvec........................................................................
ENSBTAP00000054539  araalcrlhpdtaalaallppemgapwglplryrdpg.........................................
ENSBTAP00000047875  gqpea.........................................................................
ENSBTAP00000054539  gqpea.........................................................................
ENSBTAP00000055003  rvvgrwll......................................................................
ENSBTAP00000003182  vevhrllsglsdsvghlswhirksagssacfvwkglyistrrhvmyrtvgediesrecahthgqcvkgtfayekaede


                                                                                                    
                                                                                                    
d1fiw.1               ..............................................................................
ENSBTAP00000004737  ..............................................................................
ENSBTAP00000033392  ..............................................................................
ENSBTAP00000012503  ..............................................................................
ENSBTAP00000026272  ..............................................................................
ENSBTAP00000055274  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000010989  ..............................................................................
ENSBTAP00000027425  ..............................................................................
ENSBTAP00000042983  ..............................................................................
ENSBTAP00000028354  ..............................................................................
ENSBTAP00000027417  ..............................................................................
ENSBTAP00000037246  ..............................................................................
ENSBTAP00000023479  ..............................................................................
ENSBTAP00000037407  ..............................................................................
ENSBTAP00000002505  ..............................................................................
ENSBTAP00000054149  ..............................................................................
ENSBTAP00000000788  ..............................................................................
ENSBTAP00000050450  ..............................................................................
ENSBTAP00000050393  ..............................................................................
ENSBTAP00000028731  ..............................................................................
ENSBTAP00000009636  ..............................................................................
ENSBTAP00000009406  ..............................................................................
ENSBTAP00000004648  ..............................................................................
ENSBTAP00000013434  ..............................................................................
ENSBTAP00000001642  ..............................................................................
ENSBTAP00000050246  ..............................................................................
ENSBTAP00000004986  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000021967  ..............................................................................
ENSBTAP00000028678  ..............................................................................
ENSBTAP00000012036  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033941  ..............................................................................
ENSBTAP00000012346  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033942  ..............................................................................
ENSBTAP00000011204  ..............................................................................
ENSBTAP00000036577  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000001674  ..............................................................................
ENSBTAP00000024677  ..............................................................................
ENSBTAP00000016644  ..............................................................................
ENSBTAP00000015915  ..............................................................................
ENSBTAP00000048279  ..............................................................................
ENSBTAP00000036408  ..............................................................................
ENSBTAP00000054627  ..............................................................................
ENSBTAP00000005227  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000048972  ..............................................................................
ENSBTAP00000055314  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000024680  ..............................................................................
ENSBTAP00000051470  ..............................................................................
ENSBTAP00000055795  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000021789  ..............................................................................
ENSBTAP00000019098  ..............................................................................
ENSBTAP00000046176  ..............................................................................
ENSBTAP00000005163  ..............................................................................
ENSBTAP00000054336  ..............................................................................
ENSBTAP00000020053  ..............................................................................
ENSBTAP00000005785  ..............................................................................
ENSBTAP00000002923  ..............................................................................
ENSBTAP00000020025  ..............................................................................
ENSBTAP00000027772  ..............................................................................
ENSBTAP00000027594  ..............................................................................
ENSBTAP00000009746  ..............................................................................
ENSBTAP00000020127  ..............................................................................
ENSBTAP00000010816  ..............................................................................
ENSBTAP00000054342  ..............................................................................
ENSBTAP00000020123  ..............................................................................
ENSBTAP00000027052  ..............................................................................
ENSBTAP00000007806  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000020121  ..............................................................................
ENSBTAP00000052855  ..............................................................................
ENSBTAP00000050470  ..............................................................................
ENSBTAP00000002847  ..............................................................................
ENSBTAP00000050126  ..............................................................................
ENSBTAP00000011718  ..............................................................................
ENSBTAP00000046936  ..............................................................................
ENSBTAP00000023055  ..............................................................................
ENSBTAP00000027207  ..............................................................................
ENSBTAP00000025122  ..............................................................................
ENSBTAP00000017401  ..............................................................................
ENSBTAP00000002912  ..............................................................................
ENSBTAP00000017359  ..............................................................................
ENSBTAP00000016545  ..............................................................................
ENSBTAP00000017363  ..............................................................................
ENSBTAP00000017013  ..............................................................................
ENSBTAP00000005550  ..............................................................................
ENSBTAP00000025732  ..............................................................................
ENSBTAP00000012471  ..............................................................................
ENSBTAP00000013262  ..............................................................................
ENSBTAP00000051933  ..............................................................................
ENSBTAP00000011362  ..............................................................................
ENSBTAP00000017607  ..............................................................................
ENSBTAP00000006358  ..............................................................................
ENSBTAP00000006807  ..............................................................................
ENSBTAP00000055802  ..............................................................................
ENSBTAP00000014364  ..............................................................................
ENSBTAP00000045833  ..............................................................................
ENSBTAP00000039032  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000052108  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000031726  ..............................................................................
ENSBTAP00000002709  ..............................................................................
ENSBTAP00000051578  ..............................................................................
ENSBTAP00000011737  ..............................................................................
ENSBTAP00000046934  ..............................................................................
ENSBTAP00000054275  ..............................................................................
ENSBTAP00000046937  ..............................................................................
ENSBTAP00000021566  ..............................................................................
ENSBTAP00000054098  ..............................................................................
ENSBTAP00000047813  ..............................................................................
ENSBTAP00000052086  ..............................................................................
ENSBTAP00000055933  ..............................................................................
ENSBTAP00000048088  ..............................................................................
ENSBTAP00000053944  ..............................................................................
ENSBTAP00000051737  ..............................................................................
ENSBTAP00000029273  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000039959  ..............................................................................
ENSBTAP00000009800  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000023490  ..............................................................................
ENSBTAP00000008335  ..............................................................................
ENSBTAP00000055870  ..............................................................................
ENSBTAP00000030635  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000026804  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000055424  ..............................................................................
ENSBTAP00000056087  ..............................................................................
ENSBTAP00000046935  ..............................................................................
ENSBTAP00000016767  ..............................................................................
ENSBTAP00000009798  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000004732  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000022878  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000018804  ..............................................................................
ENSBTAP00000041742  ..............................................................................
ENSBTAP00000054780  ..............................................................................
ENSBTAP00000039011  ..............................................................................
ENSBTAP00000024541  ..............................................................................
ENSBTAP00000042824  ..............................................................................
ENSBTAP00000051417  ..............................................................................
ENSBTAP00000025894  ..............................................................................
ENSBTAP00000054781  rdsdmdyiqtdai.................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000020194  ..............................................................................
ENSBTAP00000037916  ..............................................................................
ENSBTAP00000047553  drkswpdiistcvkvtftykefcpndvdwlsfepwfm.........................................
ENSBTAP00000003767  drkswpdiistcvkvtftykefcpndvdwlsfepwfmvsgetldyailklsengngfppglsklifrqpsdgllylig
ENSBTAP00000053065  ..............................................................................
ENSBTAP00000055732  ..............................................................................
ENSBTAP00000047875  ..............................................................................
ENSBTAP00000054539  ..............................................................................
ENSBTAP00000047875  ..............................................................................
ENSBTAP00000054539  ..............................................................................
ENSBTAP00000055003  ..............................................................................
ENSBTAP00000003182  nkhcflerwfetpdveldhaalkvktqgqqepeglcdgkdpgpdsslvcvtgrpageakstdacavipqdqreekyle


                                                                10                   20         30  
                                                                 |                    |          |  
d1fiw.1               ..................................---DGPCGVR.....FRQN......XIIGGQDAA.HGAWPWMVS
ENSBTAP00000004737  ..................................----------.....----......-IVGGYTCG.ANTVPYQVS
ENSBTAP00000033392  ..................................----------.....----......-IVGGYTCG.ANTVPYQVS
ENSBTAP00000012503  ..................................----------.....--RT......RIVGGTNAS.WGEWPWQVS
ENSBTAP00000026272  ..................................----CDCGRRsf...TRQS......RVVGGENSD.QGEWPWQVS
ENSBTAP00000055274  ..................................----SHCGLR.....AMTG......RIVGGARAP.ESKWPWQVS
ENSBTAP00000000958  ..................................------CGLQpgw..KTAG......RIVGGVEAS.PGEFPWQVS
ENSBTAP00000010989  ..................................----SHCGLR.....AMTG......RIVGGARAP.ESKWPWQVS
ENSBTAP00000027425  ..................................---ASTCGQP.....RVSS......RIVGGRDAR.AGEWPWQAS
ENSBTAP00000042983  ..................................---HCDCGLQ.....GPLG......RIVGGAVSS.EGEWPWQAS
ENSBTAP00000028354  ..................................---CSACGLRt....GSSP......RIVGGNTSS.LAQWPWQAS
ENSBTAP00000027417  ..................................---LNACGRP.....RMLN......RMVGGQNAL.EGEWPWQVS
ENSBTAP00000037246  ..................................----------.....VPQG......RITGGTTAA.LGQWPWQVS
ENSBTAP00000023479  ..................................-----ECGAR.....PLAS......RIVGGQAAA.PGRWPWQAS
ENSBTAP00000037407  ..................................------PGQA.....LQRA......GIVGGQEAP.GSRWPWQVS
ENSBTAP00000002505  ..................................--------VRsdlitLSEE......RIIGGSKAE.KGDWPWQVS
ENSBTAP00000054149  ..................................------CGKKlvtq.EVSP......KIVGGSDSR.EGAWPWVVA
ENSBTAP00000000788  ..................................------CGKKlvtq.EVSP......KIVGGSDSR.EGAWPWVVA
ENSBTAP00000050450  ..................................--LHTCCGHRkit..RSGN......KIAGGMDAE.EGEWPWQAS
ENSBTAP00000050393  ..................................----SGCGHRkit..RSGN......KIAGGMDAE.EGEWPWQAS
ENSBTAP00000028731  ..................................----------.....---D......KIVGGYTCA.ENSVPYQVS
ENSBTAP00000009636  ..................................------PGQA.....LQRA......GIVGGQEAP.GSRWPWQVS
ENSBTAP00000009406  ..................................---------S.....YIEG......RIVEGQDAE.VGLSPWQVM
ENSBTAP00000004648  ..................................-------CTT.....KIKT......RIVGGTQSV.HGEWPWQIT
ENSBTAP00000013434  ..................................------CGTR.....FRQNrqggm.RIIGGQDAA.HGSWPWMVS
ENSBTAP00000001642  ..................................------CGLRqyk..RPQF......RIKGGLFAD.ITSHPWQAA
ENSBTAP00000050246  ..................................------CGVP.....AIDPvlsglsRIVNGEDAV.PGSWPWQVS
ENSBTAP00000004986  ..................................---CQDCGHRk....LPVD......RIVGGQDTS.LGRWPWQVS
ENSBTAP00000053077  ..................................----LDCGRP.....KPSA......RIVGGSDSQ.PGTWPWQVS
ENSBTAP00000021967  ..................................----PACGKR.....LQLN......RIVGGEDSS.DAEWPWVVS
ENSBTAP00000028678  ..................................----LACGQS.....VKAP......RVVGGKEAS.VDSWPWQVS
ENSBTAP00000012036  ..................................----IECGVSvkt..SRQS......RIVGGSNAY.SGEWPWQVS
ENSBTAP00000000958  ..................................---LPDCGLA.....PAAAlt....RIVGGSAAG.RGEWPWQVS
ENSBTAP00000033941  ..................................-----SCGVP.....TYPPqls...RVVGGEDAR.PNSWPWQVS
ENSBTAP00000012346  ..................................----------.....---G......FLPGGYTCI.PHSQPWQAA
ENSBTAP00000000958  ..................................------CGAR.....PALEkpt...RIVGGLGAS.LGEVPWQVS
ENSBTAP00000033942  ..................................---------P.....NLSA......RVVGGEDAI.PHSWPWQIS
ENSBTAP00000011204  ..................................----FGCGVP.....AIQPvlsglaRIVNGEDAV.PGSWPWQVS
ENSBTAP00000036577  ..................................------CGLGref..PSME......RIAYGNVAK.KADWPWQAS
ENSBTAP00000052308  ..................................----QGCGRR.....PRMSatyd..RIRGGSTAQ.EGEWPWQAS
ENSBTAP00000001674  ..................................-----DCGKPkvepkKCSG......RIVGGCVSK.PHSWPWQVS
ENSBTAP00000024677  ..................................----------.....----......-IVGGQECE.KHSQPWQVA
ENSBTAP00000016644  ..................................----LAMAQN.....QGNE......KIIGGYTCT.QGSQPWQAA
ENSBTAP00000015915  ..................................-----GCGVP.....AIQPvlsglsRIVNGEEAV.PGSWPWQVS
ENSBTAP00000048279  ..................................----------.....--FS......RVVGGEDAE.RGQFPWQVL
ENSBTAP00000036408  ..................................----VACGQR.....HVQG......KILGGVDAL.EGKWPWQAS
ENSBTAP00000054627  ..................................----------.....----......-TVGVHDAP.PGRWPWQAS
ENSBTAP00000005227  ..................................----------.....--FS......RVVGGEDAE.RGQFPWQVL
ENSBTAP00000049751  ..................................----------.....---S......RIVGGRPAA.EKKWPWQVS
ENSBTAP00000048972  ..................................----GPCGIQ.....GIQV......RVVGGNEAK.LGRWPWQGS
ENSBTAP00000055314  ..................................----GPCGQR.....VIPT......RIVGGKDAT.IGHWPWQGS
ENSBTAP00000006095  ..................................-----MCGRP.....VYSG......RVVGGKDAA.ATRWPWQVS
ENSBTAP00000007060  ..................................----GVCGIP.....PFSPqwlsr.RIAGGVEAC.PHCWPWQVG
ENSBTAP00000024680  ..................................--------AQ.....DDSD......KVRRDEECV.PHSQPWQVA
ENSBTAP00000051470  ..................................---------L.....NIFS......RIVGGRQVA.KGSYPWQVS
ENSBTAP00000055795  ..................................---------L.....NIFS......RIVGGRQVA.KGSYPWQVS
ENSBTAP00000052308  ..................................------CGTRrn...K--Tpgqsl.RIVGGTEVQ.EGEWPWQTS
ENSBTAP00000021789  ..................................----------.....----......RIVGGRDCA.EGECPWQAL
ENSBTAP00000019098  ..................................------CGIQ.....GIQV......RVVGGNEAK.LGRWPWQGS
ENSBTAP00000046176  ..................................----------.....AQYS......RITGGIEAG.VGEFPWQVS
ENSBTAP00000005163  ..................................----------.....-LDP......RIVDGQEAG.WGESPWQAV
ENSBTAP00000054336  ..................................----------.....----......GIVGGCDVS.ARSYLWQVS
ENSBTAP00000020053  ..................................----------.....---H......RIIGGTDTQ.EGGWPWQVS
ENSBTAP00000005785  ..................................----------.....-STE......RIVQGSEAAlEGEWPWQAS
ENSBTAP00000002923  ..................................----------.....--KE......KITNGTECI.PHSQPWQVG
ENSBTAP00000020025  ..................................------CGQR.....VIPT......RIVGGKDAT.IGHWPWQGS
ENSBTAP00000027772  ..................................----------.....-SSS......RIVNGTDCE.RNSQPWQAA
ENSBTAP00000027594  ..................................------CGLRllp..RRQK......RIIGGKNSL.RGSWPWQVS
ENSBTAP00000009746  ..................................----------.....KPQG......RIVGGHVCP.KGECPWQAM
ENSBTAP00000020127  ..................................----------.....-QEN......KVLEGKECK.PHSQPWQTA
ENSBTAP00000010816  ..................................----------.....----......KILGGHDSE.EGKWPWQVS
ENSBTAP00000054342  ..................................------CGKRvvp..LVSN......RIMSGEIAG.KAAWPWQAS
ENSBTAP00000020123  ..................................----------.....-SGE......KIIDGVPCP.RGSQPWQVA
ENSBTAP00000027052  ..................................---QACCGKRvvp..LVSN......RIMSGEIAG.KAAWPWQAS
ENSBTAP00000007806  ..................................-----QCGQKal...RPRF......KIVGGQVTN.AENQPWFAA
ENSBTAP00000054089  ..................................----GVCGIP.....PFSPqwlsr.RIAGGVEAC.PHCWPWQVG
ENSBTAP00000020121  ..................................-------AQA.....EEKD......KVLHGGPCE.QTSHPYQAA
ENSBTAP00000052855  ..................................------CGQK.....MNTSeksevlEIIGGVPAN.IRDFPWQIR
ENSBTAP00000050470  ..................................----------.....--DT......RAIGAKECR.PNSQPWQAG
ENSBTAP00000002847  ..................................-----DCGRRpaa..RMNK......RILGGRTSR.PGRWPWQCS
ENSBTAP00000050126  ..................................----------.....GEAG......KIIGGHEAK.PHSRPYMAF
ENSBTAP00000011718  ..................................----------.....-TNA......RVVGGTAVS.KNSWPSQIS
ENSBTAP00000046936  ..................................---STVCGKP.....KVMG......RIYGGRDVE.AGQWPWQAS
ENSBTAP00000023055  ..................................----------.....--RP......RIIGGSSSL.PGSHPWLAA
ENSBTAP00000027207  ..................................----------.....-GSS......RIINGEDCR.PHSQPWQAA
ENSBTAP00000025122  ..................................----------.....---N......RVVGGLVAL.PGAHPYIAA
ENSBTAP00000017401  ..................................----------.....--SS......RVVNGEDAV.PYSWSWQVS
ENSBTAP00000002912  ..................................----------.....---T......RIIKGYECP.PHSQPWQAA
ENSBTAP00000017359  ..................................----------.....GEAG......KIIGGHEAK.PHSRPYMAF
ENSBTAP00000016545  ..................................-TCLPVCGQPsrslpNLVK......RIIGGRNAE.PGLFPWQAL
ENSBTAP00000017363  ..................................----------.....--AG......RIIGGHKAK.PHSRPYMAF
ENSBTAP00000017013  ..................................-VCEPVCGIStr...TTEG......RIYGGQNAK.LGYFPWQVL
ENSBTAP00000005550  ..................................----------.....----......---------.-RHWPWEVS
ENSBTAP00000025732  ..................................------CGRT.....EIAEkkvk..RIFGGFKST.AGKHPWQAS
ENSBTAP00000012471  ..................................---VSSCGKT.....AVTG......KIIGGKNTV.DKRWPWQAG
ENSBTAP00000013262  ..................................-------TPR.....AKAG......EIIGGHEAK.PHSRPYMAY
ENSBTAP00000051933  ..................................---FRACGQT.....NISC......KNVNGKLVE.VGKWPWQVS
ENSBTAP00000011362  ..................................--CLPVCGKPlhpv.EQRQ......RIIGGLKAK.LGNFPWQAY
ENSBTAP00000017607  ..................................----------.....--AG......QIIGGREAR.PHSRPYMAY
ENSBTAP00000006358  ..................................----------.....RSTQ......RIFGGSIAK.IENFPWQVF
ENSBTAP00000006807  ..................................----------.....-FNM......EIIGGREVS.PHSRPFMAS
ENSBTAP00000055802  ..................................---------A.....QPRG......RILRGQEAP.SHSRPYMAS
ENSBTAP00000014364  ..................................--LPPGLGEP.....FLSE......EIIGGHEAK.PHSRPYMAF
ENSBTAP00000045833  ..................................-----SCGVKnnmh.IRRK......RVVGGKPAK.MGEFPWQMA
ENSBTAP00000039032  ..................................----------.....---A......QIIGGHEVT.PHSRPYMAS
ENSBTAP00000007060  ..................................----------.....RFFS......RISSWRNST.VGGHPWQVS
ENSBTAP00000052108  ..................................-----LLSPR.....ARAG......QIIGGREAR.PHSHPYMAY
ENSBTAP00000054089  ..................................----------.....---S......RISSWRNST.VGGHPWQVS
ENSBTAP00000031726  ..................................----------.....TSSN......FVASGAPCA.HGSQPWQVS
ENSBTAP00000002709  ..................................--------GN.....TFET......HIIGGRDAV.PHSRPYMVS
ENSBTAP00000051578  ..................................---CLACGQS.....VKAP......RVVGGKEAS.VDSWPWQVS
ENSBTAP00000011737  ..................................------LCCR.....TQAG......EIIGGTESK.PHSRPYMAY
ENSBTAP00000046934  ..................................----------.....----......---------.------QAS
ENSBTAP00000054275  ..................................----------.....----......EIVGGREAQ.PHSRPYVAS
ENSBTAP00000046937  ..................................----------.....----......---------.------QAS
ENSBTAP00000021566  ..................................---VPVCGRPvvpi.SQTR......ESLGASRAE.LGSFPWQAL
ENSBTAP00000054098  ..................................---VPVCGRPvvpi.SQTR......ESLGASRAE.LGSFPWQAL
ENSBTAP00000047813  ..................................----FACGFS.....YERD......PTLRDPESM.ARRWPWMVS
ENSBTAP00000052086  ..................................------LCCR.....TQAG......EIIEGTESK.PHSRPYMAY
ENSBTAP00000055933  ..................................-------GGP.....ALAS......EIVGGRAAR.PHAWPFIAS
ENSBTAP00000048088  ..................................----------.....FLSG......KIIGGHEAK.PHSRPYMVF
ENSBTAP00000053944  ..................................-------GGP.....ALAS......EIVGGRAAR.PHAWPFIAS
ENSBTAP00000051737  ..................................----------.....-EAG......KIIGGHEAK.PHSRPYMVF
ENSBTAP00000029273  ..................................----------.....---E......KIIGGNQVT.PHSRPYMVL
ENSBTAP00000042196  ..................................----RACGQR.....GPGP......PEPQEGNTM.PGEWPWQAS
ENSBTAP00000039959  ..................................-------GVF.....PVSCe.....GIIGGNEVA.PHTRRYMAL
ENSBTAP00000009800  ..................................----------.....----......-------TA.YHKQPWQAK
ENSBTAP00000006095  ..................................----------.....----......---------.-GQWPWQVS
ENSBTAP00000023490  ..................................----------.....----......---------.RTNVGWMVS
ENSBTAP00000008335  ..................................--CEAVCGKPkhpv.DQVQ......RIIGGSLDA.KGSFPWQAK
ENSBTAP00000055870  ..................................----------.....----......---------.---------
ENSBTAP00000030635  ..................................-----KCGKRvtrvdP--Lhskl..RVVGGQ---.PGNSPWTVS
ENSBTAP00000052308  ..................................----------.....----......---------.---------
ENSBTAP00000011042  ..................................----------.....----......---------.---------
ENSBTAP00000026804  ..................................----------.....----......---------.---------
ENSBTAP00000004564  ..................................----------.....----......---------.---------
ENSBTAP00000055424  ..................................----------.....----......-IVGGRKAR.PQELPFLAS
ENSBTAP00000056087  ..................................----------.....----......-IVGGRKAR.PQELPFLAS
ENSBTAP00000046935  ..................................------CGIS.....KVMG......RIYGGRDVE.AGRRLWQAS
ENSBTAP00000016767  ..................................----------.....----......------KTQ.GTRWPWQAA
ENSBTAP00000009798  ..................................----------.....----......---------.QERTPWHVT
ENSBTAP00000042196  ..................................----------.....----......---GPQAGA.PSPWPWDAR
ENSBTAP00000004732  ..................................----------.....----......---------.----PYLIY
ENSBTAP00000049751  ..................................----------.....----......-------AR.PRKWPWQVS
ENSBTAP00000022878  ..................................----------.....----......---------.---------
ENSBTAP00000049751  ..................................----------.....--KM......RIIGGMPAP.DRKWPWQVS
ENSBTAP00000018804  ..................................----------.....----......-------VE.EQEFPWVVS
ENSBTAP00000041742  ..................................----------.....----......---------.----PYMVY
ENSBTAP00000054780  ..................................----------.....--MG......RIYGGRDVE.AGQCLQQTR
ENSBTAP00000039011  ..................................----------.....----......---------.---------
ENSBTAP00000024541  ..................................----------.....----......---------.----PYLVY
ENSBTAP00000042824  ..................................----------.....----......---------.QERTPWHVT
ENSBTAP00000051417  ..................................------CGKPkvepkKCSG......RIVGGCVSK.PHSWPWQVS
ENSBTAP00000025894  ..................................------CGTL.....GPECc.....QRPQGSQQN.LLPFPWQVK
ENSBTAP00000054781  ..................................----------.....----......---------.---------
ENSBTAP00000053077  ..................................----------.....----......---------.---WPWLAE
ENSBTAP00000053077  ..................................----------.....----......----GRAPR.PGAWPWEAQ
ENSBTAP00000020194  ..................................----------.....----......---------.---YPFSTS
ENSBTAP00000037916  ..................................----------.....----......---------.-TNFPFNTA
ENSBTAP00000047553  ..................................----------.....----......---------.---------
ENSBTAP00000003767  hpegqikkidgcsvisleqrlerykehysdgvvp----------.....----......---------.---------
ENSBTAP00000053065  ..................................----------.....----......---------.---------
ENSBTAP00000055732  ..................................----------.....----......---------.---------
ENSBTAP00000047875  ..................................----------.....----......---------.---------
ENSBTAP00000054539  ..................................----------.....----......---------.---PPWAAA
ENSBTAP00000047875  ..................................----------.....----......---------.---------
ENSBTAP00000054539  ..................................----------.....----......---------.---------
ENSBTAP00000055003  ..................................----------.....----......---------.---------
ENSBTAP00000003182  ...............................hiq----------.....----......---------.---------


                                   40         50         60                70                       
                                    |          |          |                 |                       
d1fiw.1               LQIFTYH.......NN.RRYHVCGGSLLNSQ.WLLTAAHCFRIKK........KV......................T
ENSBTAP00000004737  LNS----.......--.-GYHFCGGSLINSQ.WVVSAAHC-----........YK......................S
ENSBTAP00000033392  LNS----.......--.-GYHFCGGSLINSQ.WVVSAAHC-----........YK......................S
ENSBTAP00000012503  LQV---K.......QR.AQSHLCGGSIIGRQ.WVLTAAHCFDGLL........LS......................N
ENSBTAP00000026272  LHA----.......-Q.GHGHLCGASLISPS.WMISAAHCFVDDRgfrys...EH......................S
ENSBTAP00000055274  LQF----.......--.SRTHICGGTLIDAQ.WILTAAHCFFITRek......IL......................E
ENSBTAP00000000958  LRE----.......--.NNEHFCGAAIISAR.WLVSAAHCFNEFQ........DS......................P
ENSBTAP00000010989  LQF----.......--.SRTHICGGTLIDAQ.WILTAAHCFFITRek......IL......................E
ENSBTAP00000027425  IQH----.......--.RGAHVCGGSLIAPQ.WVLTAAHCFPRKA........LP......................A
ENSBTAP00000042983  LQV----.......--.RGRHICGGALIADR.WVITAAHCFQEESma......SP......................A
ENSBTAP00000028354  LQF----.......--.QGYHLCGGSVITPL.WVVTAAHCVYDLY........LP......................K
ENSBTAP00000027417  IQR----.......--.NGSHFCGGSLITDR.WVLTAAHCFSNTS........ET......................S
ENSBTAP00000037246  INH----.......--.HGTHVCGGSLVSDQ.WVLSAAHCFPSDN........KI......................E
ENSBTAP00000023479  VTL----.......--.GSRHTCGASVLGPR.WVVTAAHCTHSFRls......RL......................S
ENSBTAP00000037407  LRV---S.......HQ.YWRHHCGGSLIHPQ.WVLTAAHCVGPEVh.......GP......................S
ENSBTAP00000002505  LQW----.......--.SSSHRCGGALISNR.WILSAAHCFRSHS........DP......................R
ENSBTAP00000054149  LYF----.......--.DDQQVCGASLVSRD.WLVSAAHCVYGRNm.......EP......................S
ENSBTAP00000000788  LYF----.......--.DDQQVCGASLVSRD.WLVSAAHCVYGRNm.......EP......................S
ENSBTAP00000050450  LQQ----.......--.KNVHRCGATLISNS.WLVTAAHCFLKAR........DP......................K
ENSBTAP00000050393  LQQ----.......--.KNVHRCGATLISNS.WLVTAAHCFLKAR........DP......................K
ENSBTAP00000028731  LNA----.......--.-GYHFCGGSLINDQ.WVVSAAHC-----........YQ......................Y
ENSBTAP00000009636  LRV---S.......RR.YWRHHCGGSLIHPQ.WVLTAAHCVGPEVh.......GP......................S
ENSBTAP00000009406  LFRK---.......-S.PQELLCGASLISDR.WVLTAAHCLLYPPwdknf...TV......................D
ENSBTAP00000004648  LHV---T.......SP.TQRHLCGGAIIGNQ.WILTAAHCFNEVK........SP......................N
ENSBTAP00000013434  LQIFTYH.......NN.RRYHVCGGSLLNAH.WLLTAAHCFRIKK........KV......................T
ENSBTAP00000001642  IFVKNRR.......SP.GERFLCGGILISSC.WVLSAAHCFQERY........PP......................H
ENSBTAP00000050246  LQT----.......-S.SGFHFCGGSLISED.WVVTAAHCGVSK-........--......................-
ENSBTAP00000004986  LRY----.......--.DGAHLCGGSVLSRD.WVLTAAHCFPERNr.......VL......................S
ENSBTAP00000053077  LHH----.......--.GGGHICGGSLIAPS.WVLSAAHCFVTNGtle.....PA......................A
ENSBTAP00000021967  IRK----.......--.NGTHHCAGSLLTSR.WVLTAAHCFKDNLd.......KP......................T
ENSBTAP00000028678  IQY----.......--.DKQHICGGSILDPH.WILTAAHCFWKHL........DV......................P
ENSBTAP00000012036  LHV----.......--.QGIHVCGGSIITPE.WIVTAAHCVEEPLn.......NP......................K
ENSBTAP00000000958  LWL----.......-R.RREHRCGAVLVAER.WLLSAAHCFDVYG........DP......................K
ENSBTAP00000033941  LQY--SS.......SG.QWRHTCGGSLIEQN.WVLTAAHCISSS-........--......................R
ENSBTAP00000012346  LKV----.......--.QGRLLCGGVLVHPK.WVLTAAHCLKDR-........--......................R
ENSBTAP00000000958  LKE----.......--.GSRHFCGATVVGDR.WLLSAAHCFNHT-........KV......................E
ENSBTAP00000033942  LQY--LR.......DN.TWRHTCGGTLITPN.HVLTAAHCISNT-........--......................L
ENSBTAP00000011204  LQD----.......-S.TGFHFCGGSLISED.WVVTAAHCGVT--........--......................T
ENSBTAP00000036577  LQV----.......--.DGIHFCGATLISEV.WLLTAAHCFDSYK........NP......................K
ENSBTAP00000052308  LKK----.......--.NGQHYCGASLISDR.YLLTAAHCFKNSQ........DP......................R
ENSBTAP00000001674  LRR----.......--.SSRHFCGGTLISPK.WVLTAAHCLDNIL........AL......................S
ENSBTAP00000024677  IYH----.......--.FSTFQCGGVLVAPQ.WVLTAAHC-----........KS......................D
ENSBTAP00000016644  LLQ----.......GP.QRRFLCGGSLLSDQ.WVITAAHC-----........AR......................P
ENSBTAP00000015915  LQD----.......-K.TGFHFCGGSLINEN.WVVTAAHCGVT--........--......................T
ENSBTAP00000048279  LHG----.......--.EIAAFCGGSIVNEK.WVVTAAHCIKPG-........--......................V
ENSBTAP00000036408  VHF----.......--.VGFHICGGSIIDEY.WILSAAHCFDRNR........NT......................E
ENSBTAP00000054627  LRRHSKE.......RE.QWEHVCGGFLVHLQ.WVLTAAHCTGRESr.......QA......................S
ENSBTAP00000005227  LHG----.......--.EIAAFCGGSIVNEK.WVVTAAHCIKPG-........--......................V
ENSBTAP00000049751  LQV----.......--.NQKHICGGSLIGSR.WVLTAAHCRIWEGslc.....SH......................V
ENSBTAP00000048972  LRW----.......--.NKVHSCGASLLNRR.WALSAAHCFEKNS........YP......................S
ENSBTAP00000055314  LRL----.......--.WGYHFCGASLLNRR.WALSAAHCFENNR........NP......................F
ENSBTAP00000006095  LQL----.......--.SNSHVCGGSLLSDR.WIVTAAHCLQMTR........IP......................F
ENSBTAP00000007060  LRF----.......--.LGNHQCGGAIINSI.WILTAAHCVQSKN........NP......................L
ENSBTAP00000024680  LFE----.......--.HGRFNCGASLISPQ.WVLSAAHC-----........QT......................R
ENSBTAP00000051470  LKQ----.......--.RQKHVCGGTIISPQ.WVITAAHCVANRN........TV......................S
ENSBTAP00000055795  LKQ----.......--.RQKHVCGGTIISPQ.WVITAAHCVANRN........TV......................S
ENSBTAP00000052308  LQW----.......--.DGIHRCGATLINDT.WLVSAAHCFRTYK........DP......................A
ENSBTAP00000021789  LVN----.......-E.ENEGFCGGTILNEF.YVLTAAHCLHQA-........--......................K
ENSBTAP00000019098  LRW----.......--.NKVHSCGASLLNRR.WALSAAHCFEKNS........YP......................S
ENSBTAP00000046176  IQA----.......--.RNEHFCGGAILNEW.WIITAAHCFYPEQl.......PP......................T
ENSBTAP00000005163  LLD----.......-S.KKKLVCGAVLIHVS.WVLTVAHCLDSR-........--......................K
ENSBTAP00000054336  LRFYNRT.......AG.LWIHFCGGSLIHPQ.WVLTAAHCVKPKSq.......KA......................S
ENSBTAP00000020053  LHF----.......--.VGSAYCGASVISRE.WLLSAAHCFHGSRls......DP......................T
ENSBTAP00000005785  LQLI---.......--.GAGHQCGASLISNT.WLLTAAHCFRRNK........DP......................N
ENSBTAP00000002923  LFE----.......--.GTRLRCGGVLIDRR.WVLTAAHC-----........SG......................S
ENSBTAP00000020025  LRL----.......--.WGYHFCGASLLNRR.WALSAAHCFENNR........NP......................F
ENSBTAP00000027772  LLV----.......-R.FNKLYCGAVLVDPQ.WLLTAAHC-----........RK......................Q
ENSBTAP00000027594  LRLK-SS.......HG.DGRLLCGATLLSSC.WVLTAAHCFKRYGn.......ST......................R
ENSBTAP00000009746  LKL----.......--.NGALLCGGTLVGPA.WVVSAAHCFERLR........SR......................G
ENSBTAP00000020127  LFQ----.......--.GVRLICGGVLIEDN.WVLTAAHC-----........QK......................K
ENSBTAP00000010816  LRV----.......--.RNRHVCGASLVTER.WVLTAGHCILSR-........--......................Y
ENSBTAP00000054342  LQH----.......--.NKIHQCGATLISNT.WLVTAAHCFKNKE........NP......................H
ENSBTAP00000020123  LLK----.......--.GSQLHCGGVLLNEQ.WVLTAAHC-----........KM......................N
ENSBTAP00000027052  LQH----.......--.NKIHQCGATLISNT.WLVTAAHCFKNKE........NP......................H
ENSBTAP00000007806  IYR-RHR.......GG.SITYLCGGSLISPC.WVVSATHCFIDHP........KK......................E
ENSBTAP00000054089  LRF----.......--.LGNHQCGGAIINSI.WILTAAHCVQSKN........NP......................L
ENSBTAP00000020121  LYT----.......--.AGHLLCGGVLIHPL.WVLTAAHC-----........KK......................P
ENSBTAP00000052855  ILE----.......--.NGSHLCGGSILSEW.WILTAAHCFKSKNa.......IR......................S
ENSBTAP00000050470  LFY----.......--.LTHLFCGATLISDR.WLLTAAHC-----........RK......................W
ENSBTAP00000002847  LQS----.......-E.PSGHICGCVLIAKK.WVLTVAHCFEGRE........NA......................A
ENSBTAP00000050126  LLF---K.......TS.GKSHICGGFLVRED.FVLTAAHC-----........LG......................S
ENSBTAP00000011718  LQY--KS.......GS.SWYHTCGGTLIKQK.WVMTAAHCVDSQ-........--......................M
ENSBTAP00000046936  LRF----.......--.QGSHICGAVLINSS.WLLSTAHCFLKKSk.......AP......................E
ENSBTAP00000023055  IYI----.......--.-GNNFCAGSLVHTC.WVVSAAHCFSNSP........PR......................E
ENSBTAP00000027207  LFL----.......--.ENEFFCGGVLVHPQ.WVLSAAHCFQ---........--......................K
ENSBTAP00000025122  LYW----.......--.-DQHFCAGSLIAPC.WVLTAAHCLQNRP........AP......................K
ENSBTAP00000017401  LQY--EK.......DG.AFHHTCGGSLIAPD.WVVTAGHCISTS-........--......................R
ENSBTAP00000002912  LFQ----.......--.KTRLLCGATLIAPR.WLLTAAHCRKPWV........-RgpgrgregrrlemerrrrvshfS
ENSBTAP00000017359  LQV---K.......TS.GKSHNCGGFLVRED.FVLTAAHCLGRP-........FL......................L
ENSBTAP00000016545  IVVEDTS.......RVpNDKWFGSGALLSES.WILTAAHVLRSQRrdntvtpvSK......................E
ENSBTAP00000017363  LQFKI--.......-S.GEPQRCGGFLVRED.FVLTAAHCLGSS-........LS......................T
ENSBTAP00000017013  LLG----.......--.--KTMAAGALLYDN.WILTAAHAVYDQRe.......DT......................A
ENSBTAP00000005550  LRV----.......--.GNEHVCGGALIDLK.WVVTAAHCIQGT-........--......................K
ENSBTAP00000025732  LQTSLRLtv.....ST.PQGHYCGGALIHPC.WVLTAAHCTEI--........KT......................K
ENSBTAP00000012471  LLY----.......--.QGMFICGASLISDY.WVISAAHCFQMSH........KP......................S
ENSBTAP00000013262  LQY---W.......NQ.DVQSRCGGFLVRQD.FVLTAAHC-----........NG......................S
ENSBTAP00000051933  ILF----.......--.LGMSICSGSLIHRQ.WVLTAAHCLQRSK........DP......................L
ENSBTAP00000011362  TNI----.......--.--HGPGGGALLGDR.WILTAAHTINPKDheaq....GS......................P
ENSBTAP00000017607  IQIR---.......SP.VGIKVCGGFLVRED.FVMTAAHCLGRFSf.......LC......................S
ENSBTAP00000006358  FSN----.......--.---PWAGGALIDEY.WVLTAAHVVEGN-........DI......................P
ENSBTAP00000006807  LQY----.......--.GGDHICGGVLIHPQ.WVLTAAHCHLRFA........KS......................Q
ENSBTAP00000055802  VQV----.......--.NGKHVCGGFLIAEQ.WVMSAAHCLEDV-........AD......................G
ENSBTAP00000014364  VQF---L.......GE.KSWKRCGGVLIQKD.FVLTAAHC-----........RG......................S
ENSBTAP00000045833  IKE----.......--.GDKIHCGGIYIGGC.WILTAAHCVRIS-........RM......................H
ENSBTAP00000039032  VKF----.......--.QGQHHCGGFLLRAR.WVVSAAHCFSGR-........DP......................G
ENSBTAP00000007060  LKL----.......--.GGHHFCGGSLIQDD.LVVTAVHCLIGLNek......QI......................K
ENSBTAP00000052108  IQTLT--.......-P.AGPTICGGFLVRED.FVMTAARC-----........LG......................S
ENSBTAP00000054089  LKL----.......--.GGHHFCGGSLIQDD.LVVTAVHCLIGLNek......QI......................K
ENSBTAP00000031726  LFN----.......--.GLSFHCAGVLVDRS.WVLTAAHCGNNK-........--......................-
ENSBTAP00000002709  LQK----.......-S.SGSHQCGGVLLHQN.WVLTAAHCLTQ--........PT......................Q
ENSBTAP00000051578  IQY----.......--.DKQHICGGSILDPH.WILTAAHCFWKHL........DV......................P
ENSBTAP00000011737  LQI--VT.......WH.GKLAACGGFLIRRD.FVLTAAHC-----........AG......................R
ENSBTAP00000046934  LRF----.......--.QGSNICGAVLINSS.WLLSTAHCFLKKSk.......AP......................E
ENSBTAP00000054275  LQL----.......-A.SGSHFCGGTLVHPS.FVLTAAHCLNNL-........NP......................Q
ENSBTAP00000046937  LRF----.......--.QGSNICGAVLINSS.WLLSTAHCFLKKSk.......AP......................E
ENSBTAP00000021566  TSI----.......--.--YGRGGGALLGDR.WVLTAAHTIYPKDsillg...RN......................R
ENSBTAP00000054098  TSI----.......--.--YGRGGGALLGDR.WVLTAAHTIYPKDsillg...RN......................R
ENSBTAP00000047813  VRA----.......--.NGTHICAGTLIASE.WVLTAAHCTTE--........SD......................V
ENSBTAP00000052086  LQI--VT.......WD.GKQKACGGFLIRRD.FVLMAAHC-----........AG......................R
ENSBTAP00000055933  LQR----.......--.RGGHFCGATLIARN.FVLSAAHCLNGL-........NF......................R
ENSBTAP00000048088  LQFKI--.......-S.GEPQRCGGFLVRED.FVLTAAHC-----........LG......................S
ENSBTAP00000053944  LQR----.......--.RGGHFCGATLIARN.FVLSAAHCLNGL-........NF......................R
ENSBTAP00000051737  LQFKI--.......-S.GEPQRCGGFLVRED.FVLTAAHC-----........LG......................S
ENSBTAP00000029273  L------.......--.DGGNICAGALIAKD.WVLTAAHCSLN--........--......................Q
ENSBTAP00000042196  VRR----.......--.QGIHICSGSLVADI.WVLTAAHCFEKEAmt......EL......................N
ENSBTAP00000039959  I------.......--.KGLKLCAGALIKEN.WVLTAAHCDLK--........--......................G
ENSBTAP00000009800  ISV--TR.......PS.KGHESCMGAIVSEY.FVLTAAHCFTVDD........EK......................H
ENSBTAP00000006095  IRQ----.......--.GLSHVCAASLISKQ.WVLTVASCFRSK-........DT......................R
ENSBTAP00000023490  LKY----.......--.RNKHICGGSLIKES.WILTARQCFPSRNk.......DL......................K
ENSBTAP00000008335  MVS----.......--.QHNLISGATLINER.WLLTTAKNLYLGHssdkkakdIT......................P
ENSBTAP00000055870  -------.......--.--------------.-------------........--......................S
ENSBTAP00000030635  LRN----.......-R.QGQHFCGGSLVKEQ.WVLTARQCFSSCHm.......SL......................V
ENSBTAP00000052308  -------.......--.----FCPSTSLGNR.WLLSAAHCFARKN........HS......................E
ENSBTAP00000011042  -------.......--.-----GSGFIVSEDgLIVTNAHVVTNK-........HR......................V
ENSBTAP00000026804  -------.......--.-----------ADG.LIVTNAHVVADR-........--......................R
ENSBTAP00000004564  -------.......--.---SSASGFIVSEDgLIVTNAHVLTNQ-........QR......................I
ENSBTAP00000055424  IQN----.......--.QGRHFCGGALIHPN.FVLTAASCFQSR-........NT......................G
ENSBTAP00000056087  IQN----.......--.QGRHFCGGALIHPN.FVLTAASCFQSR-........NT......................G
ENSBTAP00000046935  LWS----.......--.QGSHICGAVLINSS.WLLSTAHCFLKKGkeiq....SP......................V
ENSBTAP00000016767  IYRRAGGvhggglhKD.AWFLVCSGALVNER.TVVVAAHCVTDLGrvtvi...KT......................A
ENSBTAP00000009798  IKP----.......--.KSQETCRGALISDQ.WVLTAAHCFRNAE........DR......................T
ENSBTAP00000042196  LKH----.......--.QGKLACGGALVSEE.VVLTAAHCFIGRQ........TP......................E
ENSBTAP00000004732  LKS----.......--.-DYLPCVGVLIHPL.WVITAANC-----........NL......................P
ENSBTAP00000049751  LQI----.......--.NNVHKCGGSLIAPR.WVLTSAHCVRGSHyingpqr.D-......................-
ENSBTAP00000022878  -------.......--.---DTCLGTLIHKQ.WVLTAAHCFLPF-........--......................L
ENSBTAP00000049751  LQI----.......--.NNEHVCGGSLIAPQ.WVLTAAHCIFGPVvrgll...GF......................E
ENSBTAP00000018804  LQD----.......-S.QYTHLTFGSILSEF.WILSIASTFQNR-........--......................K
ENSBTAP00000041742  LQS----.......--.-FPEPCVGTLIHPQ.WVLTAAHC-----........-P......................S
ENSBTAP00000054780  LQS----.......--.QGSHVCGAVLINSR.WVVGSLRKGKEIQ........SP......................V
ENSBTAP00000039011  -------.......--.-SYKSCMGTLIAPQ.WVITAAHCFLPD-........--......................L
ENSBTAP00000024541  LKS----.......--.-HFNPCVGVLIKSN.WVLAPAHC-----........YL......................P
ENSBTAP00000042824  IKP----.......--.KSQETCRGALISDQ.WVLTAAHCFRNAE........DR......................T
ENSBTAP00000051417  LRR----.......--.SSRHFCGGTLISPK.WVLTAAHCLDNIL........AL......................S
ENSBTAP00000025894  LTN----.......-S.EGKDFCGGVLIQDN.FVLTTATCSLLY-........--......................A
ENSBTAP00000054781  -------.......--.--------------.-------------........--......................-
ENSBTAP00000053077  VHV----.......--.AGERVCAGVLVAPG.WVLAATHCVLRPGst......TV......................P
ENSBTAP00000053077  VMV----.......--.PGSRPCYGALVSES.WVLAPASCFPGHIssarpps.DL......................D
ENSBTAP00000020194  VKL----.......--.--STGCTGTLVAEK.HVLTAAHCIHDGKty......VK......................G
ENSBTAP00000037916  VKL----.......--.--STGCSGILISPN.HVLTAAHCVHDGNgy......IK......................G
ENSBTAP00000047553  -------.......--.--------------.-------------........--......................-
ENSBTAP00000003767  -------.......--.--------------.-------------........--......................-
ENSBTAP00000053065  -------.......--.--------------.-------------........--......................-
ENSBTAP00000055732  -------.......--.--------------.-------------........--......................-
ENSBTAP00000047875  -------.......--.-GSVWGSGVAVAPH.LVVTCRHVAPRE-........--......................-
ENSBTAP00000054539  AVLVE--.......--.CGSVWGSGVAVAPH.LVVTCRHVAPRE-........--......................-
ENSBTAP00000047875  -------.......--.-GSWSCSGVILNRR.-------------........--......................-
ENSBTAP00000054539  -------.......--.-GSWSCSGVILNRR.-------------........--......................-
ENSBTAP00000055003  -------.......--.----VCSGTV----.-------------........--......................-
ENSBTAP00000003182  -------.......--.--------------.-------------........--......................-


                             80                                                     90       100    
                              |                                                      |         |    
d1fiw.1               DWRLIFGAKEVEWGTNKP.............................................VKPPLQERYVEKIII
ENSBTAP00000004737  GIQVRLGEDNINVVEG--.............................................---NEQFISASKSIV
ENSBTAP00000033392  GIQVRLGEDNINVVEG--.............................................---NEQFISASKSIV
ENSBTAP00000012503  IWRIYGGILNLSEITT--.............................................---ETSFSQIKEIIV
ENSBTAP00000026272  VWTAFLGLHDQSKRNA--.............................................--PGVQERGLQRIIK
ENSBTAP00000055274  GWKVYVGTNDLHHLPE--.............................................------SASVAQIII
ENSBTAP00000000958  EWVAYVGTTYLSGSEA--.............................................---SMVRARVARIIT
ENSBTAP00000010989  GWKVYVGTNDLHHLPE--.............................................------SASVAQIII
ENSBTAP00000027425  DYRVRLGAPHLGPSSP--.............................................---PALLAPVRRVLL
ENSBTAP00000042983  LWTVFLGKVWQSSRWP--.............................................---GEVSFKVSRLLL
ENSBTAP00000028354  SWTIQVGLVSLLDSPA--.............................................-----PSHLVEKIIY
ENSBTAP00000027417  LYQVLLGVLQLARPGP--.............................................---HAVYARVKRVES
ENSBTAP00000037246  EYEVKLGAHQLDYFST--.............................................---DTQVRGVAQVIS
ENSBTAP00000023479  SWRVHAGLVSHSTVR---.............................................---PHQGAVVQRIIT
ENSBTAP00000037407  YFRVQLREQHLYYQD---.............................................-----QLLPISRIIP
ENSBTAP00000002505  QWIATFGTSTISPQL---.............................................------RVGVRNILI
ENSBTAP00000054149  KWKAVLGLHMASNLTS--.............................................--PQIETRLIDQIVI
ENSBTAP00000000788  KWKAVLGLHMASNLTS--.............................................--PQIETRLIDQIVI
ENSBTAP00000050450  QWNVSFGLLLSD------.............................................---PQIQRSVKDIII
ENSBTAP00000050393  QWNVSFGLLLSD------.............................................---PQIQRSVKDIII
ENSBTAP00000028731  HIQVRLGEYNIDVLEG--.............................................---GEQFIDASKIIR
ENSBTAP00000009636  YFRVQLREQHLYYQD---.............................................-----QLLPISRIIP
ENSBTAP00000009406  DLLVRIGKHSRTRYER--.............................................--KVEKISMLDKIYI
ENSBTAP00000004648  VLRVYSGILNQSEIKE--.............................................---DTSFFGVQEIII
ENSBTAP00000013434  DWRLIFGAKEVEWGSNKP.............................................VKPPLQERYVEKIII
ENSBTAP00000001642  HLKVFLGRTYRLVPGE--.............................................---EEQTFEVEKYII
ENSBTAP00000050246  ------GTTFTSQPQDSGs............................................GPPPSQYRRTAQVFE
ENSBTAP00000004986  RWRVFAGAVAQTSPHG--.............................................-----VQLGVQAVIY
ENSBTAP00000053077  EWSVVLGVHSQDGPLD--.............................................---GAHVRAVAAILV
ENSBTAP00000021967  QFSVLLGAWQLGNPGP--.............................................---RSQEVGIAWAQP
ENSBTAP00000028678  NWKVRAGSDRLGSFP---.............................................------SLPVAKIFI
ENSBTAP00000012036  IWVAFAGILKQSYMF---.............................................---YGSGYRVAKVIS
ENSBTAP00000000958  QWAAFLGTPFLSGADG--.............................................-----QLERVARIHK
ENSBTAP00000033941  TYRVVVGRQSLSTVES--.............................................---GSLTIAVSKSVI
ENSBTAP00000012346  GYRVYLGKHVLARVEA--.............................................---GEQVREVARAIP
ENSBTAP00000000958  LVRAQLGTASLSGVGG--.............................................---SPVKVGLRRVVL
ENSBTAP00000033942  TYRVALGKNNLEVEDE--.............................................--AGSLYVGVDTIFV
ENSBTAP00000011204  SDVVVAGEFDQGLQTE--.............................................---DTQVLKIGKVFK
ENSBTAP00000036577  RWTASFGTTLSPALM---.............................................------RQEVQSVVI
ENSBTAP00000052308  NYTVTFGTRVNL------.............................................---PYMQHYVQQIFI
ENSBTAP00000001674  FYKVILGAHNEKVREQ--.............................................---SVQEIPVSRLFR
ENSBTAP00000024677  NYQVWLGRHNLFEDED--.............................................---TAQFAGVSEDFP
ENSBTAP00000016644  ILRVALGKHNLKIPEA--.............................................---TQQVLRVVRKVP
ENSBTAP00000015915  SDVVVAGEFDQGSSSE--.............................................---KIQKLKIAKVFK
ENSBTAP00000048279  KITVVAGEHNTEKPEP--.............................................---TEQKRNVIRAIP
ENSBTAP00000036408  AFDMYVGLVDLNVAGN--.............................................---HTQWFEVNRVII
ENSBTAP00000054627  AFRVQVGQLRLYDPDR--.............................................------LMKVTEIIP
ENSBTAP00000005227  KITVVAGEHNTEKPEP--.............................................---TEQKRNVIRAIP
ENSBTAP00000049751  EYTVKMGITQLQQTST--.............................................---MAVTVPVQDIVI
ENSBTAP00000048972  EWSVQFGELSATPSIW-S.............................................LRAFLRRYGVQDIIT
ENSBTAP00000055314  HWSVQFGELSAAPSI-WN.............................................LQAYYNRYNVDQIFL
ENSBTAP00000006095  LYTVQLGSVERDNLD---.............................................---EGVILRVSQIVI
ENSBTAP00000007060  FWTIVAGDHDITLKES--.............................................---TEQVRRAKHIVM
ENSBTAP00000024680  FLRVRLGEHNLRKRDG--.............................................---PEQLRTVSRIIP
ENSBTAP00000051470  TFNVTAGEYDLRYVEP--.............................................---GEQTLTIETIII
ENSBTAP00000055795  TFNVTAGEYDLRYVEP--.............................................---GEQTLTIETIII
ENSBTAP00000052308  RWTASFGVTIYPPKM---.............................................------RRALRRIIV
ENSBTAP00000021789  RFTVRVGDRNTEQEEG--.............................................---NEMAHEVEMTVK
ENSBTAP00000019098  EWSVQFGELSATPSIW-S.............................................LRAFLRRYGVQDIIT
ENSBTAP00000046176  DLRVVLGTNSLTSPSL--.............................................-----EIKGVTTIIR
ENSBTAP00000005163  KLIVRLGEYDMRRWES--.............................................---WEVDLDIKEVII
ENSBTAP00000054336  TIRVQVGQLRLYDHDE--.............................................------LTKVSKIVQ
ENSBTAP00000020053  PWTAHLGMNVQGNAK---.............................................-----FISPVRRIVV
ENSBTAP00000005785  RWIVTFGITITP------.............................................---PAVKRSLRKIII
ENSBTAP00000002923  RYWVRLGEHSLSKLDW--.............................................---TEQIRRSGLSVT
ENSBTAP00000020025  HWSVQFGELSAAPSI-WN.............................................LQAYYNRYNVDQIFL
ENSBTAP00000027772  FFRVRLGHHSLSPMYE--.............................................--SGQQLLKGIKSIP
ENSBTAP00000027594  NYVVRVGDYHTLVPEE--.............................................---FEEEIRVEQIVT
ENSBTAP00000009746  NLTAVLGEHDLSRVEG--.............................................---PEQERRVAQIIV
ENSBTAP00000020127  KYVVRMGEHSLKKKDE--.............................................---SEQERAVARSIP
ENSBTAP00000010816  QYSVTMGDRKLQGTL---.............................................---SGLVVPVSRVVV
ENSBTAP00000054342  QWTVSFGTK----INP--.............................................---PLMKRNIKRIIV
ENSBTAP00000020123  EYNVHMGSVRLVGGQ---.............................................------KIKATRSFR
ENSBTAP00000027052  QWTVSFGTK----INP--.............................................---PLMKRNIKRIIV
ENSBTAP00000007806  NYIVYLGQSRLNSDTR--.............................................---GEMQFEVEKLIL
ENSBTAP00000054089  FWTIVAGDHDITLKES--.............................................---TEQVRRAKHIVM
ENSBTAP00000020121  NLQVFLGKHNLQQREF--.............................................---FQEESSVIRTVA
ENSBTAP00000052855  TLEVTHGEENLDTQNL--.............................................-----TKIKVDKLII
ENSBTAP00000050470  YLWVRLGEHHLWKWEG--.............................................---PEQLFRATDFFP
ENSBTAP00000002847  VWKVVFGINNLDHPST--.............................................---FMQMRLVKTIIL
ENSBTAP00000050126  SINVTLGAHNIMERER--.............................................---TQQVIPVRRPIP
ENSBTAP00000011718  TFRVVLGDHNLSQNDG--.............................................---TEQYISVQKIVV
ENSBTAP00000046936  NYQVLLGSIQLYQHTP--.............................................---QTREVSVSRIIT
ENSBTAP00000023055  SVSVVLGQHFFNRTTD--.............................................---VTQTFGIEKYIP
ENSBTAP00000027207  SYTIGLGLHSLEADQE--.............................................--PGSQMIEAHLSIQ
ENSBTAP00000025122  ELTVVLGQDRHNQSCE--.............................................---QCQTLAVRDYRL
ENSBTAP00000017401  TYQVVLGEYDRSVLEGSE.............................................---QVIPINAGDLFV
ENSBTAP00000002912  RYVVHLGAHSLGRQDG--.............................................---CEQTRTATKSFP
ENSBTAP00000017359  SINVTLGAHNIMERER--.............................................---KQQVIPMRRAIP
ENSBTAP00000016545  HVTVHLGLHDVRDKS---.............................................---GAVNSSAARVVL
ENSBTAP00000017363  SINVTLGAHNIKEREM--.............................................---TQQVIPVRRPIP
ENSBTAP00000017013  SLQIRMGALKRISPNY--.............................................-----TQAWAEAIFI
ENSBTAP00000005550  EYSVILGTSKLKPPNS--.............................................--TRTLLIPVRDIIM
ENSBTAP00000025732  YLKVVLGDQDLTKTEF--.............................................---HEQSFGVQKIFK
ENSBTAP00000012471  DYKILLGYYQLEKPTS--.............................................---YSQLAAVYRLFI
ENSBTAP00000013262  SIKVTLGAHNIKQQER--.............................................---TQQVIRVRRAIS
ENSBTAP00000051933  SYSVKMGVQSLLENGT--.............................................------ERQVARITI
ENSBTAP00000011362  NIDVFLGHINVEDIT---.............................................---KLSNHPVRRVII
ENSBTAP00000017607  QINVILGAHNIRTLES--.............................................---TQQRIPVLRSIP
ENSBTAP00000006358  VMYVGSSSVVTSQLS---.............................................---NAQMLTAERVFI
ENSBTAP00000006807  SSKVVLGAHSLSKNEA--.............................................---SKQTFEIKKFIR
ENSBTAP00000055802  KVQVLLGAHSLSQPEP--.............................................---SKRLYDVLRVVP
ENSBTAP00000014364  SINVTLGAHNIKQQER--.............................................---TQQVIQVKRAIH
ENSBTAP00000045833  RYQIWTSFTDWLRPGF--.............................................---QTVVHSVNRIII
ENSBTAP00000039032  TGLVVLGAHALRTKEA--.............................................---TQQVFSISAVIT
ENSBTAP00000007060  SLTVTAGEYNLFQKDK--.............................................---EEQNIPVSKIII
ENSBTAP00000052108  QINVILGIHSVTASEW--.............................................---TQQRIPVLRPIP
ENSBTAP00000054089  SLTVTAGEYNLFQKDK--.............................................---EEQNIPVSKIII
ENSBTAP00000031726  PLWARVGDDHLLLLQ---.............................................---GEQLRRTSRPIV
ENSBTAP00000002709  QLRLVLGLHVLGEISP--.............................................------IYRIRKVVR
ENSBTAP00000051578  NWKVRAGSDRLGSFP---.............................................------SLPVAKIFI
ENSBTAP00000011737  SITVILGAHNLQKKED--.............................................---TWQRLEVIKQFP
ENSBTAP00000046934  NYQVLLGSIQLYQHTP--.............................................---QTQEISVSRIIT
ENSBTAP00000054275  RVRVVLGAHRLQTPEP--.............................................---TQQRLGISRLFE
ENSBTAP00000046937  NYQVLLGSIQLYQHTP--.............................................---QTQEISVSRIIT
ENSBTAP00000021566  SAQVFLGHTDTDQMLE--.............................................----LGRHPVRRVVV
ENSBTAP00000054098  SAQVFLGHTDTDQMLE--.............................................----LGRHPVRRVVV
ENSBTAP00000047813  TYSVRAGSPWIDRITK--.............................................---TSIDILAKEVIV
ENSBTAP00000052086  SVTVTLGAHNLQKKED--.............................................---TWQRLEVIKQFP
ENSBTAP00000055933  SVRVVLGAHNLRRQER--.............................................---TRQMFRVRRVFE
ENSBTAP00000048088  SINVTLGAHNIMDRER--.............................................---TQQFIPVRRPIP
ENSBTAP00000053944  SVRVVLGAHNLRRQER--.............................................---TRQMFRVRRVFE
ENSBTAP00000051737  SINVTLGAHNIMDRER--.............................................---TQQFIPVRRPIP
ENSBTAP00000029273  KSQIILGAHSRNKEEP--.............................................---EKQIMFVKKEFP
ENSBTAP00000042196  SWSVVLGSLQHEGLSP--.............................................---GAEEVGVTALQL
ENSBTAP00000039959  NPQVILGAHSTSHKEK--.............................................---LDQVFSIKKAIP
ENSBTAP00000009800  SIKVSLGG----------.............................................---QRKEWEVKEILF
ENSBTAP00000006095  KYEVLVGSLQVSGYQG--.............................................--SKTTIIPVSRIIP
ENSBTAP00000023490  DYEAWLGIHDVHGRGDEK.............................................---RKQVLNVTQLVY
ENSBTAP00000008335  TLRLYVG-----------.............................................---KNQLVEVEKVVL
ENSBTAP00000055870  RYVVHLGAHSLGRQDG--.............................................---CEQTRTATKSFP
ENSBTAP00000030635  GYEVWLGTLFQDPQPGEP.............................................---DLQHIPMAKMVC
ENSBTAP00000052308  DWTVDFGTIVNK------.............................................---PYMTRKVQNIII
ENSBTAP00000011042  KVELKNGATYEAKIK---.............................................---------------
ENSBTAP00000026804  RVRVRLPSGDTYEAVV--.............................................---------------
ENSBTAP00000004564  QVELQSGVQYEATVKD--.............................................---------------
ENSBTAP00000055424  IATVVLGAYDLRRRER--.............................................---SRQTFFIRS-VS
ENSBTAP00000056087  IATVVLGAYDLRRRER--.............................................---SRQTFFIRS-VS
ENSBTAP00000046935  ELRGLLGSTQLSQHTR--.............................................------EVSVSQIIT
ENSBTAP00000016767  DLKVVLGKFYRDDDRDEK.............................................---SIQSLRISAIIL
ENSBTAP00000009798  LWRVSVGDPNFQGSK---.............................................------EFQIEEAVI
ENSBTAP00000042196  EWTVGLGV----------.............................................---GPEESGLKQVIL
ENSBTAP00000004732  RLQLILGVTKPSNIDEEK.............................................---YVQVVGYEKMIH
ENSBTAP00000049751  ------SSVNTVIAPS--.............................................---RASATLIKHIKS
ENSBTAP00000022878  EMDIAISDERFQKRME--.............................................------GLRPMLIIP
ENSBTAP00000049751  EYTVRMGSTLLLPESG--.............................................-----MVIPVRDIVC
ENSBTAP00000018804  DAVAIIGIAKMDAKLI--.............................................---AHEEYPINTIII
ENSBTAP00000041742  PVKIRLGIYQPNIKNK--.............................................---HEQTQSYSMTVP
ENSBTAP00000054780  ELRGLLGSTQLYQHTQ--.............................................---HTREVSVSQIIT
ENSBTAP00000039011  QVILTGGATTFQELIG--.............................................-----EILPYEEVII
ENSBTAP00000024541  NLKVMLGNLRIRIRDG--.............................................---TEQTINPIQIIR
ENSBTAP00000042824  LWRVSVGDPNFQGSK---.............................................------EFQIEEAVI
ENSBTAP00000051417  FYKVILGAHNEKVREQ--.............................................---SVQEIPVSRLFR
ENSBTAP00000025894  NISVKTR-----------.............................................---SHFRLHVRGVHV
ENSBTAP00000054781  ------------------.............................................---------------
ENSBTAP00000053077  YIEVYLGRAGASPLPQ--.............................................---SHQVSRLVISIH
ENSBTAP00000053077  YWRVQLPS----------.............................................---RPRAEQVARLVP
ENSBTAP00000020194  TQKLRVGFLKPKFKDGRGandshsalp....................................EKMKFQWIRVKRTHV
ENSBTAP00000037916  SKKLRVGLLKMRNKGGGKrrrgsrrnrrevsgagregsqdslketakagrrrkgsarrqraadGRPSFQWTRVKNTHI
ENSBTAP00000047553  ------------------.............................................---------------
ENSBTAP00000003767  ------------------.............................................---------------
ENSBTAP00000053065  ------------------.............................................-------KQVQKIII
ENSBTAP00000055732  ------------------.............................................---SKRLYDVLRVVP
ENSBTAP00000047875  --TARVLVHSTTP-----.............................................----------KSAII
ENSBTAP00000054539  --TARVLVHSTTP-----.............................................----------KSAII
ENSBTAP00000047875  ------------------.............................................---------------
ENSBTAP00000054539  ------------------.............................................---------------
ENSBTAP00000055003  ------------------.............................................---------------
ENSBTAP00000003182  ------------------.............................................---------------


                                          110             120                         130       140 
                                            |               |                           |         | 
d1fiw.1               HEKY......S...........ASS......EANDIALM.KIT....PP....VT.....CG....HFIGPGCLPQFR
ENSBTAP00000004737  HPSY......N...........SNT......LNNDIMLI.KLK....SA....AS.....LN....SRVASISLPTSC
ENSBTAP00000033392  HPSY......N...........SNT......LNNDIMLI.KLK....SA....AS.....LN....SRVASISLPTSC
ENSBTAP00000012503  HPNY......K...........ISE......GSHDIALI.KLE....AP....LN.....FT....DLQKAICLPSKD
ENSBTAP00000026272  HPFF......N...........DFT......FDYDIALL.QLD....RP....VE.....YS....ATIRPICLPAAD
ENSBTAP00000055274  NSNY......S...........DDQ......DDYDIALM.RLS....KP....LT.....LS....AHVHPACLPMHG
ENSBTAP00000000958  HPSY......N...........SDT......ADFDVAVL.ELG....RP....LP.....FS....RHVQPVCLPAAS
ENSBTAP00000010989  NSNY......S...........DDQ......DDYDIALM.RLS....KP....LT.....LS....AHVHPACLPMHG
ENSBTAP00000027425  PPDY......S...........EDG......AHGDLALL.LLR....RP....TP.....LS....TRVQPVCLPEPG
ENSBTAP00000042983  HPYH......E...........EDS......HDYDVALL.QLD....HP....VV.....RS....ATVQPICLPARS
ENSBTAP00000028354  HSKY......K...........PKR......LGNDIALM.KLA....GP....VT.....FN....EMTQPVCLPNSE
ENSBTAP00000027417  NPKY......Q...........GMA......SSADVALV.ELE....AP....VT.....FT....NYILPVCVPDPS
ENSBTAP00000037246  HEKY......S...........HEG......SMGDIALL.QLS....SS....VT.....FS....RYIRPICLPAAN
ENSBTAP00000023479  HPLY......S...........AQN......HDYDVALL.QLR....TP....LH.....FS....DTVGAVCLPAEE
ENSBTAP00000037407  HPNY......Y...........SVE......NGADIALL.ELD....EP....VS.....IS....CHVQPVTLPPES
ENSBTAP00000002505  HDNY......K...........PET......HENDIALV.QLD....RE....VT.....FN....RYIHTVCLPEAN
ENSBTAP00000054149  NPHY......N...........KRR......KNNDIAMM.HLE....MK....VN.....YT....DYIQPICLPEEN
ENSBTAP00000000788  NPHY......N...........KRR......KNNDIAMM.HLE....MK....VN.....YT....DYIQPICLPEEN
ENSBTAP00000050450  HENY......H...........YPS......HKNDIAVV.RLS....SP....VL.....YT....SNIRRACLPETS
ENSBTAP00000050393  HENY......H...........YPS......HKNDIAVV.RLS....SP....VL.....YT....SNIRRACLPETS
ENSBTAP00000028731  HPKY......S...........SWT......LDNDILLI.KLS....TP....AV.....IN....ARVSTLALPSAC
ENSBTAP00000009636  HPNY......Y...........SVK......NGADIALL.ELD....KL....VN.....IS....WHVQPVTLPPES
ENSBTAP00000009406  HPRY......Nw..........KEN......LDRDIALL.KLK....RP....IE.....LS....DYIHPVCLPDKQ
ENSBTAP00000004648  HDQY......E...........KAE......SGYDIALL.KLE....TA....MN.....YT....DSQWPICLPSKG
ENSBTAP00000013434  HEKY......S...........ASS......EANDIALI.KIT....PP....VI.....CG....HFIGPGCLPQFR
ENSBTAP00000001642  HKEF......D...........DDT......YDNDIALL.HLK....SDsltcAR.....ES....ASVRTICLPDAS
ENSBTAP00000050246  HPQW......D...........LRA......VRNDVALL.KLA....AP....AR.....LS....AAVAPVCLPSAD
ENSBTAP00000004986  HGGYlpfrdpN...........SEE......NSNDIALV.HLS....GT....LP.....LT....EYIQPVCLPAAG
ENSBTAP00000053077  PDNY......S...........SVE......RGADVALL.RLA....SP....AR.....LG....PSVRPVCLPRAS
ENSBTAP00000021967  HPVY......S...........WKEg.....SRADIALV.RLE....RA....IQ.....FS....ERVLPICLPDST
ENSBTAP00000028678  LEPN......A...........TYP......REHDIALV.KLQ....LP....LT.....FS....GTIRPICLPFSD
ENSBTAP00000012036  HPNY......D...........SKT......KNNDIALM.KLQ....TP....LT.....FN....DKVKPVCLPNPG
ENSBTAP00000000958  HPFY......N...........LYT......LDYDVALL.ELV....GP....VR.....RS....RLVRPICLPEPA
ENSBTAP00000033941  HEKW......N...........SNQla....QGNDIALL.KLA....SS....VP.....LT....DKIQLGCLPPAG
ENSBTAP00000012346  HPRY......Qsspt.......HLN......HDHDIMLL.ELK....SS....VQ.....LT....RHIQTLPLSHHH
ENSBTAP00000000958  HPQY......N...........PSI......LDFDVAVL.ELA....RP....LV.....FN....KYVQPVCLPLAI
ENSBTAP00000033942  HEKW......N...........SFL......VRNDIALI.KLA....ET....VE.....LS....DTIQVACLPEEG
ENSBTAP00000011204  NPKF......S...........ILT......VRNDITLL.KLA....TP....AQ.....FS....ETVSAVCLPSAD
ENSBTAP00000036577  HEDY......A...........SHK......HDDDIALV.KLS....AP....VI.....FS....DEVHRVCLPDAT
ENSBTAP00000052308  HENY......I...........RGE......LHDDIAVI.LLT....EK....VL.....FK....NDVHSVCLPEAT
ENSBTAP00000001674  EPSQ......-...........---......--ADIALL.KLS....RP....AI.....IT....KEVIPACLPPPN
ENSBTAP00000024677  NPGF......NlsllenhtrhpGED......YSHDLMLL.RLQ....EP....VQ.....LT....QNVQVLGLPTKE
ENSBTAP00000016644  HPRY......N...........SRT......NDNDLMLL.QLE....RP....AR.....LG....PRVRPISVASSC
ENSBTAP00000015915  NSKY......N...........SLT......INNDITLL.KLS....TA....AS.....FS....QTVSAVCLPSAS
ENSBTAP00000048279  YHSY......N...........ASInk....YSHDIALL.ELD....EP....LE.....LN....SYVTPICIADRD
ENSBTAP00000036408  HPTY......E...........LYHp.....VGGDIALV.QLK....TR....IV.....FS....DSVLPICIAPPD
ENSBTAP00000054627  HPDY......N...........HLLsak...GGADIALL.RLE....AP....VT.....LS....PHVQVVSLPPAS
ENSBTAP00000005227  YHSY......N...........ASInk....YSHDIALL.ELD....EP....LE.....LN....SYVTPICIADRD
ENSBTAP00000049751  HKHF......N...........PIGi.....IENDIALA.LLA....FP....VN.....FS....ASIQPVCLPEKA
ENSBTAP00000048972  FSQF......-...........RKN......FQHDIALV.KLS....SP....VT.....FN....KHVQPVCVTSSS
ENSBTAP00000055314  SPHY......-...........LGA......PVYDIALL.KLS....SS....VT.....YT....KYIQPICVMASI
ENSBTAP00000006095  HPTY......-...........-SN......VSGDIALL.RLF....SR....VT.....YS....SSILPICLSNVK
ENSBTAP00000007060  HEDF......D...........SLS......YDSDIALI.QLS....SA....LE.....FN....SVVRPVCLPHSL
ENSBTAP00000024680  HPRY......K...........ALN......HRHDLMLL.RLT....RP....VR.....VT....AEVRPIPLPARC
ENSBTAP00000051470  HPHF......S...........TKKp.....MDYDIALL.KMA....GA....FR.....FD....QFVGPMCLPEPG
ENSBTAP00000055795  HPHF......S...........TKKp.....MDYDIALL.KMA....GA....FR.....FD....QFVGPMCLPEPG
ENSBTAP00000052308  HEKY......K...........YPS......HDYDISVL.ELS....RP....VP.....YT....NAVHKICLPDAS
ENSBTAP00000021789  HSRF......V...........KET......YDFDIAVL.RLK....TP....IR.....FR....RNVAPACLPEKD
ENSBTAP00000019098  FSQF......-...........RKN......FQHDIALV.KLS....SP....VT.....FN....KHVQPVCVTSSS
ENSBTAP00000046176  HKDF......Q...........RVS......MDNDIALL.MLD....NP....IT.....FN....ELKEPICLPMQP
ENSBTAP00000005163  HPNY......T...........KST......SDNDIALL.RLA....KP....AT.....LS....QTIVPICLPDSG
ENSBTAP00000054336  HPDY......D...........QILsae...GGADIALL.RLE....AP....VS.....LS....SHVQVVSLPPAS
ENSBTAP00000020053  HEYY......N...........SQT......FDYDIALL.QLSva..WP....ET.....LK....QLIQPICIPPAG
ENSBTAP00000005785  HENY......R...........KET......NENDIALA.QLD....TR....VE.....FS....NVVQRVCLPDSS
ENSBTAP00000002923  HPSYrg....N...........LGN......HDNDLRLL.RLG....TP....VR.....LT....TSVQPLPLPTTC
ENSBTAP00000020025  SPHY......-...........LGA......PVYDIALL.KLS....SS....VT.....YT....KYIQPICVMASI
ENSBTAP00000027772  HPGY......S...........HPG......HSNDLMLI.KLN....KR....IR.....ET....PYVRPINIASRC
ENSBTAP00000027594  HRLY......R...........PHS......NDYDIALV.RLQ....GPeeqcAR.....LS....SHVLPACLPRWR
ENSBTAP00000009746  PKQY......V...........PGQ......TDHDVALL.QLA....QP....VA.....LG....DHVAPLCLPDPD
ENSBTAP00000020127  HPCY......Nns.........KND......HSYDMMLI.QLR....GR....VS.....LG....PKVKPIKLADHC
ENSBTAP00000010816  HPQFs.....T...........SGT......VKNDLALL.RLR....YP....VN.....FT....GVIQPICIPEKT
ENSBTAP00000054342  HERY......S...........SPA......REYDIAVV.QFS....PR....VS.....FT....DDIRRICLPEAS
ENSBTAP00000020123  HPGY......S...........TQT......HANDLMLV.KLN....GR....AK.....LS....SSVKKVNLPSHC
ENSBTAP00000027052  HERY......S...........SPA......REYDIAVV.QFS....PR....VS.....FT....DDIRRICLPEAS
ENSBTAP00000007806  HEDY......S...........AESla....HHNDIALL.KIR....TSrgqcAQ.....PS....RSIQTICLPPEH
ENSBTAP00000054089  HEDF......D...........SLS......YDSDIALI.QLS....SA....LE.....FN....SVVRPVCLPHSL
ENSBTAP00000020121  HPGY......N...........AAT......HDQDIMLL.RLS....RP....PR.....LS....DHIQPLALERDC
ENSBTAP00000052855  HNYF......D...........SWF......YLNDIALL.LLK....SP....LS.....LG....VRKVPICLSEVT
ENSBTAP00000050470  HPGF......Nqdlt.......AQD......HNNDIMLV.RLP....RK....AH.....LG....PAVQPLNLSQTC
ENSBTAP00000002847  HPRY......S...........RAV......VDYDISIV.ELS....QD....IN.....ET....SYVRPVCLPSPD
ENSBTAP00000050126  HPDY......N...........DET......LANDIMLL.KLT....RK....AD.....IT....DKVSPINLPRSL
ENSBTAP00000011718  HPSW......N...........SNNva....AGYDIAVL.RLA....QS....AT.....LN....SYVQLGVLPQSG
ENSBTAP00000046936  HPDF......E...........KLHp.....FGSDIAML.QLL....FP....VN.....FT....SYIIPACLPVPG
ENSBTAP00000023055  YPLY......S...........VFNp.....SDHDLVLI.RLE....KKgercAV.....RS....QFVQPICLPEPG
ENSBTAP00000027207  HPEY......N...........KPS......LANDLMLI.KLE....ES....VP.....PS....DTIQDISIASQC
ENSBTAP00000025122  HEAF......S...........PIT......YQHDLALV.RLQ....ES....ADgccahPS....PFVQPVCLPSTA
ENSBTAP00000017401  HPLW......N...........SNCva....CGNDIALV.KLS....RS....AQ.....LG....DKVQLANLPPAG
ENSBTAP00000002912  HPDF......N...........NSLpnkd..HRNDIMLV.KMV....TP....AH.....LT....WAVRPLTVSPRC
ENSBTAP00000017359  HPCY......N...........KKT......WANDIMLL.KLT....RK....AD.....IT....DAVSPIDLPRRL
ENSBTAP00000016545  HPDF......N...........IQS......YNHDIALV.QLR....EP....VP.....LG....PHILPVCLPPPE
ENSBTAP00000017363  HPDY......N...........DET......WANDIMLL.KLM....RK....AH.....VT....TTVSPISLPRDW
ENSBTAP00000017013  HESY......I...........HDAg.....YDNDIALI.KLK....NK....VA.....IN....SNIMPICLPRKE
ENSBTAP00000005550  HPKY......W...........GRTf.....IMGDVALL.QLY....NP....VI.....IS....KYVQPICLPEPN
ENSBTAP00000025732  YSHY......I...........EIDdi....PYNDIALL.KLKpvdgHC....AL.....ES....KYVKTVCLPDGP
ENSBTAP00000012471  HADY......N...........KHYy.....QESDITLL.QLY....RP....AK.....FS....DSIRTVCLPEVN
ENSBTAP00000013262  HPDY......N...........PKN......FSNDIMLL.KLE....RK....AK.....QT....SAVKPLSLPRAK
ENSBTAP00000051933  HEDF......-...........-TN......LSQDLALL.KLR....DS....VS.....WS....PLIQPVCLPNPK
ENSBTAP00000011362  HPDY......Rqee........SHN......FEGDIALL.ELE....NS....VT.....LG....PNLLPICLPDNE
ENSBTAP00000017607  HPGY......S...........QQN......KRNDIMLL.QLA....NR....AQ.....RN....RFVRPVPLPQTQ
ENSBTAP00000006358  HPGW......Evldpsit....RKN......FDNDIALV.RLR....DP....VK.....MG....PKVAPICLPGTS
ENSBTAP00000006807  FPGF......A...........LAP......KSNDIMLV.KLH....TA....AI.....LN....RHVQLLHPRAKN
ENSBTAP00000055802  HPGS......R...........TET......IDHDLLLL.QLS....EK....AV.....LG....PAVQLLPWQRED
ENSBTAP00000014364  HPDY......N...........PKT......FSNDIMLL.QLE....RK....AK.....QT....SAVKPLSLPKAK
ENSBTAP00000045833  HENY......N...........GTT......YQNDIALI.EMK....KR....PN.....EKecvlSKSIPACVPWSP
ENSBTAP00000039032  HPDY......Q...........PTT......HTSDICLL.QLN....SS....AT.....LG....PAVGLLGLPRRG
ENSBTAP00000007060  HPEY......N...........RLGy.....MSFNIALL.YLK....LK....VK.....FG....TTVQPICIPHRG
ENSBTAP00000052108  HPRY......N...........QRN......NQNDIMLL.QLA....NR....AR.....QN....EAVRLVALPQTE
ENSBTAP00000054089  HPEY......N...........RLGy.....MSFNIALL.YLK....LK....VK.....FG....TTVQPICIPHRG
ENSBTAP00000031726  HPKY......Qqgsgpilp...RRT......DEHDLMLL.KLG....RP....VV.....PG....PRVRPLRLPFRC
ENSBTAP00000002709  HPEY......K...........PVPh.....LENDLALL.KLD....GK....VK.....PS....RTIQPLALPRGR
ENSBTAP00000051578  LEPN......A...........TYP......REHDIALV.KLQ....LP....LT.....FS....G-----------
ENSBTAP00000011737  YPKY......-...........EHV......GLHDIMLL.KLK....EK....AN.....LT....LAVGTIPLPSHF
ENSBTAP00000046934  HPDF......E...........KLHp.....FGSDIAML.QLL....FP....VN.....FT....SYIIPACLPVPG
ENSBTAP00000054275  -NNY......N...........PQE......KLNDVLLL.QLD....QP....AT.....LN....THVAVAQLPQQA
ENSBTAP00000046937  HPDF......E...........KLHp.....FGSDIAML.QLL....FP....VN.....FT....SYIIPACLPVPG
ENSBTAP00000021566  HPDY......Hqee........PHD......FHGDIALL.ELE....RS....VP.....LG....PHLLPVCLPDRE
ENSBTAP00000054098  HPDY......Hqee........PHD......FHGDIALL.ELE....RS....VP.....LG....PHLLPVCLPDRE
ENSBTAP00000047813  HSRY......R...........ASRywswvgRANDIALL.NLD....RP....MQ.....YS....KYVWPICLPGLD
ENSBTAP00000052086  YPKY......-...........EHV......GLHDIMLL.KLK....EK....AN.....LT....LAVGTIPLPSHF
ENSBTAP00000055933  N-GF......D...........PLS......LQNDVVVL.QLN....RM....AT.....LN....ANVQVARLPAQD
ENSBTAP00000048088  YPRY......-...........NKT......WANDIMLL.QLE....RK....AK.....QM....SAVKPLSLPKAK
ENSBTAP00000053944  N-GF......D...........PLS......LQNDVVVL.QLN....RM....AT.....LN....ANVQVARLPAQD
ENSBTAP00000051737  YPRY......-...........NKT......WANDIMLL.QLE....RK....AK.....QM....SAVKPLSLPKAK
ENSBTAP00000029273  YPCY......D...........PDT......HEGDLKLL.KLN....KK....AT.....LN....KNVAILQLPKEG
ENSBTAP00000042196  PRAY......N...........HYS......QGSDLALL.RLA....HP....IA.....HT....----PLCLPRPA
ENSBTAP00000039959  YPCF......D...........PQT......FEGDLQLL.QLE....GK....AT.....MT....KAVGILQLPRTE
ENSBTAP00000009800  HPKY......Dlnakkakgi..PEF......YDYDVALV.RLK....EK....LK.....YE....TTIRPICLPCTE
ENSBTAP00000006095  YPDV......-...........QRH......ASSAIAVA.ELA....RP....LS.....FS....PLVLPICLPTSA
ENSBTAP00000023490  GPE-......-...........---......-GSDLVLL.KLA....RP....AI.....LD....DFVSTIDLPNYG
ENSBTAP00000008335  HPDH......S...........KV-......---DIGLI.KLR....QK....VP.....VN....DKVMPICLPSKD
ENSBTAP00000055870  HPDF......N...........NSLpnkd..HRNDIMLV.KMV....TP....AH.....LT....WAVRPLTVSPRC
ENSBTAP00000030635  GPSG......S...........Q--......----LVLL.KLE....RP....VI.....LN....QRVALICLPPER
ENSBTAP00000052308  HENF......S...........GPG......IHDDIAVV.QLA....E-....--.....--....EHVRKICLPEAK
ENSBTAP00000011042  ----......-...........DVD......EKADIALI.KID....H-....--.....--....QGKLPVLLLGRS
ENSBTAP00000026804  ----......T...........AVD......PVADIATL.RIQ....TK....EP.....LP....------TLPLGR
ENSBTAP00000004564  ----......-...........-VD......HKLDLALI.KIE....PN....AD.....--....---LPVLLLGKS
ENSBTAP00000055424  ENGY......D...........PQQ......NLNDVLLLqQLD....RQ....AN.....LT....SSVALVPLPEQN
ENSBTAP00000056087  ENGY......D...........PQQ......NLNDVLLLqQLD....RQ....AN.....LT....SSVALVPLPEQN
ENSBTAP00000046935  HPDF......K...........KLHp.....FGSDIAML.QLL....YP....VN.....FT....SYIIPACLLIPG
ENSBTAP00000016767  HPNY......D...........PIL......LDMDIAIL.KLL....DK....AR.....MS....TRVQPICLAAPR
ENSBTAP00000009798  SPGF......Nvfskksqgi..PEF......YGDDIALL.KLT....QK....VK.....MS....THARPICLPCTV
ENSBTAP00000042196  HGAY......T...........HPE......GGYDVALL.LLA....QP....VT.....LG....PSLRPLCLPYSD
ENSBTAP00000004732  HPQF......S...........ITS......IEHNLMLI.KLQ....TH....IE.....LN....NYVKIVSLPKEP
ENSBTAP00000049751  HKDF......D...........WNL......TPNDIALL.QLA....HS....VN.....YS....AYIQPVCLPRKN
ENSBTAP00000022878  HPSF......K...........QDS......AEHDIVLI.KLT....RP....LK.....LN....DQVKLAALPSPT
ENSBTAP00000049751  HSFY......D...........VRT......LINDIALV.LLA....HS....VN.....YS....AFIQPVCLPEKN
ENSBTAP00000018804  HEDF......D...........NKT......MRNNIALL.KTD....TA....MQ.....FN....SLVRPICFLGRK
ENSBTAP00000041742  YPDF......N...........SEY......LSNDLMMI.KLS....EA....AK.....VT....TQVGTIAIAMEP
ENSBTAP00000054780  HLDSe.....K...........LHP......FGSGITIL.QLL....FP....VN.....FT....SYIIPACLPVPA
ENSBTAP00000039011  HPNF......T...........FTS......PKNDLMLI.KLS....VP....LT.....FF....ST-SMFQLPVSN
ENSBTAP00000024541  YWNH......S...........HTA......PQDDLMLI.RLA....KP....AI.....LN....EKVQPIALATST
ENSBTAP00000042824  SPGF......Nvfskksqgi..PEF......YGDDIALL.KLT....QK....VK.....MS....THARCRGLGWEG
ENSBTAP00000051417  EPSQ......-...........---......--ADIALL.KLS....R-....--.....--....------------
ENSBTAP00000025894  HTRF......E...........ADT......GHNDVALL.DLA....RP....VR.....CP....DAGRPVCTADAD
ENSBTAP00000054781  ----......-...........---......--------.---....--....--.....--....------------
ENSBTAP00000053077  LPRH......-...........-LG......LRPPLALL.ELS....SR....VE.....PS....PSALPICLHPGG
ENSBTAP00000053077  HENA......-...........SWD......DASNLALL.QLR....AP....VN.....LS....AAPRPVCLPHPE
ENSBTAP00000020194  PKGW......I...........KGNandig.MDYDYALL.ELK....KP....HK.....-R....KFMKIGVSPPAK
ENSBTAP00000037916  PKGWarges.R...........DPA......LDYDYALL.ELK....RP....HK.....--....--KKYMELGVSP
ENSBTAP00000047553  ----......-...........VSG......ETLDYAIL.KLS....E-....--.....-N....GNGFPPGLSKLI
ENSBTAP00000003767  ----......-...........---......--------.---....--....--.....--....------------
ENSBTAP00000053065  HKDY......E...........PPH......LDSDLSLL.LLA....TP....VQ.....FN....NFKMPICLQKKE
ENSBTAP00000055732  HPGS......R...........TET......IDHDLLLL.QLS....EK....AV.....LG....PAVQLLPWQRED
ENSBTAP00000047875  WGRVvfa...T...........QET......SPYDIAVV.RLE....ED....LD.....--....--GVPVPVPAEH
ENSBTAP00000054539  WGRVvfa...T...........QET......SPYDIAVV.RLE....ED....L-.....--....------------
ENSBTAP00000047875  ----......-...........---......--------.---....--....--.....--....------------
ENSBTAP00000054539  ----......-...........---......--------.---....--....--.....--....------------
ENSBTAP00000055003  ----......-...........---......--------.---....--....--.....--....------------
ENSBTAP00000003182  ----......-...........---......--------.---....--....--.....--....------------


                                                                                            150     
                                                                                              |     
d1fiw.1               AGP....PRVP............................................................QTCWVAG
ENSBTAP00000004737  ---....ASAG............................................................TQCLISG
ENSBTAP00000033392  ---....ASAG............................................................TQCLISG
ENSBTAP00000012503  DT-....KPVY............................................................TDCWITG
ENSBTAP00000026272  YT-....FPTG............................................................KAIWVTG
ENSBTAP00000055274  QT-....FGLN............................................................EICWITG
ENSBTAP00000000958  HI-....FPPR............................................................KKCLISG
ENSBTAP00000010989  QT-....FGLN............................................................EICWITG
ENSBTAP00000027425  AR-....PPPG............................................................TPCWVTG
ENSBTAP00000042983  HF-....FEAG............................................................LHCWITG
ENSBTAP00000028354  EN-....FPDG............................................................KLCWTSG
ENSBTAP00000027417  VV-....FESG............................................................MKCWVTG
ENSBTAP00000037246  AS-....FPNG............................................................LQCVVTG
ENSBTAP00000023479  RD-....FPRG............................................................SECWVSG
ENSBTAP00000037407  ET-....FPPG............................................................TQCWVTG
ENSBTAP00000002505  QA-....ISAG............................................................STAYVTG
ENSBTAP00000054149  QV-....FPPG............................................................RICSIAG
ENSBTAP00000000788  QV-....FPPG............................................................RICSIAG
ENSBTAP00000050450  YA-....FPSN............................................................SDVVVTG
ENSBTAP00000050393  YA-....FPSN............................................................SDVVVTG
ENSBTAP00000028731  ---....ASAG............................................................TECLISG
ENSBTAP00000009636  ET-....FPPG............................................................TQCWVTG
ENSBTAP00000009406  TAAkl..LHAG............................................................FKGRVTG
ENSBTAP00000004648  DR-....NVMY............................................................TECWVTG
ENSBTAP00000013434  AGP....PRVP............................................................QTCWVAG
ENSBTAP00000001642  LQ-....LPDW............................................................TECELSG
ENSBTAP00000050246  TS-....FPTG............................................................SLCTVTG
ENSBTAP00000004986  QA-....LVDG............................................................KICTVTG
ENSBTAP00000053077  HR-....FAQG............................................................TACWATG
ENSBTAP00000021967  VQ-....LSPD............................................................TNCWIAG
ENSBTAP00000028678  EE-....LTPG............................................................TPLWVIG
ENSBTAP00000012036  MM-....LEPT............................................................QSCWISG
ENSBTAP00000000958  PR-....PPDG............................................................ARCVITG
ENSBTAP00000033941  TI-....LPNN............................................................YVCYVTG
ENSBTAP00000012346  C--....LPPG............................................................TCCRVSG
ENSBTAP00000000958  QK-....FPVG............................................................RKCVISG
ENSBTAP00000033942  SL-....LPQD............................................................YPCFVTG
ENSBTAP00000011204  ED-....FPAG............................................................MLCATTG
ENSBTAP00000036577  FE-....ALPE............................................................SKVFVTG
ENSBTAP00000052308  QI-....FPPG............................................................EGVVVTG
ENSBTAP00000001674  YM-....VAAR............................................................TECYITG
ENSBTAP00000024677  ---....PQLG............................................................TTCYASG
ENSBTAP00000016644  ---....ARVG............................................................SSCLVSG
ENSBTAP00000015915  DD-....FAAG............................................................TTCVTTG
ENSBTAP00000048279  YTNi...FLKF............................................................GYGYVSG
ENSBTAP00000036408  L--....TLWN............................................................LSCWATG
ENSBTAP00000054627  LR-....VPEK............................................................KMCWVTG
ENSBTAP00000005227  YTNi...FLKF............................................................GYGYVSG
ENSBTAP00000049751  FM-....VQAG............................................................TECWVTG
ENSBTAP00000048972  LE-....FKNR............................................................NDCWVTG
ENSBTAP00000055314  SE-....FENR............................................................SDCWVTG
ENSBTAP00000006095  KKR....LIIP............................................................DSCWVTG
ENSBTAP00000007060  EP-....LFSS............................................................EICVVTG
ENSBTAP00000024680  ---....PQAG............................................................EACVVSG
ENSBTAP00000051470  ER-....FKPG............................................................FICTTAG
ENSBTAP00000055795  ER-....FKPG............................................................FICTTAG
ENSBTAP00000052308  HE-....FRPG............................................................DEMFVTG
ENSBTAP00000021789  WAEat..LMTQ............................................................KTGIVSG
ENSBTAP00000019098  LE-....FKNR............................................................NDCWVTG
ENSBTAP00000046176  G--....LSQW............................................................HKCWVAG
ENSBTAP00000005163  LSErkl.TQVG............................................................QETVVTG
ENSBTAP00000054336  LT-....VPER............................................................KMCWVSG
ENSBTAP00000020053  QK-....VRSG............................................................EKCWVTG
ENSBTAP00000005785  IK-....LPPK............................................................TGVFVTG
ENSBTAP00000002923  ---....ATAG............................................................TECHISG
ENSBTAP00000020025  SE-....FENR............................................................SDCWVTG
ENSBTAP00000027772  ---....PSAG............................................................TSCLVSG
ENSBTAP00000027594  ERP....QKRA............................................................HNCYVTG
ENSBTAP00000009746  FADqt..LAFV............................................................RFSAVSG
ENSBTAP00000020127  ---....PQVG............................................................QKCTISG
ENSBTAP00000010816  FR-....VQAG............................................................TRCWVTG
ENSBTAP00000054342  AS-....FQPN............................................................STVYITG
ENSBTAP00000020123  ---....DPPG............................................................TMCTVSG
ENSBTAP00000027052  AS-....FQPN............................................................STVYITG
ENSBTAP00000007806  ED-....AHSR............................................................TRCEITG
ENSBTAP00000054089  EP-....LFSS............................................................EICVVTG
ENSBTAP00000020121  ---....SANH............................................................TSCHILG
ENSBTAP00000052855  A--....IERW............................................................RNCWVSG
ENSBTAP00000050470  ---....VSPG............................................................TQCLISG
ENSBTAP00000002847  QS-....LEPD............................................................TYCYITG
ENSBTAP00000050126  AE-....VKPG............................................................MMCSVAG
ENSBTAP00000011718  TI-....LANN............................................................TPCYITG
ENSBTAP00000046936  MK-....LPSN............................................................SSCWITG
ENSBTAP00000023055  SS-....FPPG............................................................HKCQIAG
ENSBTAP00000027207  P--....AAGG............................................................DSCLVSG
ENSBTAP00000025122  ARPa...ESEA............................................................AVCEVAG
ENSBTAP00000017401  DI-....LPNE............................................................APCYISG
ENSBTAP00000002912  ---....VPAG............................................................ANCLISG
ENSBTAP00000017359  AK-....VKPG............................................................MMCSVAG
ENSBTAP00000016545  PAG....PAPH............................................................VLGLVAG
ENSBTAP00000017363  DT-....VNPG............................................................MMCSVAG
ENSBTAP00000017013  AESf...MRTN............................................................DIGTASG
ENSBTAP00000005550  YS-....LKVG............................................................TQCWVTG
ENSBTAP00000025732  ---....FLSG............................................................TECYISG
ENSBTAP00000012471  IQ-....LLDL............................................................ILCWITG
ENSBTAP00000013262  AR-....VKPG............................................................QTCSVAG
ENSBTAP00000051933  LK-....PSFG............................................................SLCWMIG
ENSBTAP00000011362  TL-....YDPG............................................................LMGYVSG
ENSBTAP00000017607  NR-....LRPG............................................................TQCTVAG
ENSBTAP00000006358  SEYd...PPEN............................................................VLGLISG
ENSBTAP00000006807  D--....IKAG............................................................TKCQVVG
ENSBTAP00000055802  RD-....VAAG............................................................TLCDVAG
ENSBTAP00000014364  AQ-....VKPG............................................................EVCSLAG
ENSBTAP00000045833  YL-....FQPN............................................................DKCIVSG
ENSBTAP00000039032  ARP....PRAG............................................................TRCKVAG
ENSBTAP00000007060  DK-....FEEG............................................................IFCMASG
ENSBTAP00000052108  EM-....LSPG............................................................TQCTVAG
ENSBTAP00000054089  DK-....FEEG............................................................IFCMASG
ENSBTAP00000031726  ---....TQPG............................................................DQCQIAG
ENSBTAP00000002709  QM-....VATG............................................................TRCSLAG
ENSBTAP00000051578  ---....----............................................................-------
ENSBTAP00000011737  TF-....IHPG............................................................IMCWVAG
ENSBTAP00000046934  MK-....LPSN............................................................SSCWIPG
ENSBTAP00000054275  QP-....LPHG............................................................TQCLAMG
ENSBTAP00000046937  MK-....LPSN............................................................SSCWIPG
ENSBTAP00000021566  AL-....YRPG............................................................RWGYVSG
ENSBTAP00000054098  AL-....YRPG............................................................RWGYVSG
ENSBTAP00000047813  YS-....VKDY............................................................SLCTVTG
ENSBTAP00000052086  TF-....IHPG............................................................IMCRVAG
ENSBTAP00000055933  QG-....VGEG............................................................VRCVAMG
ENSBTAP00000048088  AQ-....MKPG............................................................QVCSLAG
ENSBTAP00000053944  QG-....VGEG............................................................VRCVAMG
ENSBTAP00000051737  AQ-....MKPG............................................................QVCSLAG
ENSBTAP00000029273  KD-....VEPG............................................................TACRVAG
ENSBTAP00000042196  HR-....FPFG............................................................TSCWATG
ENSBTAP00000039959  DD-....VKPH............................................................TKCHVAG
ENSBTAP00000009800  GSI....-QALrlprsttcqqqmqellpakdiealfvseskktltrkavyikngdkkascer.........DALRAPG
ENSBTAP00000006095  VQ-....LKNA............................................................TSCWVTG
ENSBTAP00000023490  CT-....IPEK............................................................TTCSVYG
ENSBTAP00000008335  Y--....VKVG............................................................RVGYVSG
ENSBTAP00000055870  ---....VPAG............................................................ANCLISG
ENSBTAP00000030635  YV-....VPPG............................................................TRCEIAG
ENSBTAP00000052308  MK-....LSAN............................................................DSVVVTG
ENSBTAP00000011042  SE-....LRPG............................................................EFVVAIG
ENSBTAP00000026804  SAD....VRQG............................................................EFVVAMG
ENSBTAP00000004564  SD-....LRAG............................................................EFVVALG
ENSBTAP00000055424  AT-....VEAG............................................................TGCQVAG
ENSBTAP00000056087  AT-....VEAG............................................................TGCQVAG
ENSBTAP00000046935  MK-....LPSN............................................................SSYWIPG
ENSBTAP00000016767  DLSt...SFQE............................................................SRITVAG
ENSBTAP00000009798  GANlalrKLPGstcrdhekellnqvsipa..........................................HFVALNG
ENSBTAP00000042196  HR-....LPDG............................................................ERGWVLG
ENSBTAP00000004732  ---....AAED............................................................DTCIVST
ENSBTAP00000049751  FE-....VRPG............................................................TQCWITG
ENSBTAP00000022878  ---....TNRM............................................................DNCAVFG
ENSBTAP00000049751  FE-....AETG............................................................TRCWVTG
ENSBTAP00000018804  LNR....PPVL............................................................MNCWVAG
ENSBTAP00000041742  ---....LSLN............................................................ESCFIPT
ENSBTAP00000054780  MK-....LPSN............................................................SSCWIPG
ENSBTAP00000039011  ---....SSDI............................................................ADCLVYT
ENSBTAP00000024541  ---....VKPG............................................................TICMLSG
ENSBTAP00000042824  TL-....YRGGcpgepwrrghqgwasvtlalllrpiclpctvganlalrklpgstcrdhekellnqvsipaHFVALNG
ENSBTAP00000051417  ---....----............................................................-------
ENSBTAP00000025894  FADs...VLLP............................................................QPGVLGG
ENSBTAP00000054781  ---....----............................................................-------
ENSBTAP00000053077  ---....TPLG............................................................ASCWVLG
ENSBTAP00000053077  HY-....FLPG............................................................SRCRLAR
ENSBTAP00000020194  ---....QLPG............................................................GRIHFSG
ENSBTAP00000037916  TIK....KLPG............................................................GMIHFSG
ENSBTAP00000047553  FR-....QPSD............................................................GLLYLIG
ENSBTAP00000003767  ---....----............................................................-------
ENSBTAP00000053065  KIW....----............................................................GRCWMTE
ENSBTAP00000055732  RD-....VAAG............................................................TLCDVAG
ENSBTAP00000047875  FH-....----............................................................-------
ENSBTAP00000054539  ---....----............................................................-------
ENSBTAP00000047875  ---....----............................................................-------
ENSBTAP00000054539  ---....----............................................................-------
ENSBTAP00000055003  ---....----............................................................-------
ENSBTAP00000003182  ---....----............................................................-------


                        160                 170       180                      190       200        
                          |                   |         |                        |         |        
d1fiw.1               WGFLQENA..........RRTSPMLQEARVDLIDLGLCNSTR...............WYNGRIRSTNVCAGYPE...G
ENSBTAP00000004737  WGNTKSSG..........TSYPDVLKCLKAPILSDSSCKSAY...............P--GQITSNMFCAGYLE...G
ENSBTAP00000033392  WGNTKSSG..........TSYPDVLKCLKAPILSDSSCKSAY...............P--GQITSNMFCAGYLE...G
ENSBTAP00000012503  WGFTEEKG..........-KIQNTLQKANIPLISNEECQKSY...............RD-YKITKQMICAGYKE...G
ENSBTAP00000026272  WGHTQEAG..........-QGAMILQKGEIRVINQTTCEHLL...............P--QQITPRMICVGYLS...G
ENSBTAP00000055274  FGKTKETD..........ERTSPFLREVQVNLIDFKKCNDYL...............VYDSYLTPRMMCAGDLR...G
ENSBTAP00000000958  WGYLKENF..........LVKPEMLQKATVELLDQALCTSLY...............G--HSLTDRMVCAGYLD...G
ENSBTAP00000010989  FGKTKETD..........ERTSPFLREVQVNLIDFKKCNDYL...............VYDSYLTPRMMCAGDLR...G
ENSBTAP00000027425  WGSLRPGVp.........LPEWRPLQGVRVPLLDAHTCDHLYhlgtdvp........RAEHIVLPGSLCAGYVG...G
ENSBTAP00000042983  WGALREGG..........-PTSNGLQKVDVQLIPQDLCSEAY...............R--YQVTPRMLCAGYRN...G
ENSBTAP00000028354  WGATEDGDp.........GDASPVLNHAAVPLISNKVCNHRD...............VYGGIISPSMLCAGYLK...G
ENSBTAP00000027417  WGTPSEQDs.........LPKPRTLQKLAVPIISTPKCNLLYskdaesg........FQPRTIKDDMLCAGFAE...G
ENSBTAP00000037246  WGHVAPSVs.........LQHPRPLQQLEVPLISRETCNCLYninakp.........GEPHVIDQDMLCAGYVN...G
ENSBTAP00000023479  WGHTDPGH..........TRSSDVLQDSVVPLLSTQLCNSSC...............VYSGALTPRMLCAGYLD...G
ENSBTAP00000037407  WGNVDNGRr.........LPPPFPLKQVKVPVVENSVCDRKYhsglstg........DNVPIVQEDNLCAGDS-...-
ENSBTAP00000002505  WGSQSYSG..........-STVSDLNQGRVNIISNTVCNTPA...............GYNGAVLSGMLCAGLPE...G
ENSBTAP00000054149  WGALIYQG..........-STADVLQEADVPLLSNEKCQQQM...............PE-YNITENMVCAGYEA...G
ENSBTAP00000000788  WGALIYQG..........-STADVLQEADVPLLSNEKCQQQM...............PE-YNITENMVCAGYEA...G
ENSBTAP00000050450  WGTLKTDG..........-TSPNILQKGLVKIIDSKICNRKV...............VYDGAITPGMLCAGFLE...G
ENSBTAP00000050393  WGTLKTDG..........-TSPNILQKGLVKIIDSKICNRKV...............VYDGAITPGMLCAGFLE...G
ENSBTAP00000028731  WGNTLSSG..........VNYPDLLQCLEAPLLSHADCEASY...............P--GEITNNMICAGFLE...G
ENSBTAP00000009636  WGNVDNGRr.........LPPPFPLKQVKVPVVENSVCDRKYhsglstg........DNVPIVREDMLCAGDS-...-
ENSBTAP00000009406  WGNRRETWttsva.....EVQPSVLQVVNLPLVERPVCKAST...............R--IRITDNMFCAGYKPgegK
ENSBTAP00000004648  WGYRKLRD..........-KIQNTLQKAKVPLMTNEECQAGY...............RE-HRITSKMVCAGYRE...G
ENSBTAP00000013434  WGFLRENA..........RRTSPVLQEAHVDLIDLDLCNSTR...............WYNGRIRSTNVCAGYPE...G
ENSBTAP00000001642  YGKHESSS..........PFFSERLKEAHVRLYPSSRCTSQH...............LFNRTVTNNMLCAGDTR...S
ENSBTAP00000050246  WGKTRYNA..........FDTPDKLQQATLPILSNADCREFW...............G--SKITDVMICAGAS-...-
ENSBTAP00000004986  WGNTQYYG..........-QQAGVLQEARVPIISNDVCNGPD...............FYGNQIKPKMFCAGYPE...G
ENSBTAP00000053077  WGDVQEEDp.........LPLPWVLQEVELRLLGEAACQCLYsrpgpf.........NLTFQLLPGMLCAGYRE...G
ENSBTAP00000021967  WGSVHDGVp.........LSHPQTLQKLKVPIIDSATCSRLYwrg............AGQGAITEDMLCAGYLE...G
ENSBTAP00000028678  WGFTEENG..........GKMSDILQQGSVQLINRTRCNAED...............AYQGEVTKTMMCAGLPE...G
ENSBTAP00000012036  WGATYEKG..........-KTSDDLNAAKVHLIEPRKCNSKY...............MYDNLITPAMICAGYLR...G
ENSBTAP00000000958  WGSVREGG..........-SMARQLQKAAVRLLSEQTCRRFY...............P--VQISSRMLCAGFPQ...G
ENSBTAP00000033941  WGRLQSNG..........-ALPDILQQGKLLVVDYATCSQPS...............WWGSTVKTNMICAGGDG...-
ENSBTAP00000012346  WGTTTSPQ..........VTFPQTLQCANIELRSDEECRQVY...............P--GKITPNMLCAGTKE...G
ENSBTAP00000000958  WGNTQEGN..........ATKPDLLQQASVGIIDHKACSALY...............N--FSLTDRMICAGFLE...G
ENSBTAP00000033942  WGRLYTNG..........-PIAAELQQGLQPVVDYATCSQRD...............WWGTTVKETMVCAGGDG...-
ENSBTAP00000011204  WGKTKYNA..........LKTPDKLQQATLPIVSNTDCRKYW...............G--SRVTDVMICAGAS-...-
ENSBTAP00000036577  WGALKANG..........-PFPNTLREVEVEIISNDICNQIH...............VYGGAVSSGMICAGFLK...G
ENSBTAP00000052308  WGALSYDG..........-EYPVLLQKAPVKIIDTNTCNAWE...............AYNGMIQDTMLCAGYLE...G
ENSBTAP00000001674  WGETQGT-..........-FGEGLLKEAHLPVIENKVCNRNE...............YLDGRVKPTELCAGHLI...G
ENSBTAP00000024677  WGSVKPDE..........FSYPDDLQCVDLTLLPNEKCATAH...............P--QEVTEWMLCAGHLE...G
ENSBTAP00000016644  WGTISSPV..........ARYPNSLQCVNINISSDQECRRAY...............S--GAITPGMVCAGVPQ...G
ENSBTAP00000015915  WGLTRYTN..........ANTPDRLQQASLPLLSNTNCKKYW...............G--TKIKDAMICAGAS-...-
ENSBTAP00000048279  WGKVFNRG..........-RSASILQYLKVPLVDRATCLRST...............K--FSIYSHMFCAGYHE...G
ENSBTAP00000036408  WGSISRKG..........-DTSNKLQEVQLPLVPFHLCRLLY...............GQ-TDILPDMLCAGNFK...D
ENSBTAP00000054627  WGDVRLGGp.........LRPPHHLQEAEVPVVGNEVCNRHYqnssad.........AARQIFKDNMLCAGSE-...-
ENSBTAP00000005227  WGKVFNRG..........-RSASILQYLKVPLVDRATCLRST...............K--FSIYSHMFCAGYHE...G
ENSBTAP00000049751  WGKVKEEDvp........QASTQELQEAELNILRYETCNEVLsekle..........SQFDVVKEGTVCAISSK...-
ENSBTAP00000048972  WGNIGERQk.........LLPPYNLREVQVSIINKSRCSYLFqqp............LYRRNINHGMICAGSED...G
ENSBTAP00000055314  WGDIEEELs.........LPSPYTLQEVQVGIINTTMCNHLFsmp............DFRIDIWGDMICAGEPQ...G
ENSBTAP00000006095  WGKLKEED..........ADYPTILQEAEVPIIKRQKCENIYnplgsflp.......QIQPVIMETMICAGDVK...K
ENSBTAP00000007060  WGSANKDG..........-GLASRLQQIQVPVLEREVCERTYys.............AHPGGISEKMICAGFAAs..G
ENSBTAP00000024680  WGLVANKEpgatgspesqVRLPDRLHCANISIISTASCNKDY...............A--GRLMDTMVCAGVEG...G
ENSBTAP00000051470  WGRLSENG..........-ISPQVLQEVNLPILTQDECITALlt.............LEKPISGRTFLCTGFPD...G
ENSBTAP00000055795  WGRLSENG..........-ISPQVLQEVNLPILTQDECITALlt.............LEKPISGRTFLCTGFPD...G
ENSBTAP00000052308  FGALQNDE..........GSSQNHLRQVQVDLIDAKICNAPQ...............AYNNAITPTMLCAGSLK...G
ENSBTAP00000021789  FGRTHEKG..........-RLSSTLKMLEVPYVDRSTCKLSS...............S--FTITPNMFCAGYDT...Q
ENSBTAP00000019098  WGNIGERQtpq.......LLPPYNLREVQVSIINKSRCSYLFqqp............LYRRNINHGMICAGSED...G
ENSBTAP00000046176  WGQVKSGLn.........QPMETELLKAPMTIMNWDKCFKEF...............P---KLTKNMLCAGYEN...E
ENSBTAP00000005163  WGYRDETK..........RNRTFVLSFIKVPVVPYNACVHAM...............E--NKISENMLCAGILG...D
ENSBTAP00000054336  WGKVTVHSp.........LPPPYHLQEVEVPIVGNQVCNQHYqkle...........NSTKPIKDDMLCAGSK-...-
ENSBTAP00000020053  WGRRHEAD..........NKGSPILQQAEVELIDQTLCVSTY...............G---IITSRMLCAGVMS...G
ENSBTAP00000005785  FGSIVDDVwvi.......GPTQNKLRQARVETISTEVCNRKD...............VYDGMITSGMLCAGFME...G
ENSBTAP00000002923  WGTTNHPW..........SPFPDRLQCLSLSIVSNATCRAVF...............P--GRITDNMVCAGGKA...-
ENSBTAP00000020025  WGDIEEELrs........LPSPYTLQEVQVGIINTTMCNHLFsmp............DFRIDIWGDMICAGEPQ...G
ENSBTAP00000027772  WGTTSSPQ..........VTFPKALQCLNITVLSDDQCKKAY...............P--NQIDNTMFCAGDQA...-
ENSBTAP00000027594  WGDTGPA-..........--YSRTLQQGAIPLLPKRFCEHRY...............K--GRFTRRMLCAGNLHeh.K
ENSBTAP00000009746  WGQLLERG..........-VTARKLMVVLVPRLLTQDCLQQSrqr............PGGPVVTDNMFCAGYSD...G
ENSBTAP00000020127  WGTVTSPR..........EKFPDTLNCAEVKIIPQDQCEKAY...............P--GQVTDSMVCASDSS...-
ENSBTAP00000010816  WGRKQEFG..........PLVSEVLQEIDQYIMYYEKCNGLLqmalr..........TDKDLVQEGVICGYNSI...-
ENSBTAP00000054342  FGALFYGG..........-ESQNDLREARLKIISDDVCKQPH...............VYGSDIKFGMMCAGYLE...G
ENSBTAP00000020123  WGTTTSPD..........VTFPGQLMCTDVKLISPQDCRKVY...............K--DLLGDSMLCAGIPN...S
ENSBTAP00000027052  FGALFYGG..........-ESQNDLREARLKIISDDVCKQPH...............VYGSDIKFGMMCAGYLE...G
ENSBTAP00000007806  FGKENPSD..........YRYSDELKMTFVSLVSHEVCQQPH...............YYGAEVTDKMLCAADPQ...W
ENSBTAP00000054089  WGSANKDG..........-GLASRLQQIQVPVLEREVCERTYys.............AHPGGISEKMICAGFAAs..G
ENSBTAP00000020121  WGKMADG-..........-EYPDTIQCAYVHLVSREKCDHAY...............P--GQITQNMVCAGDEK...H
ENSBTAP00000052855  WGTTGSVPq.........RSTETGLQKVNIQLIKWETCFELM...............P---LLTKSMLCAGDLE...G
ENSBTAP00000050470  WGAVSSPK..........VEYPLTLQCANISILEPRLCRRAY...............P--GHISDSMLCAGLWE...G
ENSBTAP00000002847  WGHMGNKKkkk.......NPVPFKLQEGEVRVISLEQCQSYF...............DM-KTITNRMICAGYES...G
ENSBTAP00000050126  WGRLGVNM..........-PSTDKLQEVDLEVQSEEKCIARF...............K--NYIPFTQICAGDPS...K
ENSBTAP00000011718  WGRTKTNG..........-QLAQTLQQAYLPSVDYATCSSSS...............YWGSTVKTTMVCAGGDG...-
ENSBTAP00000046936  WGMLNEETp.........LLEPFHLQEGKVSFVENKFCNMLYglak...........GKNVSVQEDMLCAGDFS...T
ENSBTAP00000023055  WGHQDENV..........SGYSPSLREALVPLVADHKCSSPE...............VYGADISPNMLCAGYFD...C
ENSBTAP00000027207  WGRLVNG-..........-KLPKVLQCVNISVVSEKICSELY...............A--HVYHPSMFCAGGGQ...D
ENSBTAP00000025122  WGHQFEGG..........-EYSSFLQEAQVPLIDPQRCSAPD...............VHGAAFTQGMLCAGFLE...G
ENSBTAP00000017401  WGRLYTGG..........-PLPDKLQEALLPVVDYEHCSQWD...............WWGISVKKTMVCAGGD-...-
ENSBTAP00000002912  WGTMSSPQ..........LHLPHTLRCANVTIIKHRECEDAY...............P--GNITDTMVCASVRK...E
ENSBTAP00000017359  WGQLGVNM..........-PSTDKLQEVDLEVQSEEECIARF...............K--KYIPSKQICAGNPS...K
ENSBTAP00000016545  WGISNPNVtvdeiigsgtRTLSDVLQYVKLPVVPHAECKTSYesr............SGNYSVTENMFCAGYYE...G
ENSBTAP00000017363  WGRRGVNM..........-PSTDKLQEVDLEVRSEEECKDRF...............Q--DYNASIQICAGDPS...K
ENSBTAP00000017013  WGLTQRG-..........-FLARNLKFIDIPVVDHQKCTAAYekks...........YPEGRVTDNMLCAGLQS...G
ENSBTAP00000005550  WGQVKQRFsan.......STLASELQEAEVFIMDNKKCDQIYrkkship........RVVPLVLGDMICATNY-...-
ENSBTAP00000025732  WGVTETG-..........-EGSRHLLDAKVKLISNTICNSRQ...............LYDHSIDDNMICAGNLQk..P
ENSBTAP00000012471  WGMVNDQEl.........LPTPRTLQEAQVGFLDNSFCESILkppeti.........NQTIAIQDGMLCAADFL...A
ENSBTAP00000013262  WGRDSTD-..........-TYADTLQEVKLIVQEDQKCEAYL...............RN-FYNRAIQLCVGDPK...T
ENSBTAP00000051933  WGKVDIHAn.........PQSPYSLQEVAVKIINNDICNQQYkflflt.........NQKKLLGNDMICATSHL...-
ENSBTAP00000011362  FGIMEER-..........--ISHNLRFVRLPVAKREICERWLrqk............NRNDVFSENMFCAGNPA...T
ENSBTAP00000017607  WGLIGLN-..........-MRTDTLQCVQLRVQRDRVCRRRF...............M--LYYGRTQICVGDPR...Q
ENSBTAP00000006358  WGRTNVK-..........-SHVIKLRGAKLPVAPLSKCREMKgvnpgid........ISSFVFTENMICAGNDK...-
ENSBTAP00000006807  WGATDPEG..........LSLSDTLREVTVTVISRKTCNSRDyy.............NHSPVITRTMLCAGDAR...G
ENSBTAP00000055802  WGVVSHTG..........-RKPDRLQHLLLPVLDRATCNLRT...............YHDGTITERMMCAESN-...-
ENSBTAP00000014364  WGKVALG-..........-TPATTLQEVELTVQEDRVCESLN...............PR-NYSRATQICVGDPR...K
ENSBTAP00000045833  WGREKDN-..........-QKVYSLRWGEVHLINN--CSEFY...............PG-RYFEKEMQCAGTDD...G
ENSBTAP00000039032  WGSVSDFE..........-ELPPGLMEAEVRVLELDACNSSW...............K--GQLSPAMLCTHSGDr..R
ENSBTAP00000007060  WGKISETS..........-EYSNILQEVEVPIMDDRRCGAMLrg.............MNLPPLGRDMLCASFPD...G
ENSBTAP00000052108  WGLTRLH-..........-RRAITLQEVQLTIQRDGECHSRF...............D--FYTGQKQICVGDPR...E
ENSBTAP00000054089  WGKISETS..........-EYSNILQEVEVPIMDDRRCGAMLrg.............MNLPPLGRDMLCASFPD...G
ENSBTAP00000031726  WATTSSRR..........VKYNKGLSCSRVTILSPKECEVFY...............P--GVITSNMMCAGLDQ...-
ENSBTAP00000002709  WGLTHQPG..........-NLARVLQELDVHVLDTRMCNNSR...............FWHGNISSHMICLAADS...K
ENSBTAP00000051578  --------..........-KMSDILQQGSVQLINRTRCNAED...............AYQGEVTKTMMCAGLPE...G
ENSBTAP00000011737  WGQTAVNE..........-PASSILQEVELRLMEPRACSHFS...............A---FNHNLQLCVGNPQ...S
ENSBTAP00000046934  WGMLNEES..........ERGHNLLQEGKVSFVENKFCNMLYglak...........GKNVSVQEDMLCAGDFS...T
ENSBTAP00000054275  WGRLGTLE..........-PLPQVLQELNVTVVT--------...............---FLCRPQNVCTYVPR...R
ENSBTAP00000046937  WGMLNEETp.........LLEPFHLQEGKVSFVENKFCNMLYglak...........GKNVSVQEDMLCAGDFS...T
ENSBTAP00000021566  FGVEMDW-..........--LSTKLKYSRLPVAPRAACEAWLrer............QRPEAFTDGMFCAGDQT...R
ENSBTAP00000054098  FGVEMDW-..........--LSTKLKYSRLPVAPRAACEAWLrer............QRPEAFTDGMFCAGDQT...R
ENSBTAP00000047813  WGLPRVDGq.........WPQFRTIQEKEVTILNSTECDSLYrrfskip........SLIQIINSQMICAKDVD...-
ENSBTAP00000052086  WGQTAVNE..........-PASSTLQEVKLRLMEPRACSHFS...............A---FNHNLQLCVGNPQ...S
ENSBTAP00000055933  WGRLGTNR..........-PPPQILQQLNVTVVT--------...............---GLCRPTNVCTLVPR...R
ENSBTAP00000048088  WGQVALG-..........-TPATTLQEAELMVQEDRMCESLN...............PR-HYSRATQNCVGDPR...K
ENSBTAP00000053944  WGRLGTNR..........-PPPQILQQLNVTVVT--------...............---GLCRPTNVCTLVPR...R
ENSBTAP00000051737  WGQVALG-..........-TPATTLQEAELMVQEDRMCESLN...............PR-HYSRATQNCVGDPR...K
ENSBTAP00000029273  WGQFYNN-..........-SPVSILREVIVTIIDRKICNDQSh..............YNNPVIGLNMICAGSLQ...G
ENSBTAP00000042196  WYQHTND-..........--APRTLRNLRLRLISRPTCNCLYnrlhqr.........SLASPARPGMLCGGPQP...G
ENSBTAP00000039959  WGSTKKDA..........CQMSNALREANVTVIDRKICNDAQhy.............NFNPVIDLSMICAGGRK...G
ENSBTAP00000009800  YEKVKDVS..........------------------------...............---EVVTPRFLCTGGVD...P
ENSBTAP00000006095  WDNSAM--..........-TPPYTLKELKVHLIDLQTCKKYQkesll..........RGVEPISEAMICSRFPV...G
ENSBTAP00000023490  WGYTGLI-..........-NSDGLLRVAHLYIMGNEKCSQYH...............QGKVTLNESEICAGAEN...I
ENSBTAP00000008335  WGRNENF-..........-NFTEHLKYVMLPVADQDKCVKHYegidapknktakspvGVQPILNENTFCVGLSK...Y
ENSBTAP00000055870  WGTMSSPQ..........LHLPHTLRCANVTIIKHRECEDAY...............P--GNITDTMVCASVRK...E
ENSBTAP00000030635  WGETKGT-..........-GDDTVLNIALLSVISNQECNVKH...............R--GRVRESEMCTAGLL...A
ENSBTAP00000052308  WGTLYMNG..........-LLPVILQQAFLKIIDN-VCNAPY...............ALSGLVTDTMLCAGFMS...G
ENSBTAP00000011042  --------..........-SPFSLQNTVTTGIVSTTQRGGKE...............L--GLRNSDMDY---IQ...T
ENSBTAP00000026804  SPFALQNT..........-ITSGIVSSAQRPAKDLGLPQTNV...............E-------------YIQ...T
ENSBTAP00000004564  --------..........-SPFSLQNTVTAGIVSTTQRGGKE...............L---GLKDSDMDYIQT-...-
ENSBTAP00000055424  WGTRRRRG..........-RLSRVPRVLNVTVTPANQCR---...............-------PNNVCTGVLT...R
ENSBTAP00000056087  WGTRRRRG..........-RLSRVPRVLNVTVTPANQCR---...............-------PNNVCTGVLT...R
ENSBTAP00000046935  WGMLNEET..........-SFPDFLLMLVAPLLEPFHLQEDGr..............GKNWAVHMEMLRAGDFS...T
ENSBTAP00000016767  WNVLADSRsp........GYKDDTLRSGVVRVADSLLCEEQHeaq............GIPVSVTDSMFCAGRDPt..A
ENSBTAP00000009798  DKLNINL-..........KTGSEWTNCVKVVLEDKTTFPNLT...............DVREVVTDQFLCSGTQG...-
ENSBTAP00000042196  LARQGAD-..........---TGSPQTVPVTLLGPRACSRLH...............AALGSILPGMVCTSVVG...-
ENSBTAP00000004732  WAYNLCDH..........YKDPDSLQNVNISVISKVECLKAY...............KY-MHIRDSMMCVGIVP...G
ENSBTAP00000049751  WGRTLEFV..........-GLARAALGGGWMMVKCSALKCHS...............QK-PGPGEGPWCLSPQ-...-
ENSBTAP00000022878  WGWSWQNS..........EPKPDVKINQTVSCFPNEHCEASPig.............KMPVKITENMFCAGLSL...E
ENSBTAP00000049751  W-------..........------------------------...............-----------------...-
ENSBTAP00000018804  WNPTSATGn.........HMTMSILRKISVKD--IDSCP---...............---LNIEQKTGCGNHLEm..E
ENSBTAP00000041742  WTWSKYKN..........LSDPDILTWINQYTRPYDECQNMQ...............D--ERMAANVLCVGQPL...K
ENSBTAP00000054780  WGISIID-..........-KLSDCPVPLEALGKSGKKTQRYYkdfelml........SSWGSVHVNTLCAGDFS...T
ENSBTAP00000039011  WVEDKRSF..........GNRRGYLQSFMTELSTDLVCRTLL...............H--KKFFEDVFCVGHLR...K
ENSBTAP00000024541  LDWSQNNN..........GRHPDLRQNLEAPVMSDTACQETE...............Q--GKSHRNSICVKFLK...V
ENSBTAP00000042824  DKLNINL-..........KTGSEWTNCVKVVLEDKTTFPNLT...............DVREVVTDQFLCSGTQG...-
ENSBTAP00000051417  --------..........------------------------...............-----------------...-
ENSBTAP00000025894  WTLRGRE-..........----MVPLRLRVTHVEPAECGRAL...............N--ATVTTRTSCERGA-...-
ENSBTAP00000054781  --------..........------------------------...............-----------------...-
ENSBTAP00000053077  WKD-----..........-PQDRVPVAAAVSILTPRLCHCLY...............Q--GLLPPGTLCVLYAE...G
ENSBTAP00000053077  WGRGEPA-..........-PGASSLL--EAELLSAWWCHCLYgrqgas.........VPPPGEPPQALCPAYQEe..E
ENSBTAP00000020194  YDNDRPGN..........---------------------LVY...............RF-CDVQDETYDLLYQ-...-
ENSBTAP00000037916  FDQDRADQ..........---------------------LVY...............R-FCSVSDESNDLLYQ-...-
ENSBTAP00000047553  HPEGQIKKidgcsvisl.EQRLERYKEHYSDGVVPGSCSDIYnafpm..........FTQRSFLSEVWSTNTLS...Y
ENSBTAP00000003767  --------..........-----------------GSCSDIYnafpm..........FTQRSFLSEVWSTNTLS...Y
ENSBTAP00000053065  WVMAPSYDrk........DNFNMYLQKLRVVQITWRDCSQRV...............D---HLSRNMLCAWQEL...G
ENSBTAP00000055732  WGVVSHTG..........-RKPDRLQHLLLPVLDRATCNLRT...............YHDGTITERMMCAESN-...-
ENSBTAP00000047875  --------..........------------------------...............-----------------...-
ENSBTAP00000054539  --------..........------------------------...............-----------------...-
ENSBTAP00000047875  --------..........------------------------...............-----------------...-
ENSBTAP00000054539  --------..........------------------------...............-----------------...-
ENSBTAP00000055003  --------..........------------------------...............-----------------...-
ENSBTAP00000003182  --------..........-------------------A----...............-----------------...-


                              210         220             230            240                        
                                |           |               |              |                        
d1fiw.1               KID......TC.Q.GDSGGPLMCKDSAEN......SYVVVGITS...WGV..GCARAKR..........P........
ENSBTAP00000004737  GKD......SC.Q.GDSGGPVVCSG----......--KLQGIVS...WGS..GCAQKNK..........P........
ENSBTAP00000033392  GKD......SC.Q.GDSGGPVVCSG----......--KLQGIVS...WGS..GCAQKNK..........P........
ENSBTAP00000012503  GKD......AC.K.GDSGGPLVCQH--EE......TWHLVGITS...WGE..GCARREQ..........P........
ENSBTAP00000026272  GVD......AC.Q.GDSGGPLSSPE-EDG......RMFQAGVVS...WGE..GCAQRNK..........P........
ENSBTAP00000055274  GRD......SC.Q.GDSGGPLVCEQ--NG......RWYLAGVTS...WGT..GCGQRNK..........P........
ENSBTAP00000000958  KVD......SC.Q.GDSGGPLVCEE-SSG......RFFLAGIVS...WGI..GCAEAQH..........P........
ENSBTAP00000010989  GRD......SC.Q.GDSGGPLVCEQ--NG......RWYLAGVTS...WGT..GCGQRNK..........P........
ENSBTAP00000027425  QKD......AC.Q.GDSGGPLVCMK--SG......RWILVGVVS...WGK..GCALPNR..........P........
ENSBTAP00000042983  KKD......AC.Q.GDSGGPLVCKE-PSG......RWFLAGLVS...WGL..GCGRPNY..........F........
ENSBTAP00000028354  GVD......SC.Q.GDSGGPLVCQE--RR......VWKLVGATS...FGI..GCAEVNK..........P........
ENSBTAP00000027417  KRD......AC.K.GDSGGPLVCLV--GQ......VWLQAGVIS...WGE..GCARRNR..........P........
ENSBTAP00000037246  SKD......AC.Q.GDSGGPLSCPV--AG......RWYLAGIVS...WGD..ACGAPNR..........P........
ENSBTAP00000023479  RAD......AC.Q.GDSGGPLVCLD--EG......TWRLVGVVS...WGH..GCAEPSH..........P........
ENSBTAP00000037407  GRD......SC.Q.GDSGGPLVCKV--NG......TWLQAGVVS...WGD..GCAKPNR..........P........
ENSBTAP00000002505  GVD......AC.Q.GDSGGPLVQED-SRQ......HWFIVGIVS...WGY..QCGLPDK..........P........
ENSBTAP00000054149  GVD......SC.Q.GDSGGPLMCQE--NN......RWLLAGVTS...FGY..QCALPNR..........P........
ENSBTAP00000000788  GVD......SC.Q.GDSGGPLMCQE--NN......RWLLAGVTS...FGY..QCALPNR..........P........
ENSBTAP00000050450  SVD......AC.Q.GDSGGPLVGED-YKG......TWFLAGIVS...WGD..ECALPNK..........P........
ENSBTAP00000050393  SVD......AC.Q.GDSGGPLVGED-YKG......TWFLAGIVS...WGD..ECALPNK..........P........
ENSBTAP00000028731  GKD......SC.Q.GDSGGPVACNG----......--QLQGIVS...WGY..GCAQKGK..........P........
ENSBTAP00000009636  GRN......FC.Q.GDSGGPLVCKV--NG......TWLQAGVVS...WGD..GCAKPNR..........P........
ENSBTAP00000009406  RGD......AC.E.GDSGGPFVMKSPYNN......RWYQMGIVS...WGE..GCDRDGK..........Y........
ENSBTAP00000004648  GKD......AC.K.GDSGGPLSCKH--NE......VWHLVGITS...WGE..GCGQRER..........P........
ENSBTAP00000013434  KID......TC.Q.GDSGGPLMCKDSVEN......SYVVVGITS...WGV..GCARAKR..........P........
ENSBTAP00000001642  GGDhtnlhdAC.Q.GDSGGPLVCMK--DN......HMTLVGIIS...WGL..GCGRKDV..........P........
ENSBTAP00000050246  GIS......SC.M.GDSGGPLVCQK--DG......AWTLAGIVS...WGS..SRCSPFL..........P........
ENSBTAP00000004986  GID......AC.Q.GDSGGPFVCEDSISRtp....RWRLCGIVS...WGT..GCALAQK..........P........
ENSBTAP00000053077  RRD......TC.Q.GDSGGPLVCKE--GG......RWFQAGITS...FGF..GCGRRNR..........P........
ENSBTAP00000021967  ERD......AC.L.GDSGGPLMCQV--EG......TWLLAGVIS...WGE..GCAQRNR..........P........
ENSBTAP00000028678  GVD......TC.Q.GDSGGPLMYHS---D......WWQVVGIVS...WGH..GCGGPTT..........P........
ENSBTAP00000012036  TVD......SC.Q.GDSGGPLVTLK--SS......VWWLIGDTS...WGS..GCAKAYR..........P........
ENSBTAP00000000958  GVD......SC.S.GDAGGPLACRE-PSG......RWVLTGVTS...WGY..GCGRPQF..........P........
ENSBTAP00000033941  VTS......SC.N.GDSGGPLNCQA-ANG......QWQVHGIVS...FGSslGCNYYRK..........P........
ENSBTAP00000012346  GKD......SC.E.GDSGGPLVCNG----......--TLHGIIS...WGDf.PCGQPNR..........P........
ENSBTAP00000000958  KVD......SC.Q.GDSGGPLACEE-TPG......VFYLAGIVS...WGI..GCAQVKK..........P........
ENSBTAP00000033942  VIS......AC.N.GDSGGPLNCQA-ENG......NWDVRGIVS...FGSglSCNTFKK..........P........
ENSBTAP00000011204  GVS......SC.M.GDSGGPLVCQK--NG......AWTLAGIVS...WGS..STCSTST..........P........
ENSBTAP00000036577  KLD......AC.E.GDSGGPLVIPR-DGN......IWYLIGIVS...WGM..DCGKENK..........P........
ENSBTAP00000052308  NID......AC.Q.GDSGGPLVHPN-SRN......IWYLVGIVS...WGT..ECGTVNK..........P........
ENSBTAP00000001674  GTD......SC.Q.GDSGGPLVCFE--KD......KYILQGVTS...WGL..GCARPNK..........P........
ENSBTAP00000024677  GKD......TC.V.GDSGGPLICEG----......--MLQGITS...WGHi.PCGTPNK..........P........
ENSBTAP00000016644  GKD......SC.Q.GDSGGPLVCGG----......--QLQGLVS...WGMe.RCAQPGY..........P........
ENSBTAP00000015915  GVS......SC.M.GDSGGPLVCKK--NG......AWTLVGIVS...WGS..STCSTST..........P........
ENSBTAP00000048279  GKD......SC.Q.GDSGGPHVTEV--EG......TSFLTGIIS...WGE..ECAMKGK..........Y........
ENSBTAP00000036408  MKT......AC.E.GDSGGPLVCEF--DR......TWVQIGVVS...WGQ..GCAYPMY..........P........
ENSBTAP00000054627  GRD......SC.Q.GDSGGPLVCSW--ND......TWVQVGIVS...WGD..ICGHRDL..........P........
ENSBTAP00000005227  GKD......SC.Q.GDSGGPHVTEV--EG......TSFLTGIIS...WGE..ECAMKGK..........Y........
ENSBTAP00000049751  GKD......AC.Q.GDSGGPLVCEF--NN......SWVQVGIVS...WGI..GCGRSGY..........P........
ENSBTAP00000048972  DAD......SC.K.GDSGGPLVCEK--NG......RWIQIGIVS...WGV..GCGRRNR..........P........
ENSBTAP00000055314  GKD......SC.F.GDSGGPLVCEK--KG......LWYQVGVVS...WGV..GCGRPNR..........P........
ENSBTAP00000006095  GKD......TC.Q.GDSGGPLACHI--DG......IWILIGLSS...WGR..GCGI-SF..........P........
ENSBTAP00000007060  EKD......VG.Q.GDSGGLLVCKH-EKG......PFVLYGIVS...WGA..GCDQPRK..........P........
ENSBTAP00000024680  GIN......SC.E.GDSGGPLVCGG----......--VLQGIVS...WGDv.PCDTTTK..........P........
ENSBTAP00000051470  GRD......AC.Q.GDSGGSLMCRN-KKG......TWTMAGVTS...WGL..GCGRGWKnnlqkddqgsP........
ENSBTAP00000055795  GRD......AC.Q.GDSGGSLMCRN-KKG......TWTMAGVTS...WGL..GCGRGWKnnlqkddqgsP........
ENSBTAP00000052308  NKD......AC.Q.GDSGGPLVSPD-ARD......IWYLAGIVS...WGD..ECGQPNK..........P........
ENSBTAP00000021789  PED......AC.Q.GDSGGPHVTRF--KD......TYFVTGIVS...WGE..GCARKGK..........F........
ENSBTAP00000019098  DAD......SC.K.GDSGGPLVCEK--NG......RWIQIGIVS...WGV..GCGRRNR..........P........
ENSBTAP00000046176  SYD......SC.Q.GDSGGPLACTQESGK......KWYHVGIIS...WGR..SCGLKNT..........P........
ENSBTAP00000005163  PRD......AC.E.GDSGGPMVTFF--RG......TWFLVGLVS...WGE..GCGRLYN..........Y........
ENSBTAP00000054336  GQD......SC.K.GDSGGALVCLW--KC......SWVQVGVVS...WGH..KCALPDF..........P........
ENSBTAP00000020053  KKD......AC.R.GDSGGPLSCRRKSDG......KWILTGIVS...WGH..GCGRPNF..........P........
ENSBTAP00000005785  KVD......AC.K.GDSGGPLVYDN--HE......IWYLVGIVS...WGQ..SCALPKK..........P........
ENSBTAP00000002923  GED......AC.Q.GDSGGPLVCGG----......--VLQGLVS...WGSvgPCGQEGI..........P........
ENSBTAP00000020025  GKD......SC.F.GDSGGPLVCEK--KG......LWYQVGVVS...WGV..GCGRPNR..........P........
ENSBTAP00000027772  GRD......SC.Q.GDSGGPVVCNG----......--SLQGLVS...WGDf.PCAQPNR..........P........
ENSBTAP00000027594  RVD......SC.Q.GDSGGPLVCER-LGE......RWVVYGVTS...WGY..GCGVKDS..........P........
ENSBTAP00000009746  SKD......AC.K.GDSGGPHATRF--RG......TWFLTGVVS...WGE..GCAAAGH..........F........
ENSBTAP00000020127  GAD......TC.Q.GDSGGPLVCNG----......--VLHGITS...WGSd.PCGRPEK..........P........
ENSBTAP00000010816  GKD......SC.Q.GDSGGPLVCQY--ST......TWVQVGIVS...WGV..GCGRNNT..........P........
ENSBTAP00000054342  IYD......AC.R.GDSGGPLVGKD-FKD......TWYLIGIVS...WGD..NCGQRNK..........P........
ENSBTAP00000020123  RTN......AC.N.GDSGGPLMCKG----......--TLQGVVS...WGSf.PCGQPND..........P........
ENSBTAP00000027052  IYD......AC.R.GDSGGPLVGKD-FKD......TWYLIGIVS...WGD..NCGQRNK..........P........
ENSBTAP00000007806  ETD......SC.Q.GDSGGPLVCTI--QG......RLTLTGIVS...WGR..DCAMKYK..........P........
ENSBTAP00000054089  EKD......KCsK.GDSGGLLVCKH-EKG......PFVLYGIVS...WGA..GCDQPRK..........P........
ENSBTAP00000020121  GKD......SC.Q.GDSGGPLVCGD----......--RLRGLVS...WGNv.PCGSKEK..........P........
ENSBTAP00000052855  GKD......AC.Q.GDSGGPLVCQKKTRKs.....KWYQLGIVS...WGV..GCGQKKQ..........P........
ENSBTAP00000050470  GRG......SC.Q.GDSGGPLVCNG----......--TLAGVVS...GGSe.PCSRPRR..........P........
ENSBTAP00000002847  TVD......SC.M.GDSGGPLVCEK-PGG......QWTLFGLTS...WGS..VCFSKVLg.........P........
ENSBTAP00000050126  RKN......SF.S.GDSGGPLVCNG----......--VAQGIVS...YGR..NDG--TT..........P........
ENSBTAP00000011718  VRA......GC.Q.GDSGGPLHCLV--NG......QYAVHGVTS...FVSslGCNVSKK..........P........
ENSBTAP00000046936  GTS......IC.L.GDSGGPLVCDF--TS......SWVLMGLAS...WGF..DCRHPIY..........P........
ENSBTAP00000023055  RSD......AC.Q.GDSGGPLACEK--NG......VAYLYGIIS...WGD..GCGRLNK..........P........
ENSBTAP00000027207  QKD......SC.H.GDSGGPLVCNG----......--SLQGLVS...FGQa.QCGQPYV..........P........
ENSBTAP00000025122  GTD......AC.Q.GDSGGPLVCEDETPEr.....QLILRGIVS...WGS..GCGNRLK..........P........
ENSBTAP00000017401  TRS......GC.N.GDSGGPLNCPA-ADG......SWQVHGVAS...FVSafGCNTIKK..........P........
ENSBTAP00000002912  GKD......SC.Q.GDSGGPLVCNG----......--SLQGIIS...WGQd.PCAVSKK..........P........
ENSBTAP00000017359  RKN......SF.S.GDSGGPLVCDG----......--VAQGIVS...YGR..KDG--TT..........P........
ENSBTAP00000016545  GKD......TC.L.GDSGGAFVILDDASQ......RWVAQGLVS...WGGpeECGSKQV..........Y........
ENSBTAP00000017363  RKN......SF.S.GDSGGPLVCNG----......--VAQGIVS...YGR..DDG--TT..........P........
ENSBTAP00000017013  GKD......SC.R.GDSGGALVFLDNETQ......KWFVGGIVS...WGSi.NCGEADQ..........Y........
ENSBTAP00000005550  RED......LC.S.GDSGGPLACEV--EG......RWILAGVLS...WEK..ACAKVRN..........P........
ENSBTAP00000025732  GQD......SC.Q.GDSGGPLTCEK--DG......TSYIYGIVS...WGL..ECG--KR..........P........
ENSBTAP00000012471  GKS......VC.R.GDSGGPLVCKL--ND......TWYLMGLAS...FST..PCEKPIG..........P........
ENSBTAP00000013262  KKA......SF.Q.GDSGGPLVCDN----......--VAQGIVS...YGK..RDG--ST..........P........
ENSBTAP00000051933  GMD......TC.Q.SNSGNSLVCQM--DN......SWIQMGVVT...WSF..SCNRRHF..........P........
ENSBTAP00000011362  RQD......SC.Q.GDSGGVFAVSDKRND......RWVATGIVS...WGI..GCG--EG..........Y........
ENSBTAP00000017607  RKS......AF.L.GDSGGPLVCSN----......--VAQGVVS...YGD..RMGTP--..........P........
ENSBTAP00000006358  GVD......SC.D.GDSGGAFAVQDPKENkp....KFYVAGLVS...WGP..QCGT---..........Y........
ENSBTAP00000006807  QKD......SC.Q.GDSGGPLVCKG----......--AFHALVS...GGP..KCGDAKK..........P........
ENSBTAP00000055802  RRD......TC.K.GDSGGPLVCGS----......--VAEGVVT...SGSr.ICGNHKK..........P........
ENSBTAP00000014364  VKT......GF.K.GDSGGPLVCKK----......--VVHGIFS...YGK..TNGTP--..........P........
ENSBTAP00000045833  SID......AC.K.GDSGGPLVCQD-VNN......VTYVWGVVS...WGE..NCGKSEF..........P........
ENSBTAP00000039032  RRG......FC.S.ADSGGPLVCRN----......--RAYGLVS...FSGl.WCGDPKT..........P........
ENSBTAP00000007060  EKD......AC.QkRDSGGPLVCRR-DDG......VWVLAGITS...WAA..GCTRVWN..........Pfrnkqrka
ENSBTAP00000052108  GKS......TF.L.GDSGGPLVCSN----......--VAQGIVS...YGD..RMGTP--..........P........
ENSBTAP00000054089  EKD......AC.QkRDSGGPLVCRR-DDG......VWVLAGITS...WAA..GCTRVWN..........Pfrnkqrka
ENSBTAP00000031726  GQD......PC.Q.SDSGGPLVCDE----......--TLQGILS...WGVy.PCGSAQH..........P........
ENSBTAP00000002709  NQA......PC.K.GDSGGPVVCKRG---......--QVAGILS...FSSe.NCTDIFK..........P........
ENSBTAP00000051578  GVD......TC.Q.GDSGGPLMYHS---D......WWQVVGIVS...WGH..GCGGPTT..........P........
ENSBTAP00000011737  TKS......TF.K.GDSGGPLLCAG----......--VAQGIVS...YGL..SNAK--P..........P........
ENSBTAP00000046934  GTS......IC.L.GDSGGPLVCDF--TS......SWVLMGLAS...WGF..DCRHPIY..........P........
ENSBTAP00000054275  SAG......IC.F.GDSGGPLICNG----......--VLHGVDS...FVIr.GCATGQY..........P........
ENSBTAP00000046937  GTS......IC.L.GDSGGPLVCDF--TS......SWVLMGLAS...WGF..DCRHPIY..........P........
ENSBTAP00000021566  PQS......VC.Q.GDSGGAFVVWDDRTQ......RWVATGIVS...WGI..GCG--EG..........Y........
ENSBTAP00000054098  PQS......VC.Q.GDSGGAFVVWDDRTQ......RWVATGIVS...WGI..GCG--EG..........Y........
ENSBTAP00000047813  REK......FC.Y.EISGEPLACPV--QN......IWHLVGVVS...WGP..GCKKSEA..........P........
ENSBTAP00000052086  TKS......AF.K.GDSGGPLLCAG----......--VAQGIVS...YGL..PSAK--P..........P........
ENSBTAP00000055933  RAG......IC.F.GDSGGPLVCNG----......--LVHGIDS...FIRg.GCGSGVF..........P........
ENSBTAP00000048088  VKT......GF.K.GDSGGPLVCKK----......--VVHGTFS...YGK..KNGTP--..........L........
ENSBTAP00000053944  RAG......IC.F.GDSGGPLVCNG----......--LVHGIDS...FIRg.GCGSGVF..........P........
ENSBTAP00000051737  VKT......GF.K.GDSGGPLVCKK----......--VVHGTFS...YGK..KNGTP--..........L........
ENSBTAP00000029273  GKD......SC.PlGDSGSPLICKD----......--TFRGITA...FGIpgRCGDPRG..........P........
ENSBTAP00000042196  MQG......PC.Q.GDSGGPVLCRE-PDG......HWVQAGIIS...FAS..SCAREDT..........P........
ENSBTAP00000039959  EDD......SC.E.GDSGSPLICDN----......--VFRGVTS...FGK..-CGNPQK..........P........
ENSBTAP00000009800  YADpn....TC.K.GDSGGPLIIHK--RS......RFIQVGVIS...WGVvdVCKRPQQ..........Vpgyar...
ENSBTAP00000006095  QPD......AC.I.ARRGDPLMCRV--KD......FWVLAGVMS...WGS..NCIGIDE..........P........
ENSBTAP00000023490  VSG......PC.E.GDYGGPLVCEQ--HK......MRMVLGVIV...PGR..GCAIPNR..........P........
ENSBTAP00000008335  QDD......TC.Y.GDAGSAFVVHDKEDD......TWYAAGILS...FDK..SCAV-AE..........Y........
ENSBTAP00000055870  GKD......SC.Q.GDSGGPLVCNG----......--SLQGIIS...WGQd.PCAVSKK..........P........
ENSBTAP00000030635  PVG......AC.E.GDYGGPLACFT--HD......CWVLQGIII...PNR..VCARPRW..........P........
ENSBTAP00000052308  EVD......AC.Q.NDSGGPLAYSN-SRN......IWHLVRIVS...AGE..GCGKKNK..........P........
ENSBTAP00000011042  DAI......IN.Y.GNSGGPLVNLDG---......--EVIGIN-...---..-------..........-........
ENSBTAP00000026804  DAA......ID.F.GNSGGPLVNLDG---......--EVIGVNT...---..-------..........-........
ENSBTAP00000004564  DAI......IN.H.GNSGGPLVNLDG---......---------...---..-------..........-........
ENSBTAP00000055424  RGG......IC.Q.GDGGTPLVCNG----......--LAHGVAS...WSR..GPCG-RG..........T........
ENSBTAP00000056087  RGG......IC.Q.GDGGTPLVCNG----......--LAHGVAS...WSR..GPCG-RG..........T........
ENSBTAP00000046935  GKS......SC.R.SDSEGPLICDF---T......SWVLMGLAS...WGF..DCRHPIY..........P........
ENSBTAP00000016767  PSD......IC.T.AETGGIAAVSFP--GraspepRWHLVGLVS...WSYd.KTCSHSL..........S........
ENSBTAP00000009798  DDS......PC.K.GESGGAVFLER--RL......RFFQVGLVS...WGLynPCGGSSK..........Nsrkpaphg
ENSBTAP00000042196  EPP......SC.E.GLSGAPLVHEV--RG......TWFLAGLHS...FGD..ACQGPAR..........P........
ENSBTAP00000004732  RRQ......PC.K.EVTAAPAVCNG----......--ILQGILT...FAD..GCVLRAD..........V........
ENSBTAP00000049751  SFH......SC.Q.GDSGSPLVCQF--QT......SWIQVGIFP...ITG..PCAS---..........-........
ENSBTAP00000022878  SKH......TC.K.EVLAAPILCQN----......--QLQGILS...WSE..GCVLRGD..........V........
ENSBTAP00000049751  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000018804  TNA......VC.L.GDPGNPMMCQLKEMS......LWVLRGILS...QGGe.KCP---G..........L........
ENSBTAP00000041742  TLS......DA.K.EVSAAPAICGG----......--RVHGILS...WAK..GSVTLGN..........E........
ENSBTAP00000054780  GTS......IC.R.SDSGGPLVCDF---T......SWVLMGLAS...WGF..DCQYPIN..........P........
ENSBTAP00000039011  NTD......EC.Q.VTTAAPATCGN----......--KLQGIMS...WTT..GCFLTDH..........S........
ENSBTAP00000024541  FSR......IF.G.ELAVATVICKN----......--KLQGIEV...GHF..MGGD---..........V........
ENSBTAP00000042824  DDS......PC.K.GESGGAVFLER--RL......RFFQVGLVS...WGLynPCGGSSK..........Nsrkpaphg
ENSBTAP00000051417  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000025894  AAG......AA.R.WVAGGAVVREH--RG......AWFLTGLLG...AAP..PEG--PG..........P........
ENSBTAP00000054781  ---......IN.Y.GNSGGPLVNLDG---......--EVIGIN-...---..-------..........-........
ENSBTAP00000053077  QED......RC.E.VTSAPPLLCQT-EGG......SWVLVGMAV...RGS..-------..........R........
ENSBTAP00000053077  AEG......SC.W.NYSHWSLLCRE--EG......TWFLAGIRD...LPS..DCLR---..........P........
ENSBTAP00000020194  QCD......AQ.P.GASGSGVYVRMWKRQqqkw..ERKIIGIFSghqWVD..VNGSPQD..........F........
ENSBTAP00000037916  YCD......AE.S.GSTGSGVYLRLKEPDkk....R--------...---..-------..........-........
ENSBTAP00000047553  DTY......FS.S.GSSGSPVFNASG---......--KLVAMHS...FGH..FYS----..........-........
ENSBTAP00000003767  DTY......FS.S.GSSGSPVFNASG---......--KLVAMHS...FGH..FYSH---..........-........
ENSBTAP00000053065  TKG......NC.Q.GDSGAPMVCTIHGSR......RLFQVG---...---..-------..........-........
ENSBTAP00000055732  RRD......TC.K.---------------......---------...---..-------..........-........
ENSBTAP00000047875  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000054539  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000047875  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000054539  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000055003  ---......--.-.---------------......---------...---..-------..........-........
ENSBTAP00000003182  ---......--.-.---------------......---------...---..-------..........-........


                           250        260       270                                                 
                             |          |         |                                                 
d1fiw.1               ....GVYTSTWS.YLNWIASKIGS----------tavhmiqlpt..................................
ENSBTAP00000004737  ....GVYTKVCN.YVSWIKQTI------------............................................
ENSBTAP00000033392  ....GVYTKVCN.YVSWIKQTI------------............................................
ENSBTAP00000012503  ....GVYTKVAE.YVDWILEKTQ-----------d...........................................
ENSBTAP00000026272  ....GVYTRLPV.FRDWIKAQIG-----------............................................
ENSBTAP00000055274  ....GVYTKVTE.VLPWIYSKME-----------............................................
ENSBTAP00000000958  ....GVYARVTS.LRDWILETI------------a...........................................
ENSBTAP00000010989  ....GVYTKVTE.VLPWIYSKME-----------............................................
ENSBTAP00000027425  ....GVYTNVAT.YSPWIQAHLN-----------............................................
ENSBTAP00000042983  ....GVYTRITG.VIGWIQQVL------------............................................
ENSBTAP00000028354  ....GVYTRITS.FLDWIHEQME-----------r...........................................
ENSBTAP00000027417  ....GVYIRLTS.HHDWIHRII------------............................................
ENSBTAP00000037246  ....GVYTLTSV.YASWIHYK-------------v...........................................
ENSBTAP00000023479  ....GVYAKVAE.FLDWIQDT-------------a...........................................
ENSBTAP00000037407  ....GIYTRVTS.YLDWIHQYV------------............................................
ENSBTAP00000002505  ....GVYTRVTA.YRDWITQQTG-----------............................................
ENSBTAP00000054149  ....GVYARVPR.FTEWIQSF-------------l...........................................
ENSBTAP00000000788  ....GVYARVPR.FTEWIQSF-------------l...........................................
ENSBTAP00000050450  ....GVYTRVTH.YRDWIMSKTG-----------............................................
ENSBTAP00000050393  ....GVYTRVTH.YRDWIMSKTG-----------............................................
ENSBTAP00000028731  ....GVYTKVCN.YVDWIQETI------------a...........................................
ENSBTAP00000009636  ....GIYTRVTS.YLDWIHQYV------------............................................
ENSBTAP00000009406  ....GFYTHVFR.LKKWIQKVID-----------............................................
ENSBTAP00000004648  ....GVYSNVVE.YLDWILEKT------------q...........................................
ENSBTAP00000013434  ....GVYTSTWS.YLNWIASKIGSN---------tvh.........................................
ENSBTAP00000001642  ....GVYTKVTN.YLDWIRDNT------------............................................
ENSBTAP00000050246  ....GVYARVTK.FIPWILEVL------------e...........................................
ENSBTAP00000004986  ....GVYTKVSD.FREWIFQAIK-----------............................................
ENSBTAP00000053077  ....GVFTAVAP.YEAWIREQV------------s...........................................
ENSBTAP00000021967  ....GVYISLAA.HRSWVQRIV------------q...........................................
ENSBTAP00000028678  ....GVYTKVTA.YLNWIYNV-------------r...........................................
ENSBTAP00000012036  ....GVYGNVTV.FTDWIYQQMR-----------............................................
ENSBTAP00000000958  ....GVYTRVAA.VRGWIGQNIQ-----------............................................
ENSBTAP00000033941  ....SVFTRVSN.YNDWISSVIE-----------n...........................................
ENSBTAP00000012346  ....GVYTRVSQ.YVPWIQETIQ-----------............................................
ENSBTAP00000000958  ....GVYTRITR.LKGWILATMS-----------sh..........................................
ENSBTAP00000033942  ....TVFTRVSA.YIDWINQK-------------l...........................................
ENSBTAP00000011204  ....AVYARVTA.LMPWVQETL------------a...........................................
ENSBTAP00000036577  ....GVYTKVTR.YRDWIKSKT------------d...........................................
ENSBTAP00000052308  ....GVYTRVTA.YRNWIASKTG-----------............................................
ENSBTAP00000001674  ....GVYVRVSP.YVPWIEETMR-----------r...........................................
ENSBTAP00000024677  ....SVYTKVIL.YLDWINKTM------------t...........................................
ENSBTAP00000016644  ....GVYTNLCK.YHTWIQGTIR-----------............................................
ENSBTAP00000015915  ....GVYARVTA.LVNWVQQTL------------a...........................................
ENSBTAP00000048279  ....GIYTKVSR.YVNWIKEKTK-----------............................................
ENSBTAP00000036408  ....TVFARVSF.FSKWIHHHIE-----------n...........................................
ENSBTAP00000054627  ....GVYTRVTS.YVSWIHQYV------------............................................
ENSBTAP00000005227  ....GIYTKVSR.YVNWIKEKTK-----------............................................
ENSBTAP00000049751  ....GVYTEVSF.YKDWL----------------ia..........................................
ENSBTAP00000048972  ....GVYTNVSH.YFSWIQ---------------............................................
ENSBTAP00000055314  ....GVYTNISV.HYKWIREVL------------a...........................................
ENSBTAP00000006095  ....GIYTNVTY.YQKWIMSVI------------s...........................................
ENSBTAP00000007060  ....GVFARVSV.FLDWIQSKIK-----------............................................
ENSBTAP00000024680  ....GVYTKVCS.YLEWIKETMK-----------............................................
ENSBTAP00000051470  ....GIFTDLTK.VLSWIHKHIR-----------............................................
ENSBTAP00000055795  ....GIFTDLTK.VLSWIHKHIR-----------............................................
ENSBTAP00000052308  ....GVYTKVTT.FRDWITSKTG-----------............................................
ENSBTAP00000021789  ....GVYTKVSN.FLKWIDKIMK-----------............................................
ENSBTAP00000019098  ....GVYTNVSH.YFSWIQ---------------............................................
ENSBTAP00000046176  ....GIYTLLEN.YHSWIKKVT------------............................................
ENSBTAP00000005163  ....GVYTKVSR.YLDWIYGHIK-----------............................................
ENSBTAP00000054336  ....GVYTRVTS.YMSWIRQYV------------............................................
ENSBTAP00000020053  ....GVYTRVSN.FVPWIHKYV------------............................................
ENSBTAP00000005785  ....GVYTRVSQ.YRNWIASKTG-----------............................................
ENSBTAP00000002923  ....GVYTNVCK.YVDWIQTVMR-----------s...........................................
ENSBTAP00000020025  ....GVYTNISV.HYKWIREVLA-----------qnn.........................................
ENSBTAP00000027772  ....GVYTNLCR.FTKWIQDTIK-----------............................................
ENSBTAP00000027594  ....GVYTEVSA.FVPWIKRVT------------............................................
ENSBTAP00000009746  ....GIYTRVSR.YTAWLRQLMG-----------............................................
ENSBTAP00000020127  ....GVYSKVCR.SLDWIKKTIG-----------............................................
ENSBTAP00000010816  ....GVYTETAL.YAKWLVAVVN-----------k...........................................
ENSBTAP00000054342  ....GVYTKVTY.YRNWIASKTG-----------............................................
ENSBTAP00000020123  ....GVYTQVCK.YVNWIKETMR-----------............................................
ENSBTAP00000027052  ....GVYTKVTY.YRNWIASKTG-----------............................................
ENSBTAP00000007806  ....GVYTRVSK.FLPWINTHT------------............................................
ENSBTAP00000054089  ....GVFARVSV.FLDWIQ---------------............................................
ENSBTAP00000020121  ....GVYTDVCR.YGHWIQRVIQ-----------............................................
ENSBTAP00000052855  ....GVYTQVSS.YLSWIETKT------------............................................
ENSBTAP00000050470  ....AVYTSVCH.YLDWIQETME-----------d...........................................
ENSBTAP00000002847  ....GVYSNVTY.FVKWIERQI------------............................................
ENSBTAP00000050126  ....DVYTRISS.FLSWIHSTMR-----------............................................
ENSBTAP00000011718  ....TVFTRVSA.YISWINNAI------------............................................
ENSBTAP00000046936  ....SIFTNVTY.FTNWIEEI-------------............................................
ENSBTAP00000023055  ....GVYTRVAN.YVDWINDRIR-----------pn..........................................
ENSBTAP00000027207  ....SVYTNLCK.FTDWIQKTIQ-----------............................................
ENSBTAP00000025122  ....GVYTDVAN.YLAWIREHT------------............................................
ENSBTAP00000017401  ....TVFTRVSA.FIDWIDETI------------a...........................................
ENSBTAP00000002912  ....GVYTKVCK.YVDWIQKTME-----------n...........................................
ENSBTAP00000017359  ....DVYTRISS.FLSWIHSTMR-----------............................................
ENSBTAP00000016545  ....GVYTKVSN.YVDWVWEQMG-----------............................................
ENSBTAP00000017363  ....DVYTRISS.FLSWIHSTMR-----------............................................
ENSBTAP00000017013  ....GVYTKVIN.YIPWIKSIIN-----------s...........................................
ENSBTAP00000005550  ....GVYTRITK.YSRWIKKQI------------s...........................................
ENSBTAP00000025732  ....GVYTQVTK.FLTWIKATME-----------k...........................................
ENSBTAP00000012471  ....GIFTKVSY.FNQWITE--------------k...........................................
ENSBTAP00000013262  ....RAFTKVSS.FLPWIKKTMK-----------............................................
ENSBTAP00000051933  ....AVYTSTSY.FTNWMRKQIG-----------............................................
ENSBTAP00000011362  ....GFYTNVLK.YVDWIKKVM------------............................................
ENSBTAP00000017607  ....AVFTRISS.FLPWIRRTMR-----------............................................
ENSBTAP00000006358  ....GIYTRVKN.YVDWIRKTMQ-----------............................................
ENSBTAP00000006807  ....GIYILLTRkFQAWIKSNL------------a...........................................
ENSBTAP00000055802  ....GIYTRLAS.YVAWIDGVM------------a...........................................
ENSBTAP00000014364  ....GVFTQVSH.FLPWIKRTMK-----------............................................
ENSBTAP00000045833  ....GVYTKVAN.YFDWISQHVG-----------r...........................................
ENSBTAP00000039032  ....DVYTQVSA.FVTWIRDVIR-----------............................................
ENSBTAP00000007060  ..spGIFSKVFV.LMDFITQTM------------............................................
ENSBTAP00000052108  ....AVFTRISS.FLPWIRRTMR-----------............................................
ENSBTAP00000054089  ..spGIFSKVFV.LMDFITQTM------------t...........................................
ENSBTAP00000031726  ....AVYTQICK.YRSWIEKTIR-----------s...........................................
ENSBTAP00000002709  ....PVAVAVAP.YMPWIKKVLR-----------h...........................................
ENSBTAP00000051578  ....GVYTKVTA.YLNWIYNV-------------r...........................................
ENSBTAP00000011737  ....AVFTRISP.YRPWIDEVLK-----------g...........................................
ENSBTAP00000046934  ....SIFTNITY.FTDWIEEI-------------............................................
ENSBTAP00000054275  ....DFFARVSL.YVDWINSVL------------s...........................................
ENSBTAP00000046937  ....SIFTNITY.FTDWIEEI-------------............................................
ENSBTAP00000021566  ....GFYTKVLD.YVDWIRGVM------------............................................
ENSBTAP00000054098  ....GFYTKVLD.YVDWIRGVM------------............................................
ENSBTAP00000047813  ....PIYIHISS.YQQWIWDRI------------s...........................................
ENSBTAP00000052086  ....AVFTRISP.YRPWIDEVLK-----------e...........................................
ENSBTAP00000055933  ....DSFASVAK.FANWINSIIR-----------r...........................................
ENSBTAP00000048088  ....GVFIQVSH.FLPWIKRTMK-----------............................................
ENSBTAP00000053944  ....DSFASVAK.FANWINSIIR-----------............................................
ENSBTAP00000051737  ....GVFIQVSH.FLPWIKRTMK-----------............................................
ENSBTAP00000029273  ....GVYTLLSKkHLNWIVKTMK-----------............................................
ENSBTAP00000042196  ....VLLTDMAA.HSSWLQ---------------a...........................................
ENSBTAP00000039959  ....GIYILLTKkHLNWIKKTI------------a...........................................
ENSBTAP00000009800  ....DFHINLYQ.VLPWLKEKLQ-----------n...........................................
ENSBTAP00000006095  ....GVFTNISF.YKSWIE---------------k...........................................
ENSBTAP00000023490  ....GIFVRVAY.YAKWIHKII------------............................................
ENSBTAP00000008335  ....GVYVKVTS.ILDWVRKTIA-----------n...........................................
ENSBTAP00000055870  ....GVYTKVCK.YVDWIQKTME-----------n...........................................
ENSBTAP00000030635  ....AIFMRVSV.FVDWIHKVMR-----------............................................
ENSBTAP00000052308  ....GVYTRVTA.YHDWITSKMSK----------aphqfc......................................
ENSBTAP00000011042  ....--------.---------------------tlkvtagisfaipsdkikkflte.....................
ENSBTAP00000026804  ....--------.---------------------mkvtsgisfaipsdrlreflhr......................
ENSBTAP00000004564  ....--------.---------------------dvigintlkvtagisfaipsdrirqflaefh.............
ENSBTAP00000055424  ....DFFARVAL.FRNWIDSVIN-----------............................................
ENSBTAP00000056087  ....DFFARVAL.FRNWIDSVIN-----------............................................
ENSBTAP00000046935  ....SIFTNVTN.WMDEIQRL-------------t...........................................
ENSBTAP00000016767  ....TAFTKVLP.FKDWIERNMK-----------............................................
ENSBTAP00000009798  kvprDFHINLFR.LQPWLRQHLE-----------g...........................................
ENSBTAP00000042196  ....AVFAALPT.YENWVS---------------s...........................................
ENSBTAP00000004732  ....GIYTRIIN.YIPWIENTIQ-----------n...........................................
ENSBTAP00000049751  ....--------.---------------------p...........................................
ENSBTAP00000022878  ....GYYTKVSR.YTDWIHRVI------------s...........................................
ENSBTAP00000049751  ....--------.---------------------............................................
ENSBTAP00000018804  ....FLYIRVED.YSDWITSKTRKT---------ssplssfh....................................
ENSBTAP00000041742  ....GFFTEISS.YSRWIMSII------------e...........................................
ENSBTAP00000054780  ....SIFTNVTN.WIDKIQRLI------------............................................
ENSBTAP00000039011  ....AVFTNIYS.HIPWIKSII------------s...........................................
ENSBTAP00000024541  ....GIYTNVQK.YVSWIESTTK-----------............................................
ENSBTAP00000042824  kvprDFHINLFR.LQPWLRQH-------------l...........................................
ENSBTAP00000051417  ....--------.---------------------vtaaglwsalrrtntfc...........................
ENSBTAP00000025894  ....LLLIKVPR.YALWLRQVTQ-----------............................................
ENSBTAP00000054781  ....--------.---------------------tlkvaagisfaipsdritrflsefqd..................
ENSBTAP00000053077  ....ELFAATGP.EEAWISQTV------------g...........................................
ENSBTAP00000053077  ....RVFYPLQT.HGPWISHVTR-----------g...........................................
ENSBTAP00000020194  ....NVAVRITP.---------------------lkyaqicywi..................................
ENSBTAP00000037916  ....--------.---------------------wkrkiiaiysghqwvdvhgvqkdynvavritpl...........
ENSBTAP00000047553  ....--------.---------------------hvnkayaliefg................................
ENSBTAP00000003767  ....--------.---------------------vnkayaliefgysmesilcdikq.....................
ENSBTAP00000053065  ....--------.---------------------............................................
ENSBTAP00000055732  ....--------.---------------------............................................
ENSBTAP00000047875  ....--------.---------------------easfptlagvtsqagtslhpgysalagvalrglpavlsmptvlg
ENSBTAP00000054539  ....--------.---------------------dgvpvp......................................
ENSBTAP00000047875  ....--------.---------------------pglvlchggiftpflragsgaltaastaflpgdscgddlrlhvq
ENSBTAP00000054539  ....--------.---------------------pglvlchggiftpflragsgaltaastaflpgdscgddlrlhvq
ENSBTAP00000055003  ....--------.---------------------agavilggvtrltesglsmvdwhlikemkpptskeewea.....
ENSBTAP00000003182  ....--------.---------------------raayrtqyihmhtqksfqevvpqpdvathntasyfgsgspvfds


                                                                                                    
                                                                                                    
d1fiw.1               ..............................................................................
ENSBTAP00000004737  ..............................................................................
ENSBTAP00000033392  ..............................................................................
ENSBTAP00000012503  ..............................................................................
ENSBTAP00000026272  ..............................................................................
ENSBTAP00000055274  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000010989  ..............................................................................
ENSBTAP00000027425  ..............................................................................
ENSBTAP00000042983  ..............................................................................
ENSBTAP00000028354  ..............................................................................
ENSBTAP00000027417  ..............................................................................
ENSBTAP00000037246  ..............................................................................
ENSBTAP00000023479  ..............................................................................
ENSBTAP00000037407  ..............................................................................
ENSBTAP00000002505  ..............................................................................
ENSBTAP00000054149  ..............................................................................
ENSBTAP00000000788  ..............................................................................
ENSBTAP00000050450  ..............................................................................
ENSBTAP00000050393  ..............................................................................
ENSBTAP00000028731  ..............................................................................
ENSBTAP00000009636  ..............................................................................
ENSBTAP00000009406  ..............................................................................
ENSBTAP00000004648  ..............................................................................
ENSBTAP00000013434  ..............................................................................
ENSBTAP00000001642  ..............................................................................
ENSBTAP00000050246  ..............................................................................
ENSBTAP00000004986  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000021967  ..............................................................................
ENSBTAP00000028678  ..............................................................................
ENSBTAP00000012036  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033941  ..............................................................................
ENSBTAP00000012346  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033942  ..............................................................................
ENSBTAP00000011204  ..............................................................................
ENSBTAP00000036577  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000001674  ..............................................................................
ENSBTAP00000024677  ..............................................................................
ENSBTAP00000016644  ..............................................................................
ENSBTAP00000015915  ..............................................................................
ENSBTAP00000048279  ..............................................................................
ENSBTAP00000036408  ..............................................................................
ENSBTAP00000054627  ..............................................................................
ENSBTAP00000005227  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000048972  ..............................................................................
ENSBTAP00000055314  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000024680  ..............................................................................
ENSBTAP00000051470  ..............................................................................
ENSBTAP00000055795  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000021789  ..............................................................................
ENSBTAP00000019098  ..............................................................................
ENSBTAP00000046176  ..............................................................................
ENSBTAP00000005163  ..............................................................................
ENSBTAP00000054336  ..............................................................................
ENSBTAP00000020053  ..............................................................................
ENSBTAP00000005785  ..............................................................................
ENSBTAP00000002923  ..............................................................................
ENSBTAP00000020025  ..............................................................................
ENSBTAP00000027772  ..............................................................................
ENSBTAP00000027594  ..............................................................................
ENSBTAP00000009746  ..............................................................................
ENSBTAP00000020127  ..............................................................................
ENSBTAP00000010816  ..............................................................................
ENSBTAP00000054342  ..............................................................................
ENSBTAP00000020123  ..............................................................................
ENSBTAP00000027052  ..............................................................................
ENSBTAP00000007806  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000020121  ..............................................................................
ENSBTAP00000052855  ..............................................................................
ENSBTAP00000050470  ..............................................................................
ENSBTAP00000002847  ..............................................................................
ENSBTAP00000050126  ..............................................................................
ENSBTAP00000011718  ..............................................................................
ENSBTAP00000046936  ..............................................................................
ENSBTAP00000023055  ..............................................................................
ENSBTAP00000027207  ..............................................................................
ENSBTAP00000025122  ..............................................................................
ENSBTAP00000017401  ..............................................................................
ENSBTAP00000002912  ..............................................................................
ENSBTAP00000017359  ..............................................................................
ENSBTAP00000016545  ..............................................................................
ENSBTAP00000017363  ..............................................................................
ENSBTAP00000017013  ..............................................................................
ENSBTAP00000005550  ..............................................................................
ENSBTAP00000025732  ..............................................................................
ENSBTAP00000012471  ..............................................................................
ENSBTAP00000013262  ..............................................................................
ENSBTAP00000051933  ..............................................................................
ENSBTAP00000011362  ..............................................................................
ENSBTAP00000017607  ..............................................................................
ENSBTAP00000006358  ..............................................................................
ENSBTAP00000006807  ..............................................................................
ENSBTAP00000055802  ..............................................................................
ENSBTAP00000014364  ..............................................................................
ENSBTAP00000045833  ..............................................................................
ENSBTAP00000039032  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000052108  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000031726  ..............................................................................
ENSBTAP00000002709  ..............................................................................
ENSBTAP00000051578  ..............................................................................
ENSBTAP00000011737  ..............................................................................
ENSBTAP00000046934  ..............................................................................
ENSBTAP00000054275  ..............................................................................
ENSBTAP00000046937  ..............................................................................
ENSBTAP00000021566  ..............................................................................
ENSBTAP00000054098  ..............................................................................
ENSBTAP00000047813  ..............................................................................
ENSBTAP00000052086  ..............................................................................
ENSBTAP00000055933  ..............................................................................
ENSBTAP00000048088  ..............................................................................
ENSBTAP00000053944  ..............................................................................
ENSBTAP00000051737  ..............................................................................
ENSBTAP00000029273  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000039959  ..............................................................................
ENSBTAP00000009800  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000023490  ..............................................................................
ENSBTAP00000008335  ..............................................................................
ENSBTAP00000055870  ..............................................................................
ENSBTAP00000030635  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000026804  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000055424  ..............................................................................
ENSBTAP00000056087  ..............................................................................
ENSBTAP00000046935  ..............................................................................
ENSBTAP00000016767  ..............................................................................
ENSBTAP00000009798  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000004732  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000022878  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000018804  ..............................................................................
ENSBTAP00000041742  ..............................................................................
ENSBTAP00000054780  ..............................................................................
ENSBTAP00000039011  ..............................................................................
ENSBTAP00000024541  ..............................................................................
ENSBTAP00000042824  ..............................................................................
ENSBTAP00000051417  ..............................................................................
ENSBTAP00000025894  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000020194  ..............................................................................
ENSBTAP00000037916  ..............................................................................
ENSBTAP00000047553  ..............................................................................
ENSBTAP00000003767  ..............................................................................
ENSBTAP00000053065  ..............................................................................
ENSBTAP00000055732  ..............................................................................
ENSBTAP00000047875  grswgpgesshggnrtgivasntrdnntgatyphlnfsipitvlqpalqqysqtg.......................
ENSBTAP00000054539  ..............................................................................
ENSBTAP00000047875  cgptaaspagraergrpglctpqcaglepgpparprgrplqpprpaelllllscpafrghfvrlfggeeaeqwrfana
ENSBTAP00000054539  cgptaaspagraergrpglctpqcaglepgpparprgrplqpprpaelllllscpafrghfvrlfggeeaeqwrfana
ENSBTAP00000055003  ..............................................................................
ENSBTAP00000003182  egswvtytagfaykypqgissitefs....................................................


                                                                                                    
                                                                                                    
d1fiw.1               ..............................................................................
ENSBTAP00000004737  ..............................................................................
ENSBTAP00000033392  ..............................................................................
ENSBTAP00000012503  ..............................................................................
ENSBTAP00000026272  ..............................................................................
ENSBTAP00000055274  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000010989  ..............................................................................
ENSBTAP00000027425  ..............................................................................
ENSBTAP00000042983  ..............................................................................
ENSBTAP00000028354  ..............................................................................
ENSBTAP00000027417  ..............................................................................
ENSBTAP00000037246  ..............................................................................
ENSBTAP00000023479  ..............................................................................
ENSBTAP00000037407  ..............................................................................
ENSBTAP00000002505  ..............................................................................
ENSBTAP00000054149  ..............................................................................
ENSBTAP00000000788  ..............................................................................
ENSBTAP00000050450  ..............................................................................
ENSBTAP00000050393  ..............................................................................
ENSBTAP00000028731  ..............................................................................
ENSBTAP00000009636  ..............................................................................
ENSBTAP00000009406  ..............................................................................
ENSBTAP00000004648  ..............................................................................
ENSBTAP00000013434  ..............................................................................
ENSBTAP00000001642  ..............................................................................
ENSBTAP00000050246  ..............................................................................
ENSBTAP00000004986  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000021967  ..............................................................................
ENSBTAP00000028678  ..............................................................................
ENSBTAP00000012036  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033941  ..............................................................................
ENSBTAP00000012346  ..............................................................................
ENSBTAP00000000958  ..............................................................................
ENSBTAP00000033942  ..............................................................................
ENSBTAP00000011204  ..............................................................................
ENSBTAP00000036577  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000001674  ..............................................................................
ENSBTAP00000024677  ..............................................................................
ENSBTAP00000016644  ..............................................................................
ENSBTAP00000015915  ..............................................................................
ENSBTAP00000048279  ..............................................................................
ENSBTAP00000036408  ..............................................................................
ENSBTAP00000054627  ..............................................................................
ENSBTAP00000005227  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000048972  ..............................................................................
ENSBTAP00000055314  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000024680  ..............................................................................
ENSBTAP00000051470  ..............................................................................
ENSBTAP00000055795  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000021789  ..............................................................................
ENSBTAP00000019098  ..............................................................................
ENSBTAP00000046176  ..............................................................................
ENSBTAP00000005163  ..............................................................................
ENSBTAP00000054336  ..............................................................................
ENSBTAP00000020053  ..............................................................................
ENSBTAP00000005785  ..............................................................................
ENSBTAP00000002923  ..............................................................................
ENSBTAP00000020025  ..............................................................................
ENSBTAP00000027772  ..............................................................................
ENSBTAP00000027594  ..............................................................................
ENSBTAP00000009746  ..............................................................................
ENSBTAP00000020127  ..............................................................................
ENSBTAP00000010816  ..............................................................................
ENSBTAP00000054342  ..............................................................................
ENSBTAP00000020123  ..............................................................................
ENSBTAP00000027052  ..............................................................................
ENSBTAP00000007806  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000020121  ..............................................................................
ENSBTAP00000052855  ..............................................................................
ENSBTAP00000050470  ..............................................................................
ENSBTAP00000002847  ..............................................................................
ENSBTAP00000050126  ..............................................................................
ENSBTAP00000011718  ..............................................................................
ENSBTAP00000046936  ..............................................................................
ENSBTAP00000023055  ..............................................................................
ENSBTAP00000027207  ..............................................................................
ENSBTAP00000025122  ..............................................................................
ENSBTAP00000017401  ..............................................................................
ENSBTAP00000002912  ..............................................................................
ENSBTAP00000017359  ..............................................................................
ENSBTAP00000016545  ..............................................................................
ENSBTAP00000017363  ..............................................................................
ENSBTAP00000017013  ..............................................................................
ENSBTAP00000005550  ..............................................................................
ENSBTAP00000025732  ..............................................................................
ENSBTAP00000012471  ..............................................................................
ENSBTAP00000013262  ..............................................................................
ENSBTAP00000051933  ..............................................................................
ENSBTAP00000011362  ..............................................................................
ENSBTAP00000017607  ..............................................................................
ENSBTAP00000006358  ..............................................................................
ENSBTAP00000006807  ..............................................................................
ENSBTAP00000055802  ..............................................................................
ENSBTAP00000014364  ..............................................................................
ENSBTAP00000045833  ..............................................................................
ENSBTAP00000039032  ..............................................................................
ENSBTAP00000007060  ..............................................................................
ENSBTAP00000052108  ..............................................................................
ENSBTAP00000054089  ..............................................................................
ENSBTAP00000031726  ..............................................................................
ENSBTAP00000002709  ..............................................................................
ENSBTAP00000051578  ..............................................................................
ENSBTAP00000011737  ..............................................................................
ENSBTAP00000046934  ..............................................................................
ENSBTAP00000054275  ..............................................................................
ENSBTAP00000046937  ..............................................................................
ENSBTAP00000021566  ..............................................................................
ENSBTAP00000054098  ..............................................................................
ENSBTAP00000047813  ..............................................................................
ENSBTAP00000052086  ..............................................................................
ENSBTAP00000055933  ..............................................................................
ENSBTAP00000048088  ..............................................................................
ENSBTAP00000053944  ..............................................................................
ENSBTAP00000051737  ..............................................................................
ENSBTAP00000029273  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000039959  ..............................................................................
ENSBTAP00000009800  ..............................................................................
ENSBTAP00000006095  ..............................................................................
ENSBTAP00000023490  ..............................................................................
ENSBTAP00000008335  ..............................................................................
ENSBTAP00000055870  ..............................................................................
ENSBTAP00000030635  ..............................................................................
ENSBTAP00000052308  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000026804  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000055424  ..............................................................................
ENSBTAP00000056087  ..............................................................................
ENSBTAP00000046935  ..............................................................................
ENSBTAP00000016767  ..............................................................................
ENSBTAP00000009798  ..............................................................................
ENSBTAP00000042196  ..............................................................................
ENSBTAP00000004732  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000022878  ..............................................................................
ENSBTAP00000049751  ..............................................................................
ENSBTAP00000018804  ..............................................................................
ENSBTAP00000041742  ..............................................................................
ENSBTAP00000054780  ..............................................................................
ENSBTAP00000039011  ..............................................................................
ENSBTAP00000024541  ..............................................................................
ENSBTAP00000042824  ..............................................................................
ENSBTAP00000051417  ..............................................................................
ENSBTAP00000025894  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000053077  ..............................................................................
ENSBTAP00000020194  ..............................................................................
ENSBTAP00000037916  ..............................................................................
ENSBTAP00000047553  ..............................................................................
ENSBTAP00000003767  ..............................................................................
ENSBTAP00000053065  ..............................................................................
ENSBTAP00000055732  ..............................................................................
ENSBTAP00000047875  ..............................................................................
ENSBTAP00000054539  ..............................................................................
ENSBTAP00000047875  apddevseeeeedqlralgwfallrvrpemekeaeergpvlavaplgdvpkgapllacgspfgafcpdiflntlsrgv
ENSBTAP00000054539  apddevseeeeedqlralgwfallrvrpemekeaeergpvlavaplgdvpkgapllacgspfgafcpdiflntlsrgv
ENSBTAP00000055003  ..............................................................................
ENSBTAP00000003182  ..............................................................................


                                                                   
                                                                   
d1fiw.1               .............................................
ENSBTAP00000004737  .............................................
ENSBTAP00000033392  .............................................
ENSBTAP00000012503  .............................................
ENSBTAP00000026272  .............................................
ENSBTAP00000055274  .............................................
ENSBTAP00000000958  .............................................
ENSBTAP00000010989  .............................................
ENSBTAP00000027425  .............................................
ENSBTAP00000042983  .............................................
ENSBTAP00000028354  .............................................
ENSBTAP00000027417  .............................................
ENSBTAP00000037246  .............................................
ENSBTAP00000023479  .............................................
ENSBTAP00000037407  .............................................
ENSBTAP00000002505  .............................................
ENSBTAP00000054149  .............................................
ENSBTAP00000000788  .............................................
ENSBTAP00000050450  .............................................
ENSBTAP00000050393  .............................................
ENSBTAP00000028731  .............................................
ENSBTAP00000009636  .............................................
ENSBTAP00000009406  .............................................
ENSBTAP00000004648  .............................................
ENSBTAP00000013434  .............................................
ENSBTAP00000001642  .............................................
ENSBTAP00000050246  .............................................
ENSBTAP00000004986  .............................................
ENSBTAP00000053077  .............................................
ENSBTAP00000021967  .............................................
ENSBTAP00000028678  .............................................
ENSBTAP00000012036  .............................................
ENSBTAP00000000958  .............................................
ENSBTAP00000033941  .............................................
ENSBTAP00000012346  .............................................
ENSBTAP00000000958  .............................................
ENSBTAP00000033942  .............................................
ENSBTAP00000011204  .............................................
ENSBTAP00000036577  .............................................
ENSBTAP00000052308  .............................................
ENSBTAP00000001674  .............................................
ENSBTAP00000024677  .............................................
ENSBTAP00000016644  .............................................
ENSBTAP00000015915  .............................................
ENSBTAP00000048279  .............................................
ENSBTAP00000036408  .............................................
ENSBTAP00000054627  .............................................
ENSBTAP00000005227  .............................................
ENSBTAP00000049751  .............................................
ENSBTAP00000048972  .............................................
ENSBTAP00000055314  .............................................
ENSBTAP00000006095  .............................................
ENSBTAP00000007060  .............................................
ENSBTAP00000024680  .............................................
ENSBTAP00000051470  .............................................
ENSBTAP00000055795  .............................................
ENSBTAP00000052308  .............................................
ENSBTAP00000021789  .............................................
ENSBTAP00000019098  .............................................
ENSBTAP00000046176  .............................................
ENSBTAP00000005163  .............................................
ENSBTAP00000054336  .............................................
ENSBTAP00000020053  .............................................
ENSBTAP00000005785  .............................................
ENSBTAP00000002923  .............................................
ENSBTAP00000020025  .............................................
ENSBTAP00000027772  .............................................
ENSBTAP00000027594  .............................................
ENSBTAP00000009746  .............................................
ENSBTAP00000020127  .............................................
ENSBTAP00000010816  .............................................
ENSBTAP00000054342  .............................................
ENSBTAP00000020123  .............................................
ENSBTAP00000027052  .............................................
ENSBTAP00000007806  .............................................
ENSBTAP00000054089  .............................................
ENSBTAP00000020121  .............................................
ENSBTAP00000052855  .............................................
ENSBTAP00000050470  .............................................
ENSBTAP00000002847  .............................................
ENSBTAP00000050126  .............................................
ENSBTAP00000011718  .............................................
ENSBTAP00000046936  .............................................
ENSBTAP00000023055  .............................................
ENSBTAP00000027207  .............................................
ENSBTAP00000025122  .............................................
ENSBTAP00000017401  .............................................
ENSBTAP00000002912  .............................................
ENSBTAP00000017359  .............................................
ENSBTAP00000016545  .............................................
ENSBTAP00000017363  .............................................
ENSBTAP00000017013  .............................................
ENSBTAP00000005550  .............................................
ENSBTAP00000025732  .............................................
ENSBTAP00000012471  .............................................
ENSBTAP00000013262  .............................................
ENSBTAP00000051933  .............................................
ENSBTAP00000011362  .............................................
ENSBTAP00000017607  .............................................
ENSBTAP00000006358  .............................................
ENSBTAP00000006807  .............................................
ENSBTAP00000055802  .............................................
ENSBTAP00000014364  .............................................
ENSBTAP00000045833  .............................................
ENSBTAP00000039032  .............................................
ENSBTAP00000007060  .............................................
ENSBTAP00000052108  .............................................
ENSBTAP00000054089  .............................................
ENSBTAP00000031726  .............................................
ENSBTAP00000002709  .............................................
ENSBTAP00000051578  .............................................
ENSBTAP00000011737  .............................................
ENSBTAP00000046934  .............................................
ENSBTAP00000054275  .............................................
ENSBTAP00000046937  .............................................
ENSBTAP00000021566  .............................................
ENSBTAP00000054098  .............................................
ENSBTAP00000047813  .............................................
ENSBTAP00000052086  .............................................
ENSBTAP00000055933  .............................................
ENSBTAP00000048088  .............................................
ENSBTAP00000053944  .............................................
ENSBTAP00000051737  .............................................
ENSBTAP00000029273  .............................................
ENSBTAP00000042196  .............................................
ENSBTAP00000039959  .............................................
ENSBTAP00000009800  .............................................
ENSBTAP00000006095  .............................................
ENSBTAP00000023490  .............................................
ENSBTAP00000008335  .............................................
ENSBTAP00000055870  .............................................
ENSBTAP00000030635  .............................................
ENSBTAP00000052308  .............................................
ENSBTAP00000011042  .............................................
ENSBTAP00000026804  .............................................
ENSBTAP00000004564  .............................................
ENSBTAP00000055424  .............................................
ENSBTAP00000056087  .............................................
ENSBTAP00000046935  .............................................
ENSBTAP00000016767  .............................................
ENSBTAP00000009798  .............................................
ENSBTAP00000042196  .............................................
ENSBTAP00000004732  .............................................
ENSBTAP00000049751  .............................................
ENSBTAP00000022878  .............................................
ENSBTAP00000049751  .............................................
ENSBTAP00000018804  .............................................
ENSBTAP00000041742  .............................................
ENSBTAP00000054780  .............................................
ENSBTAP00000039011  .............................................
ENSBTAP00000024541  .............................................
ENSBTAP00000042824  .............................................
ENSBTAP00000051417  .............................................
ENSBTAP00000025894  .............................................
ENSBTAP00000054781  .............................................
ENSBTAP00000053077  .............................................
ENSBTAP00000053077  .............................................
ENSBTAP00000020194  .............................................
ENSBTAP00000037916  .............................................
ENSBTAP00000047553  .............................................
ENSBTAP00000003767  .............................................
ENSBTAP00000053065  .............................................
ENSBTAP00000055732  .............................................
ENSBTAP00000047875  .............................................
ENSBTAP00000054539  .............................................
ENSBTAP00000047875  lsnsagpllltdarclpgtegggvfasrpagalvalvaaplcwka
ENSBTAP00000054539  lsnsagpllltdarclpgtegggvfasrpagalvalvaaplcwka
ENSBTAP00000055003  .............................................
ENSBTAP00000003182  .............................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0037607 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Elusimicrobium minutum Pei191
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Neorickettsia sennetsu str. Miyayama
NoYes   Neorickettsia risticii str. Illinois
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Ehrlichia chaffeensis str. Arkansas
NoYes   Ehrlichia canis str. Jake
NoYes   Ehrlichia ruminantium str. Gardel
NoYes   Anaplasma phagocytophilum HZ
NoYes   Anaplasma marginale str. Florida
NoYes   Anaplasma centrale str. Israel
NoYes   Orientia tsutsugamushi str. Boryong
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Candidatus Riesia pediculicola USDA
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Candidatus Blochmannia floridanus
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Francisella sp. TX077308
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
No