SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

PH domain-like alignments

These alignments are sequences aligned to the 0036336 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1dbha2                a............................................................................
Mpf_ENSMPUP00000000236 atgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtry
Mpf_ENSMPUP00000001054 efgavfdqliaeqtgekkevadlsmgdlllhttviwpnppas...................................
Mpf_ENSMPUP00000001986 dygtvfdqlvaeqsgtekevtelsmgellmhsavswlnpflslgkark.............................
Mpf_ENSMPUP00000006133 qlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtqvtreaislvcdavpgakg
Mpf_ENSMPUP00000009494 edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevdlfis.......
Mpf_ENSMPUP00000004093 nhdpqfepivslpeqeiktleedeeelfk................................................
Mpf_ENSMPUP00000012215 pdacplpgpgeptpgsrqdrhflqhllgmgmnyyvrymgcievlqsmrsldfgmrtqvtreaisrlceavsgangai
Mpf_ENSMPUP00000016175 egeyesvlcvkpevhvyrippratnrgyraaewqldqpswsgrlritakgqvayikledrtsgelfaqapvdqfpgt
Mpf_ENSMPUP00000009909 fadadewirkgsfihkpahgwlhpdarvlgpgvsyivrymgcieilrsmrsldfntrtqvtreainrlheavpgirg
Mpf_ENSMPUP00000010977 edlidgiifaanylgstqllsernpsknirmmqaqeavsrvknsegdaqtltev.......................
Mpf_ENSMPUP00000016638 eleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikledkvsgelfaqapveqypgi
Mpf_ENSMPUP00000018612 nhdpqfepiaslpeqeiktleddeeelfkmrak............................................
Mpf_ENSMPUP00000018966 nhdpqfepiaslpeqeiktleddeeelfkmrak............................................
Mpf_ENSMPUP00000004660 peeirnlladvetfvadtlrgenlskkakekreslikkikdvksiylqdfqdkgdtedgeeyddpfagppdtvslas
Mpf_ENSMPUP00000002149 v............................................................................
Mpf_ENSMPUP00000018066 nsatellkqgaacnvwylnsvemesltghqaiqkalsltlvqeppplctvvhfkvsaqgit................
Mpf_ENSMPUP00000017958 islaalqrhdpyinrivdvasqvalytfghranewektdvegtlfvytrsaspkhgfiimnrlsmen..........
Mpf_ENSMPUP00000011450 disqyrvehlttfvldrkdamitvddgirklklldakgkvwtqdmilqvddravslidlesknelenfplstiqhcq
Mpf_ENSMPUP00000016402 nsttdllkqgaacnvlfvnsvdmesltgpqaiskatsetlaadptpaativhfkvsaqgitltd.............
Mpf_ENSMPUP00000004951 mgeqpifstrahvfqidpntk........................................................
Mpf_ENSMPUP00000011363 dwgepsitlrppneatastpvqywqhhpeklifqscdykafylgsmlikelrgtestqdacakmrancqksteqmkk
Mpf_ENSMPUP00000015445 eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinstitpnmtftktsqkfgqwad
Mpf_ENSMPUP00000015195 peeirwlmedaeeflgeglrnenlsatardhrdhilrgfqqvktryywdsqpqggdqaesylgqdssddnqsgthgp
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 edlldgvifgakylgstqlvsernpppstrmaqareamdrvkapdgetqpmtevdl.....................
Mpf_ENSMPUP00000005349 ti...........................................................................
Mpf_ENSMPUP00000006137 taadllrqgaacsvlyltsvetesltgpqavarassaalscspratpaivh..........................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 msetvicsswatvmlyddsnkrwlpagtgpqafsrvqiyhnptansfrvvgwkmqpeqqvvi...............
Mpf_ENSMPUP00000014567 dsrasclkksagchalyltsvsvetlsgalavrkaisttferdvlptptvvhfkvtdqgitltdvqr..........
Mpf_ENSMPUP00000015198 lrahpffesitwenlqhqtppkltaylpamseddedcygnydnllsqfgcmqvsssssshslstadaglphtagsni
Mpf_ENSMPUP00000008441 mrsldfstrtqitreaisrvceavpgakgafrkrkppskmlssilgktnlqfagmsisltvstaslnlrtpdskqii
Mpf_ENSMPUP00000005146 emyginyfeiknkkgtdlwlgvdalglni................................................
Mpf_ENSMPUP00000010667 fepvvplpdlvevssgeeneqvvfshraklyrydkdvgqwkergigdikilqnydnk....................
Mpf_ENSMPUP00000000642 i............................................................................
Mpf_ENSMPUP00000015373 reqpifstrahvfqidpatkrnwipagkhaltvsyfydat.....................................
Mpf_ENSMPUP00000003213 eqreakltlrppslaapyapvqswqhqpeklifescgyeanylgsmlikdlrgtestqdacakmrkstehmkkipti
Mpf_ENSMPUP00000012196 fnslftreflhgmeillqheikylrkflgsteveqpkgtevvrdavrklkfarhikksegqkipkvelqisiygvki
Mpf_ENSMPUP00000012194 eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvisrve...............
Mpf_ENSMPUP00000003212 eqreakltlrppslaapyapvqswqhqpeklifescgyeanylgsmlikdlrgtestqdacakmrkstehmkkipti
Mpf_ENSMPUP00000001158 emygvnyfsiknkkgselwlgvdalglniyeq.............................................
Mpf_ENSMPUP00000010667 nedihfepivslpevevksgeedeeilfkeraklyrwdrevsqwkergigdikilwhtmknyy..............
Mpf_ENSMPUP00000013386 l............................................................................
Mpf_ENSMPUP00000016712 mslaalkqhdpyitsiadltgqvalytfcpkanqwektdiegtlfvyrrsaspyhgftivnrlnmhnlvepv.....
Mpf_ENSMPUP00000003302 emygvnyfeiknkkgtelwlgvdalglniye..............................................
Mpf_ENSMPUP00000003768 lrqsfrrkkdvyvpeasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktg
Mpf_ENSMPUP00000008012 dvsqylvnhlvtfclgeedgvhtvedasrklavmdsqgriwaqemllrvspdhvtlldpiskeelelyp........
Mpf_ENSMPUP00000002625 s............................................................................
Mpf_ENSMPUP00000010667 hfepvvqmpekvelvtgeedekvlysqrvklfrfdaeisqwkerglgnlkilk........................
Mpf_ENSMPUP00000006140 lqvdfptpktelvqkfhvqylgmlpvdkpvgmdtlnnaienlmtssnkedwpsvnmnv...................
Mpf_ENSMPUP00000015670 klpenwtdtretllegmlfslkylgmtlveqpkgeelsaaavkrivatakasgkklqkvtlkvsp............
Mpf_ENSMPUP00000008341 pkvkaylsqgerfikwddettiaspvilrvdpkgyylywtyqskemeflditnirdtrfgkfak.............
Mpf_ENSMPUP00000017573 peasrphqwqadedavrkgtcsfpvrylghveveesrgmhvcedavkklkamgrksvksvlwvsadglrvvddktkd
Mpf_ENSMPUP00000012859 tvvetlrrgskfikwdeeassrnlvtlrvdsngfflywtgpnmevdtldissirdtrtgryarlpkdpkirevlgfg
Mpf_ENSMPUP00000012131 h............................................................................
Mpf_ENSMPUP00000000172 emygirfhtasdregarinlavshmgvlvfqgttkintfnwsrvrklsfkrkrfliklhpevrgpy...........
Mpf_ENSMPUP00000013200 emygvnyfairnkkgtelllgvdalg...................................................
Mpf_ENSMPUP00000003522 lerasnplaaefks...............................................................
Mpf_ENSMPUP00000011499 emygirlhpakdregtkinlavantgilvfqgftkinafnwakvrklsfkrkrfliklrpdanssyqdtleflmas.
Mpf_ENSMPUP00000011494 vprlpgetritdkeviyicpfngpikgrvyitnyrlylrsletdsalildvplgvisriekmggatsrgensygld.
Mpf_ENSMPUP00000012716 dafkiwvifnflsedkypliivpeeieyllkklteamgggwqqeqfehykinfddskdglsvwelieligngqfskg
Mpf_ENSMPUP00000002913 geqsicqarasvmvyddtskkwvpikpgqqgfsriniyhntasntfrvvgvklqdqq....................
Mpf_ENSMPUP00000003504 hfrddddgpvssqgympylnkyildkveegafvkehfdelcwtltakknyrvdsngnsmlsnedafrlwclfnflse
Mpf_ENSMPUP00000004361 seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi..................
Mpf_ENSMPUP00000017389 dkdtvpdnhrnkfkvinvdddgnelgsgime..............................................
Mpf_ENSMPUP00000015829 rlrlsrtlaakvelvdiqr..........................................................
Mpf_ENSMPUP00000003644 clqhrvehlmtcklgthkvqdprdalrklqemdaqgrvwsqdlllqvrdgwl.........................
Mpf_ENSMPUP00000006376 evpsflqegavfdryeeesfvfepnclfkvdefgffltwrsegkegqvlecslinsirlgatpkdpkilaaleavgk
Mpf_ENSMPUP00000014536 mygvdlhhakdsegvdiklgvcanglliykdrlrinrfawpk...................................
Mpf_ENSMPUP00000011501 etplfpgesikatvkdvmyicpfmgavsgtltvtdfkmyfknverdpnfvldvplgvisrvekigaqshgd......
Mpf_ENSMPUP00000017670 mygvdlhhakdsegidimlgvcanglliyrdrlrinrfawpkilkisykrsnfyikirpge................
Mpf_ENSMPUP00000006727 lftflgkkcvtmssavvqlyaadrncmwskkcsgvaclvkdnpqrsyflrifd........................
Mpf_ENSMPUP00000000961 elygvefhyardqsnneimigvmsggiliyknrvrmnifpwlkivkisfkckq........................
Mpf_ENSMPUP00000004942 mygvdlhhakdsegveimlgvcasgl...................................................
Mpf_ENSMPUP00000002151 dmygirphpasdgegtqihlava......................................................
Mpf_ENSMPUP00000014680 ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqriwvn.............
Mpf_ENSMPUP00000005563 klseypnveelr.................................................................
Mpf_ENSMPUP00000011333 ineasnynmtsdyaahpmspigrtsraskkvhnfgkrsnsikr..................................
Mpf_ENSMPUP00000000969 emygvdmhvvkardgndyslgltptgvlvfegetkiglffwpkitrldfkknkl.......................
Mpf_ENSMPUP00000010395 a............................................................................
Mpf_ENSMPUP00000015361 mygvdlhkakdlegvdiilgvcssgll..................................................
Mpf_ENSMPUP00000001991 etygvdphpckdstgtttflgftaagfvvfqgnkrihlikwpdvcklkfegktfyvigiqkekkamlafhtstpaac
Mpf_ENSMPUP00000005637 edywyeaynmrtgargvfpayyaievtkepehmaaltknsdwvdqfrvkflgsvqvpyhkgndvlcaamqkiattrr
Mpf_ENSMPUP00000007307 emygvdmhvvrgrdgceyslgltptgilifegankiglffwpkitkmdfkks.........................
Mpf_ENSMPUP00000008193 yarvravvmtrddssggwlplggsglscvtvfkvphqeengcadffirgerlrdkmvvlecmlkkdli.........
Mpf_ENSMPUP00000007177 shlrqssdpmlsefk..............................................................
Mpf_ENSMPUP00000010360 t............................................................................
Mpf_ENSMPUP00000010611 rtqetpsa.....................................................................
Mpf_ENSMPUP00000007161 evllevkfirevtpyikkpslvsdlpwegaspqspsfsgsedsgspkhqnntkd.......................
Mpf_ENSMPUP00000006134 yivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgflihgerq........................
Mpf_ENSMPUP00000004983 a............................................................................
Mpf_ENSMPUP00000001920 dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladfnqvqtiqysnsed.....................
Mpf_ENSMPUP00000013542 lfemlgrkcwtlatavvqlylalppgaehwtkehcgavcfvkdnpqksyf...........................
Mpf_ENSMPUP00000008337 dlkssskfkngltfrkedml.........................................................
Mpf_ENSMPUP00000013626 matsseevllivk................................................................
Mpf_ENSMPUP00000001949 rkktqgfftmsrrrisckdl.........................................................
Mpf_ENSMPUP00000017721 evvlevkymkevspyfknsasgtsvgwdsppasplqrqpsspgppprdlsdakrvslkmayvsrr............
Mpf_ENSMPUP00000001109 evllevkymreatpyvkkgspvseigwetpppesprlgagasdalsaaqpcsfhrdr....................
Mpf_ENSMPUP00000001935 eddfwfrgfnmrtgergvfpafyahavpgpakdllgskrspcwverfdvqflgsvevpchqgngilcaamqkiatar
Mpf_ENSMPUP00000006252 kcllekvevitgeeaesnvlqiqcklfvfdktsqswvergrgllrlndmasaddgtlqsrlvmrtqgslrlilntkl
Mpf_ENSMPUP00000005676 egtlpfpaqslspeplpqeeeklpprnanpgikcfavrslgwvemteeelapgrssvavnncirqlsyhknnlhdpm
Mpf_ENSMPUP00000005196 l............................................................................
Mpf_ENSMPUP00000012589 emygvdlhpvygenk..............................................................
Mpf_ENSMPUP00000010571 etygvdphpckdvsgnaaflaftpfgfvvlqgnkrvhfikwnevtklkfegktf.......................
Mpf_ENSMPUP00000011589 hnmvsevpperpsvratrtsrkaiafgkrshsmkrnl........................................
Mpf_ENSMPUP00000005676 fqvefpapknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqteavlge.
Mpf_ENSMPUP00000002533 i............................................................................
Mpf_ENSMPUP00000004215 aprkefvvtmrpteasercrlrgsytlragetalelwgghelgsklyewpyrflrrfgr..................
Mpf_ENSMPUP00000013399 hqvtnvddegvelgsgvmeltqselvlhlqrreavrwpylclrrygyds............................
Mpf_ENSMPUP00000010530 rkel.........................................................................
Mpf_ENSMPUP00000006089 d............................................................................
Mpf_ENSMPUP00000016498 vqreqnerfnvylmptpnldiygectmqitheniylwdihnakvklvmwplsslrrygrdstwft............
Mpf_ENSMPUP00000007327 dfygvelhsgrdlhnlelmigiasagiavyrkyictsfypwvnilkisfkrkkffihqrqkqtesreh.........
Mpf_ENSMPUP00000001749 g............................................................................
Mpf_ENSMPUP00000016475 np...........................................................................
Mpf_ENSMPUP00000013206 rnqrpssmvsetstagttstveakpgpkimkssnkvhsfgkrdqairrnpnvp........................
Mpf_ENSMPUP00000006140 yaslklrhaphaeeddscsinsdpeakcfavrslgwvemaeedlapgkssvavnncirqlsyckndir.........
Mpf_ENSMPUP00000005780 ienktytklknghvfrkq...........................................................
Mpf_ENSMPUP00000001869 rkql.........................................................................
Mpf_ENSMPUP00000012475 pd...........................................................................
Mpf_ENSMPUP00000008316 dgygeesypakdsqgsdicigaclegifvkhkngrppvvfrwhdi................................
Mpf_ENSMPUP00000001167 fkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaa..................................
Mpf_ENSMPUP00000008230 sqfwvtvqrteaaercglqgsyvlrveaerltlltmgtqsqilepllfwpytllrryg...................
Mpf_ENSMPUP00000017717 mvqvravvmarddssggwlpvgggglsqvsvcrvrgarpeggarqghyvihgerlrdqkttle..............
Mpf_ENSMPUP00000010272 d............................................................................
Mpf_ENSMPUP00000003964 pd...........................................................................
Mpf_ENSMPUP00000017478 l............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 lekkpqvaykteiiggvvvhtpinqnggdgqegsepgshailrrsqsyipttgsrvps...................
Mpf_ENSMPUP00000002870 vsyrtdivggvpiitptqkeevnecgesidrnnlkrsqshlpyfapkppp...........................
Mpf_ENSMPUP00000000151 t............................................................................
Mpf_ENSMPUP00000000216 airkme.......................................................................
Mpf_ENSMPUP00000007012 l............................................................................
Mpf_ENSMPUP00000012096 l............................................................................
Mpf_ENSMPUP00000004281 de...........................................................................
Mpf_ENSMPUP00000004460 vqceqtdrfnvfllpcpnldvygecklqitheniylwdihnprvklvswplcs........................
Mpf_ENSMPUP00000011499 nkspdeatvadqeseddlsasrtslerqapprgnttvhvcwhrntsvsmvdfsvavenql.................
Mpf_ENSMPUP00000003498 lslassastisslgslstkkppravskvhafgkrgnalrrdpnlpv...............................
Mpf_ENSMPUP00000006723 qrdhgy.......................................................................
Mpf_ENSMPUP00000006149 ereqserfnvylmpspnldvhgecalqityehiclwdvqnprvkliswplsalrrygrdaaw...............
Mpf_ENSMPUP00000011052 dg...........................................................................
Mpf_ENSMPUP00000015653 typagvaetqeapeqpdtspvsgrkkskgvatrlsrrrvscre..................................
Mpf_ENSMPUP00000014937 pkcllekidvvtgeeaehnvlkincklfifnkttqswtergrgalrlndtassdcgtfqsrlimrnqgslrlilns.
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 v............................................................................
Mpf_ENSMPUP00000017142 lrrhhchacgkivcrncsrnkyplkylkdrmakvcdgcygelkkrggdvpgllrerpvsmsfplssprfsssafssv
Mpf_ENSMPUP00000011052 eg...........................................................................
Mpf_ENSMPUP00000000930 ptygvhyyavkdkqgipwwlglsykgifqydyhdkvkprkifqwrqlenlyfrekkfsvevhdprrasvt.......
Mpf_ENSMPUP00000016865 ptygvhyyavkdkqglpwwlgisykgigqydlqdkvkprklfqwkqlenlyfrekkfavevhdprrisvsrrtfgqs
Mpf_ENSMPUP00000000090 l............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 lg...........................................................................
Mpf_ENSMPUP00000000172 lpgsvvcmppsrcmeevspeqesedarssrgslegqgqpranttvrvcwyrntsvsradhsaavenq..........
Mpf_ENSMPUP00000013402 dgfgqeifsvkdnhgnsvhlgiffmgifvrnrigrqaviyrwndignithnkstilvelinkee.............
Mpf_ENSMPUP00000012726 gvgrgggaagptsggggqp..........................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 cpsefddtfakkfevlfcgrvtvahkkappalideciekfkhvsgrrraefdvgsprsesprpaagpslpervppgp
Mpf_ENSMPUP00000011911 ensiysswqeagefpvvvqrteaatrcqlkgpyllvlgqdtiqlreasspqalyt......................
Mpf_ENSMPUP00000013895 hvqcdglae....................................................................
Mpf_ENSMPUP00000009754 ppspppsppeippkplrlppefddsdydevpeegpgapaglmtkkeelpvshipravrvasllsegeelsedddqgd
Mpf_ENSMPUP00000017452 dsksimrmksgqmfakedlkr........................................................
Mpf_ENSMPUP00000004281 gt...........................................................................
Mpf_ENSMPUP00000017577 papppp.......................................................................
Mpf_ENSMPUP00000004977 raqapvpgkgpfgreel............................................................
Mpf_ENSMPUP00000017884 kfdagtlllsthrliwr............................................................
Mpf_ENSMPUP00000007027 tvpvytalkgratqistvpfvdessgsdddccsqasfrtsvpcsesrktsglgspraikrgvsmsslssegdyaipp
Mpf_ENSMPUP00000012725 eklehklnqtpekwqqlwekvtvdlkeepradrlqrhpsgspgivstnltscqkrsllhlpdssmgqehsasispsn
Mpf_ENSMPUP00000000871 dqetyrceliqgwnitvdlvigpkgirqltsqdakptclaefkqirsir............................
Mpf_ENSMPUP00000006220 gv...........................................................................
Mpf_ENSMPUP00000008418 prqvelldavsqaaqkyealymgtlpvnkamgmdvlneaigtlttrg..............................
Mpf_ENSMPUP00000003932 ykdvwqvivkprglghrkelsgvfrlcltdeevvfvrlntevasvvv..............................
Mpf_ENSMPUP00000001861 pvvlstpaqliapvvvakgtlsittteiyfevdeddpafkkidtkvlayteglhgk.....................
Mpf_ENSMPUP00000008418 smepgakcfavhslgwvevpeedlvpgkssiavnnciqqlaqtrsrsrsqppdgawgegq.................
Mpf_ENSMPUP00000006249 pnple........................................................................
Mpf_ENSMPUP00000003836 ntp..........................................................................
Mpf_ENSMPUP00000015858 p............................................................................
Mpf_ENSMPUP00000002835 qddedlqal....................................................................
Mpf_ENSMPUP00000004473 airkmek......................................................................
Mpf_ENSMPUP00000000137 fqqsslqhkskkknkgpiagkskrrisckdl..............................................
Mpf_ENSMPUP00000001907 eg...........................................................................
Mpf_ENSMPUP00000014024 n............................................................................
Mpf_ENSMPUP00000001742 kt...........................................................................
Mpf_ENSMPUP00000000172 e............................................................................
Mpf_ENSMPUP00000005480 vvt..........................................................................
Mpf_ENSMPUP00000018515 ntr..........................................................................
Mpf_ENSMPUP00000009502 pslg.........................................................................
Mpf_ENSMPUP00000013672 malnknhsegggvivnntesilmsydhveltfndmknvpeafk..................................
Mpf_ENSMPUP00000011336 irkmer.......................................................................
Mpf_ENSMPUP00000001410 sdcinsmvegse.................................................................
Mpf_ENSMPUP00000003424 gpels........................................................................
Mpf_ENSMPUP00000007040 vslstpaqlvapsvvvkgtlsvtsselyfevdeedshfkkid...................................
Mpf_ENSMPUP00000019493 g............................................................................
Mpf_ENSMPUP00000018830 qria.........................................................................
Mpf_ENSMPUP00000003141 dnedafynsqkfevlycgkvtvthkkapssliddciekfslheqqrlkiqgeqrgadagddpgvfeatapcpaadil
Mpf_ENSMPUP00000010983 qe...........................................................................
Mpf_ENSMPUP00000010498 triryalgevhrfhvavapgtklesgpa.................................................
Mpf_ENSMPUP00000012786 vyk..........................................................................
Mpf_ENSMPUP00000014114 vdap.........................................................................
Mpf_ENSMPUP00000007256 klkgvvagarskgehkqkifltisfggikifdektgalqhhhavheisyia..........................
Mpf_ENSMPUP00000005608 affpspspgplprvlgassgaaqgagagllidcrasmsdnqswnssgseedpe........................
Mpf_ENSMPUP00000002033 hhrrslgvylqegpvgstlslsldsdqssgstasssrqaarrststlysqfqtaesen...................
Mpf_ENSMPUP00000016751 npfgesgggtksetedsilhqlfivrflgsmevksddnpdvvyetmrqilaaraihnifrmteshllv.........
Mpf_ENSMPUP00000016435 sedlllmqk....................................................................
Mpf_ENSMPUP00000001167 d............................................................................
Mpf_ENSMPUP00000001585 erlkitalp....................................................................
Mpf_ENSMPUP00000002351 d............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 enygiewhsvrdsegqklligvgpegisickddfcpinriaypvvqmatqsgknvyltvtkesg.............
Mpf_ENSMPUP00000015986 hrprcitkfaqyvgsfpvddldtqesvwlvqqqlwalkdcprrravilkfslqglkiysge................
Mpf_ENSMPUP00000004747 prpsspsglpeedsvlfnkltylgcmkvssprnevealramatmksssqhpfpvtlyvpnvpegsvriidqsnnvel
Mpf_ENSMPUP00000009754 etqallgcgagvncfsgdpeaptplalaeqagqilqmeflrnnrttevprldsvkplekhysvvl............
Mpf_ENSMPUP00000002257 eygvhfhrvhpekksqtgillgvcskgvlvfevhngirtlvlrfpwretkki.........................
Mpf_ENSMPUP00000006734 ggndevdkllkeflhldltapipga....................................................
Mpf_ENSMPUP00000003502 lqyefkaknikkkkvsimvsvdgvkv...................................................
Mpf_ENSMPUP00000011019 epvllpgeivvnevnfvrkciatdtsqydlwgklicsnfkisfitddpmplqkfhyrnlllgehd............
Mpf_ENSMPUP00000003673 a............................................................................
Mpf_ENSMPUP00000000383 eklvlsedcelitiidvipgrleittqhvyfydcsidkedgvgfdfk..............................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 egp..........................................................................
Mpf_ENSMPUP00000007257 rrhhcracgkivcqacssnkygldylknqparvcehcfqelqkldhqhspkigspgnhkspssalssvlhsipsgrk
Mpf_ENSMPUP00000016774 tpe..........................................................................
Mpf_ENSMPUP00000001960 qkslpdlpppkiiperkqlsipkiespegyyeeaepydaslnedgeavsssyesydeeenskgksaphqwpspeasi
Mpf_ENSMPUP00000007610 vercmsamqagtqmvklrggskglvrfyfldehrscvrwrpsrkhekakisidsiqevsegrqsevfqryp......
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 sdcisfmqagcelkkvrpns.........................................................
Mpf_ENSMPUP00000014021 pgqgdsegsspftpaadedsvvfskltylgcasvnaprsevealrmmsilrsqcqisldvtlsvpnvsegtvrlldp
Mpf_ENSMPUP00000008982 peygvlvhrvlpekarvegemalgictkgvivyevtnnsriatlr................................
Mpf_ENSMPUP00000005803 plsstsgnaessivssnaispyacfygssa...............................................
Mpf_ENSMPUP00000002728 vercmsvmqsgtqmiklkrgs........................................................
Mpf_ENSMPUP00000007017 slst.........................................................................
Mpf_ENSMPUP00000003752 lfntvgldekqsattllvgprhgishvidlktnlttvlsefskisk...............................
Mpf_ENSMPUP00000001306 vqceglseq....................................................................
Mpf_ENSMPUP00000005338 gvsfflvkekmkgknklvprllgitkecvmrvdektkev......................................
Mpf_ENSMPUP00000001689 ss...........................................................................
Mpf_ENSMPUP00000010415 msssyesydeeeedgkgkktrhqwpseeasmdlvkdak.......................................
Mpf_ENSMPUP00000006220 kr...........................................................................
Mpf_ENSMPUP00000016350 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000018773 skrkklhitsedptytvlylgnattiqargdgctdlavgkiwskseagrqgtkmkltvsaqgirmvhaeeralrrpg
Mpf_ENSMPUP00000017599 nevs.........................................................................
Mpf_ENSMPUP00000016349 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000015036 rr...........................................................................
Mpf_ENSMPUP00000007938 lpgdsnlslptldvetnddlispyasfsstadr............................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 dvavhyyrlykdkreieasltlgltmrgiqifqnldeekqllydfpwtnvgklvfvgkkfeilpdglpsark.....
Mpf_ENSMPUP00000000650 gvsfflvkekmkgknklvprllgitkdsvmrvdektkev......................................
Mpf_ENSMPUP00000007937 dafyk........................................................................
Mpf_ENSMPUP00000007017 g............................................................................
Mpf_ENSMPUP00000012780 fk...........................................................................
Mpf_ENSMPUP00000002522 grvfkatlvqaekrsevtllvgprygishvintktnlvalladfshvnriemfte......................
Mpf_ENSMPUP00000004905 pshy.........................................................................
Mpf_ENSMPUP00000011326 as...........................................................................
Mpf_ENSMPUP00000009449 ykqgilarkmhhdadgkk...........................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 kk...........................................................................
Mpf_ENSMPUP00000002136 msdva........................................................................
Mpf_ENSMPUP00000017782 vdwfnalraar..................................................................
Mpf_ENSMPUP00000013550 a............................................................................
Mpf_ENSMPUP00000017362 tvvansdesqlltpgkmnqrqgkeayptptkdlyqpffspasphsqgfergkedisqnkdesslsmsksksesklyn
Mpf_ENSMPUP00000006996 slaapkma.....................................................................
Mpf_ENSMPUP00000004785 k............................................................................
Mpf_ENSMPUP00000014164 eefdcdlsdlrdmpeddgepckgaspepakspslrhsadlppplpqrpppedyyeealplgpgkspeyisshsaaps
Mpf_ENSMPUP00000016592 fstatvswdirtlystvpedaehkaenllvkeackfyssqwyvvnykyeqysgdirqlpraeykpeklpshsfevdh
Mpf_ENSMPUP00000000486 pkqy.........................................................................
Mpf_ENSMPUP00000003712 nvdaa........................................................................
Mpf_ENSMPUP00000006850 cc...........................................................................
Mpf_ENSMPUP00000015574 fqdvwpvtlrpkglgrtqglgsgryrlclgsgvlsllrkpkgrgsgdtqas..........................
Mpf_ENSMPUP00000014962 eklvlsaecqlvtvvavipglleittqhvyfydgsaerveteegighdfrrplaq......................
Mpf_ENSMPUP00000016814 lepsseevqknlrpfctldltspmlgvaseyi.............................................
Mpf_ENSMPUP00000000139 vspi.........................................................................
Mpf_ENSMPUP00000012020 iq...........................................................................
Mpf_ENSMPUP00000006069 gkifnatlmlqdresyiallvgakygisqiissklnimstlaefa................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 pvlfssik.....................................................................
Mpf_ENSMPUP00000010353 ekiqhmyrcarvqgldtseglllfgkehfyvidgftmtatreirdietlppnmhepiiprgarqgpsqlkrtcsif.
Mpf_ENSMPUP00000000014 kpiyggwlllapdgtdf............................................................
Mpf_ENSMPUP00000009546 pyvdr........................................................................
Mpf_ENSMPUP00000012020 fgetedetfpeaedsllqqmfivrflgsmavktdntteviyeamrqvlaaraihnifrtteshlmvtsqtlrlid..
Mpf_ENSMPUP00000016751 trkagylnarnktglvss...........................................................
Mpf_ENSMPUP00000000216 rrrhhcracghvvcwkcsdykaqleydggklnkvckdcyqiisgftdseekkrkgileiesaev.............
Mpf_ENSMPUP00000010854 mpg..........................................................................
Mpf_ENSMPUP00000016813 mdkpq........................................................................
Mpf_ENSMPUP00000002870 pyvdr........................................................................
Mpf_ENSMPUP00000003651 ve...........................................................................
Mpf_ENSMPUP00000002370 l............................................................................
Mpf_ENSMPUP00000006780 mdkpah.......................................................................
Mpf_ENSMPUP00000002802 ssvshssimhtesenlpetvkencqeetpettaspveyqdklylhlkenfskvkayameigkkipvpdqctiedsvr
Mpf_ENSMPUP00000011336 v............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 msdv.........................................................................
Mpf_ENSMPUP00000003141 pgdkrfrlwyvggscldrrttlpmlpwlmaeirrrsqkpeaggcgapaarevllvlsapflrcvpapgvgaaggvgp
Mpf_ENSMPUP00000013099 nkehgte......................................................................
Mpf_ENSMPUP00000010983 q............................................................................
Mpf_ENSMPUP00000004910 dps..........................................................................
Mpf_ENSMPUP00000016233 vltqcqdvelsfphqpegssvfc......................................................
Mpf_ENSMPUP00000002953 esirvnrrcisvapsretagelllgkcgmyfvednasdtvessslqgelepasfswtyeeik...............
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 vnssveer.....................................................................
Mpf_ENSMPUP00000014585 it...........................................................................
Mpf_ENSMPUP00000014164 kksslaelkgsvsraagrkitriisfskkkpladdpqmpcse...................................
Mpf_ENSMPUP00000005886 pnepsvdfslqlvgslpvhslttmpmlpwvvaevrrlsgqsskkepgarqvrlcvspsglrcepepgksqqwdplic
Mpf_ENSMPUP00000013797 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfq.......................................
Mpf_ENSMPUP00000004108 v............................................................................
Mpf_ENSMPUP00000009167 sqikralelgtvmtvfsfrkstperrtvqvimetrqvawsktadkiegfldimeikeirpgkns.............
Mpf_ENSMPUP00000016226 peg..........................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 gsaffevkqttepnfpeilliainkygislidprtkdiltthpftk...............................
Mpf_ENSMPUP00000010607 nhedfaldasilnvamvvgylgsielpstscnlesdslqairgclrrlraeqkihslvtmrvlhdrvqlctdqaavl
Mpf_ENSMPUP00000015774 kqfgte.......................................................................
Mpf_ENSMPUP00000008639 ededvramlqgsrlckirsrtwhkerlyrlqedglsvwfqrriprapsqhiffvqhieavreghqseglrrfggafp
Mpf_ENSMPUP00000012941 kyglln.......................................................................
Mpf_ENSMPUP00000016218 skv..........................................................................
Mpf_ENSMPUP00000007001 eeliylsq.....................................................................
Mpf_ENSMPUP00000001986 vrkagwlffkplvtlq.............................................................
Mpf_ENSMPUP00000010415 t............................................................................
Mpf_ENSMPUP00000003836 aiknpe.......................................................................
Mpf_ENSMPUP00000007027 lprg.........................................................................
Mpf_ENSMPUP00000002688 emmytinsqlef.................................................................
Mpf_ENSMPUP00000001373 smhqlqgnkeygs................................................................
Mpf_ENSMPUP00000013700 t............................................................................
Mpf_ENSMPUP00000016589 gsaffevkqtsetsypdiiliainrhgvllihpktk.........................................
Mpf_ENSMPUP00000015325 qdgt.........................................................................
Mpf_ENSMPUP00000001960 ss...........................................................................
Mpf_ENSMPUP00000006310 gltyylvrfkgskkddilgvsynrliridaatgipmttwrftnm.................................
Mpf_ENSMPUP00000016747 qkd..........................................................................
Mpf_ENSMPUP00000013323 spsrstsscsskqgsrq............................................................
Mpf_ENSMPUP00000007350 sdaldi.......................................................................
Mpf_ENSMPUP00000017588 crslevgtvmtlfyskksqrperktfqvkletrqitwsrgadki.................................
Mpf_ENSMPUP00000007745 ikqqrlnrlvegtcfrklncrrrqdkf..................................................
Mpf_ENSMPUP00000006409 k............................................................................
Mpf_ENSMPUP00000015574 d............................................................................
Mpf_ENSMPUP00000008365 dka..........................................................................
Mpf_ENSMPUP00000001054 rr...........................................................................
Mpf_ENSMPUP00000017488 ikqqrlnrlcegssfr.............................................................
Mpf_ENSMPUP00000005234 e............................................................................
Mpf_ENSMPUP00000013182 rprkltl......................................................................
Mpf_ENSMPUP00000011513 ttpvyttlkgkatqissspflddssgseeedssrsssrtsesdtrnrsgpgspramkrgvslssvasesdyaippda
Mpf_ENSMPUP00000005385 githfiarfqggkkeeligiaynrlirmdastgdaiktwrfsnmkqw..............................
Mpf_ENSMPUP00000009077 ekvtqkyslvivqghlvseg.........................................................
Mpf_ENSMPUP00000001767 eliktprvdnvvlhrpfypavegtlcltghhlilssrqdnte...................................
Mpf_ENSMPUP00000007827 py...........................................................................
Mpf_ENSMPUP00000000541 ad...........................................................................
Mpf_ENSMPUP00000001809 ve...........................................................................
Mpf_ENSMPUP00000005803 e............................................................................
Mpf_ENSMPUP00000013182 gisyivvrfkgsrkdeilgiannrliridlavgdvvktwrf....................................
Mpf_ENSMPUP00000005315 gnh..........................................................................
Mpf_ENSMPUP00000014585 gn...........................................................................
Mpf_ENSMPUP00000015166 r............................................................................
Mpf_ENSMPUP00000002409 rrvkvytlnedrqwddrgtghvsstyveelkgmsllvraesdgslllesk...........................
Mpf_ENSMPUP00000005807 v............................................................................
Mpf_ENSMPUP00000013796 elpwtlqrrlirlraasghrtagsavcasrv..............................................
Mpf_ENSMPUP00000017782 pdkqepysag...................................................................
Mpf_ENSMPUP00000019464 sdspad.......................................................................
Mpf_ENSMPUP00000012725 rpallpgeeivceglrvlldpdgreeatggllggpqllpaegalflttyrilfrgtphdqlvgeqtvvrsfpi....
Mpf_ENSMPUP00000010996 g............................................................................
Mpf_ENSMPUP00000007938 elerplhpkervleqalqwcqlpepcsaslllrkvslaqagclftgirres..........................
Mpf_ENSMPUP00000009654 v............................................................................
Mpf_ENSMPUP00000005385 kpkkltl......................................................................
Mpf_ENSMPUP00000006310 rpkklil......................................................................
Mpf_ENSMPUP00000007963 p............................................................................
Mpf_ENSMPUP00000002310 ra...........................................................................
Mpf_ENSMPUP00000000486 qafp.........................................................................
Mpf_ENSMPUP00000007805 rrvkvytlnedrqwddrgtghvssgyverlkgmsllvraesdgsll...............................
Mpf_ENSMPUP00000010246 eklhmeckaemvtplvtnpghvcitdtnlyfqplngypkpvvqitlqdvrr..........................
Mpf_ENSMPUP00000004460 d............................................................................
Mpf_ENSMPUP00000014791 lhccdeavsfslrsyeh............................................................
Mpf_ENSMPUP00000003154 dk...........................................................................
Mpf_ENSMPUP00000005214 kndq.........................................................................
Mpf_ENSMPUP00000003932 e............................................................................
Mpf_ENSMPUP00000008710 dckvds.......................................................................
Mpf_ENSMPUP00000005632 lirqqrllrlcegtlfrkissrrrqltdklwfcclspnhkvlqygdmeegaspptldslpeqlpvadikalltgkdc
Mpf_ENSMPUP00000002828 kge..........................................................................
Mpf_ENSMPUP00000017859 kvenvrlvdrisskkaalgt.........................................................
Mpf_ENSMPUP00000013754 gssatv.......................................................................
Mpf_ENSMPUP00000004548 p............................................................................
Mpf_ENSMPUP00000000646 kveqvklldrfstnnksltgtlyl.....................................................
Mpf_ENSMPUP00000004473 l............................................................................
Mpf_ENSMPUP00000000402 pe...........................................................................
Mpf_ENSMPUP00000007412 eqm..........................................................................
Mpf_ENSMPUP00000004935 psgeeifatiiitgnggiqwsrgkhkesetlteqdlqlycdfpd.................................
Mpf_ENSMPUP00000011513 kvkhg........................................................................
Mpf_ENSMPUP00000001759 ps...........................................................................
Mpf_ENSMPUP00000008353 lsn..........................................................................
Mpf_ENSMPUP00000012083 pe...........................................................................
Mpf_ENSMPUP00000006956 s............................................................................
Mpf_ENSMPUP00000014860 pe...........................................................................
Mpf_ENSMPUP00000009647 miv..........................................................................
Mpf_ENSMPUP00000005803 aat..........................................................................
Mpf_ENSMPUP00000005109 vt...........................................................................
Mpf_ENSMPUP00000006149 qnstkiyqrcw..................................................................
Mpf_ENSMPUP00000001981 ra...........................................................................
Mpf_ENSMPUP00000017916 yv...........................................................................
Mpf_ENSMPUP00000003318 s............................................................................
Mpf_ENSMPUP00000017175 v............................................................................
Mpf_ENSMPUP00000016038 s............................................................................
Mpf_ENSMPUP00000016192 ihfegkif.....................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 lssst........................................................................
Mpf_ENSMPUP00000005493 tgclpgeqilgwapgvrkglepelpgtlictnlrvtfqpcgwqrsqetplsseydfvlvnigrl.............
Mpf_ENSMPUP00000009754 khgmmkfredr..................................................................
Mpf_ENSMPUP00000013796 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfq.......................................
Mpf_ENSMPUP00000010667 hfepvvplpdkievktgeedeeeffcnra................................................
Mpf_ENSMPUP00000013126 v............................................................................
Mpf_ENSMPUP00000018046 nflnsss......................................................................
Mpf_ENSMPUP00000006359 qdpklrelldvgnigrlehrmitvvygpdlvn.............................................
Mpf_ENSMPUP00000015086 lhllpgeqllceastvlkyvqedscqrgiygklvctdfkiaflgddesaldndetqfknkvigenditlhcvdqiyg
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 daliaisnyrlhikfkdsvinvplr....................................................
Mpf_ENSMPUP00000004217 thsg.........................................................................
Mpf_ENSMPUP00000015689 gedakgllrvagdsgiawssggqealqpfcdfpeivdisikqapcvgpagehrlvtvtrtdnqileaefpglpa...
Mpf_ENSMPUP00000015159 lrgpeapplrgtlcvtghhlllspgpqgtsdlwllllrsvdsiekrvsg............................
Mpf_ENSMPUP00000018833 vkvyslnedqqwddlgtghvsstyvkrlqgvsllvrsdsqaalileskinsnt........................
Mpf_ENSMPUP00000007866 a............................................................................
Mpf_ENSMPUP00000007938 qpp..........................................................................
Mpf_ENSMPUP00000010694 ntdtlscsswptspgl.............................................................
Mpf_ENSMPUP00000013131 iialsnyrlhik.................................................................
Mpf_ENSMPUP00000000312 hagrfs.......................................................................
Mpf_ENSMPUP00000019132 a............................................................................
Mpf_ENSMPUP00000015959 lseldlgaerdvrvwplhpsll.......................................................
Mpf_ENSMPUP00000012612 npdregwllklgwgrkwdrmwlrgaslqhdeeagrtsnpqrgavamcgkmakhldsgartfclelynpscrgqkika
Mpf_ENSMPUP00000007938 lyrkphpqypdhsqllqalcaavagpnllknmtqllcveasegeepwspaaldgsfpglqlpdpspgvynevvvpat
Mpf_ENSMPUP00000007989 eelirltqrlrfh................................................................
Mpf_ENSMPUP00000016156 deeasdeppkvvvtevkeedafyskkcklf...............................................
Mpf_ENSMPUP00000013721 riifsgnlfqyqednkkwrnrfslv....................................................
Mpf_ENSMPUP00000005447 pes..........................................................................
Mpf_ENSMPUP00000015768 eh...........................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 eedpdvvvkgwlygeprgggarpwlp...................................................
Mpf_ENSMPUP00000002188 mp...........................................................................
Mpf_ENSMPUP00000013446 pesr.........................................................................
Mpf_ENSMPUP00000012407 etgtgt.......................................................................
Mpf_ENSMPUP00000017043 e............................................................................
Mpf_ENSMPUP00000007898 vfpvfvqp.....................................................................
Mpf_ENSMPUP00000017064 q............................................................................
Mpf_ENSMPUP00000009754 h............................................................................
Mpf_ENSMPUP00000016461 svw..........................................................................
Mpf_ENSMPUP00000008230 ga...........................................................................
Mpf_ENSMPUP00000001993 en...........................................................................
Mpf_ENSMPUP00000014500 t............................................................................
Mpf_ENSMPUP00000002405 silg.........................................................................
Mpf_ENSMPUP00000002933 pgl..........................................................................
Mpf_ENSMPUP00000007268 ssilgq.......................................................................
Mpf_ENSMPUP00000010983 avgtldvglidsv................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 ayegrvwip....................................................................
Mpf_ENSMPUP00000002033 rprllpgeecvldglrvyllpdgreegaggsgggpallpaegavflttyrviftgmptdplvgeqvvvrsfpv....
Mpf_ENSMPUP00000010694 pvnqqivymgwceareqdplqdrv.....................................................
Mpf_ENSMPUP00000008353 da...........................................................................
Mpf_ENSMPUP00000009754 ferlgrlpykaglslqraqegwfsltgselravfpegpceeplqlrklqel..........................
Mpf_ENSMPUP00000015718 gtaye........................................................................
Mpf_ENSMPUP00000002358 aykgyv.......................................................................
Mpf_ENSMPUP00000005077 csavecldlgrgepvsvkplhssilg...................................................
Mpf_ENSMPUP00000009107 pt...........................................................................
Mpf_ENSMPUP00000016101 gq...........................................................................
Mpf_ENSMPUP00000011911 ple..........................................................................
Mpf_ENSMPUP00000007938 gl...........................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 mqlpv........................................................................
Mpf_ENSMPUP00000006638 wtyfcdfqd....................................................................
Mpf_ENSMPUP00000005803 dli..........................................................................
Mpf_ENSMPUP00000010983 tlpy.........................................................................
Mpf_ENSMPUP00000000717 nfsyfpeithivikesvvs..........................................................
Mpf_ENSMPUP00000002793 geivk........................................................................
Mpf_ENSMPUP00000007833 mdhld........................................................................
Mpf_ENSMPUP00000002271 a............................................................................
Mpf_ENSMPUP00000010974 sn...........................................................................
Mpf_ENSMPUP00000010755 egvirkrsgghrvpg..............................................................
Mpf_ENSMPUP00000013112 ldtcaefrikyvgaieklkfsegkslegpldlinyidvaqqdgklpfvpleeefimgvskygikvsssdqydvlhrh


                                                                                                    
                                                                                                    
d1dbha2                .............................................................................
Mpf_ENSMPUP00000000236 hflillfskdedisltlnmneeevekrfegrltknmsgslyemvsrvmkalvnrkitvpgnfqghsgaqcitcsyka
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000006133 atrrrkpcsrplssilgrsnlkfagmpitltvstsslnlmaadc.................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 .............................................................................
Mpf_ENSMPUP00000012215 kkrkppvkflstvlgksnlq.........................................................
Mpf_ENSMPUP00000016175 avesvtd......................................................................
Mpf_ENSMPUP00000009909 swkkkapnkalasilgksnlrfagmsiavsistdglnlsvpatrqiianhhmqsisf....................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 av...........................................................................
Mpf_ENSMPUP00000018612 .............................................................................
Mpf_ENSMPUP00000018966 .............................................................................
Mpf_ENSMPUP00000004660 erydkddeahsegnqfppiaaqdlp....................................................
Mpf_ENSMPUP00000002149 .............................................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 .............................................................................
Mpf_ENSMPUP00000011363 vptiilsvsykgvkfidatnkniiae...................................................
Mpf_ENSMPUP00000015445 sra..........................................................................
Mpf_ENSMPUP00000015195 sltsdapflpdyqdegvedllkgaqel..................................................
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 eqyihdldtnsfeldlefsedekrlllekqasgnpwhqfven...................................
Mpf_ENSMPUP00000008441 anhhmqsisfasggdpdttdyva......................................................
Mpf_ENSMPUP00000005146 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000000642 .............................................................................
Mpf_ENSMPUP00000015373 .............................................................................
Mpf_ENSMPUP00000003213 ilsitykgvkfidasnknviaeheirnisc...............................................
Mpf_ENSMPUP00000012196 lepktkevqhn..................................................................
Mpf_ENSMPUP00000012194 .............................................................................
Mpf_ENSMPUP00000003212 ilsitykgvkfidasnknviaeheirnisc...............................................
Mpf_ENSMPUP00000001158 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 .............................................................................
Mpf_ENSMPUP00000003768 kkavkavlwvsadglrvvdektkd.....................................................
Mpf_ENSMPUP00000008012 .............................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 .............................................................................
Mpf_ENSMPUP00000017573 llvdqtiekvsf.................................................................
Mpf_ENSMPUP00000012859 gpdarleeklmtvvagpdpvntt......................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013200 .............................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 mdrqtvsmainevfnelild.........................................................
Mpf_ENSMPUP00000002913 .............................................................................
Mpf_ENSMPUP00000003504 dkyplimvpdeveyllkkvlssmslevglgeleellaqeaqaaqttgglsvwqflelfnsgrclrgvgrdtlsmaih
Mpf_ENSMPUP00000004361 .............................................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 .............................................................................
Mpf_ENSMPUP00000006376 sendlegrivcvcsgtdlvnis.......................................................
Mpf_ENSMPUP00000014536 .............................................................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 .............................................................................
Mpf_ENSMPUP00000006727 .............................................................................
Mpf_ENSMPUP00000000961 .............................................................................
Mpf_ENSMPUP00000004942 .............................................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 .............................................................................
Mpf_ENSMPUP00000010395 .............................................................................
Mpf_ENSMPUP00000015361 .............................................................................
Mpf_ENSMPUP00000001991 k............................................................................
Mpf_ENSMPUP00000005637 ltvhfnppsscvleisvrgvkigvkaddsqeakg...........................................
Mpf_ENSMPUP00000007307 .............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 .............................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 .............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 .............................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 .............................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 kltvhlrppascdleislrgvkl......................................................
Mpf_ENSMPUP00000006252 waqmqidk.....................................................................
Mpf_ENSMPUP00000005676 sggwge.......................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 .............................................................................
Mpf_ENSMPUP00000010571 .............................................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 .............................................................................
Mpf_ENSMPUP00000007327 .............................................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 .............................................................................
Mpf_ENSMPUP00000012096 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 fhsinpstfkkqkkvpsaltevaa.....................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 .............................................................................
Mpf_ENSMPUP00000016865 glfvqtwy.....................................................................
Mpf_ENSMPUP00000000090 .............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013402 .............................................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 pagdgepgrgpmrksfsqpglrslafrkefqdgslrsrsffssfeendienhlisghnvvqptdmeenrtmlftigq
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 .............................................................................
Mpf_ENSMPUP00000009754 ededdhayegipnggwhtsslssslpssllipelpphpmdghpvgpapit...........................
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 .............................................................................
Mpf_ENSMPUP00000007027 daysldsdysepehklqrtssysaegp..................................................
Mpf_ENSMPUP00000012725 gvdrraatlysqyasrndenr........................................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 .............................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 aeegdgvpdilptlpatasqpglpssragfperiledsgfdeqqefrsrcssvtgvlqkkvhensqkplprrrhasa
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 .............................................................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 asfpiyk......................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 .............................................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 qkkipaalkev..................................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 elmr.........................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 .............................................................................
Mpf_ENSMPUP00000014021 qtnteianypiykilfcvrgh........................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 .............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 ragkneflnlvpdiee.............................................................
Mpf_ENSMPUP00000018773 hlyllhrvtycvadarlpkvfawvyrh..................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 ragkneflnlvpdiee.............................................................
Mpf_ENSMPUP00000015036 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 .............................................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 .............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 gsekdssasskltkkeslkvqkknyreekkratkellsti.....................................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 .............................................................................
Mpf_ENSMPUP00000014164 tnptdgcspahsimdgyyedadssypatrmngelknsyndsdpmsssyesydeeeeegkgpqpthqwpseeasmhlv
Mpf_ENSMPUP00000016592 edadkdedttshssskgggaag.......................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 .............................................................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 scvaklfftcslkghyclyskssfilisqepqpwiqimflfqqslfpeplsiqshsvqflralwektqaegahsfet
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 aaaqpnpavfifehkaqhisrfihnshd.................................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 .............................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 ssifeckpqhvhkli..............................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 aeypaeklafsavcpddr...........................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 pa...........................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 .............................................................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 ystdteysqpeqklpktcssssdngk...................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 .............................................................................
Mpf_ENSMPUP00000001767 .............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 .............................................................................
Mpf_ENSMPUP00000005632 phvrek.......................................................................
Mpf_ENSMPUP00000002828 .............................................................................
Mpf_ENSMPUP00000017859 .............................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 .............................................................................
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 vfdekkkplfgqlkkypek..........................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 cktdgegkvve..................................................................
Mpf_ENSMPUP00000007938 yssflycgpisnkagpppprrgrda....................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 .............................................................................
Mpf_ENSMPUP00000015768 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 .............................................................................
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 .............................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 .............................................................................
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 alyliirmvcyddglgagksllalktt..................................................


                                                                                                    
                                                                                                    
d1dbha2                ......................................................................-IKKMNE
Mpf_ENSMPUP00000000236 ................................................................ssglly-------
Mpf_ENSMPUP00000001054 ......................................................................-------
Mpf_ENSMPUP00000001986 ......................................................................-------
Mpf_ENSMPUP00000006133 ......................................................................-------
Mpf_ENSMPUP00000009494 ......................................................................-------
Mpf_ENSMPUP00000004093 ......................................................................-------
Mpf_ENSMPUP00000012215 ......................................................................-------
Mpf_ENSMPUP00000016175 ......................................................................-------
Mpf_ENSMPUP00000009909 ......................................................................-------
Mpf_ENSMPUP00000010977 ......................................................................-------
Mpf_ENSMPUP00000016638 ......................................................................-------
Mpf_ENSMPUP00000018612 ......................................................................-------
Mpf_ENSMPUP00000018966 ......................................................................-------
Mpf_ENSMPUP00000004660 ......................................................................-------
Mpf_ENSMPUP00000002149 ......................................................................-------
Mpf_ENSMPUP00000018066 ......................................................................-------
Mpf_ENSMPUP00000017958 ......................................................................-------
Mpf_ENSMPUP00000011450 ......................................................................-------
Mpf_ENSMPUP00000016402 ......................................................................-------
Mpf_ENSMPUP00000004951 ......................................................................-------
Mpf_ENSMPUP00000011363 ......................................................................-------
Mpf_ENSMPUP00000015445 ......................................................................-------
Mpf_ENSMPUP00000015195 ......................................................................-------
Mpf_ENSMPUP00000011751 ......................................................................NIDKIAQ
Mpf_ENSMPUP00000009831 ......................................................................NIDKIAQ
Mpf_ENSMPUP00000004111 ......................................................................-------
Mpf_ENSMPUP00000005349 ......................................................................-------
Mpf_ENSMPUP00000006137 ......................................................................-------
Mpf_ENSMPUP00000009095 ......................................................................-------
Mpf_ENSMPUP00000005832 ......................................................................-------
Mpf_ENSMPUP00000014567 ......................................................................-------
Mpf_ENSMPUP00000015198 ......................................................................-------
Mpf_ENSMPUP00000008441 ......................................................................-------
Mpf_ENSMPUP00000005146 ......................................................................-------
Mpf_ENSMPUP00000010667 ......................................................................-------
Mpf_ENSMPUP00000000642 ......................................................................--DKIAR
Mpf_ENSMPUP00000015373 ......................................................................-------
Mpf_ENSMPUP00000003213 ......................................................................-------
Mpf_ENSMPUP00000012196 ......................................................................-------
Mpf_ENSMPUP00000012194 ......................................................................-------
Mpf_ENSMPUP00000003212 ......................................................................-------
Mpf_ENSMPUP00000001158 ......................................................................-------
Mpf_ENSMPUP00000010667 ......................................................................-------
Mpf_ENSMPUP00000013386 ......................................................................-------
Mpf_ENSMPUP00000016712 ......................................................................-------
Mpf_ENSMPUP00000003302 ......................................................................-------
Mpf_ENSMPUP00000003768 ......................................................................-------
Mpf_ENSMPUP00000008012 ......................................................................-------
Mpf_ENSMPUP00000002625 ......................................................................-------
Mpf_ENSMPUP00000010667 ......................................................................-------
Mpf_ENSMPUP00000006140 ......................................................................-------
Mpf_ENSMPUP00000015670 ......................................................................-------
Mpf_ENSMPUP00000008341 ......................................................................-------
Mpf_ENSMPUP00000017573 ......................................................................-------
Mpf_ENSMPUP00000012859 ......................................................................-------
Mpf_ENSMPUP00000012131 ......................................................................-------
Mpf_ENSMPUP00000000172 ......................................................................-------
Mpf_ENSMPUP00000013200 ......................................................................-------
Mpf_ENSMPUP00000003522 ......................................................................-------
Mpf_ENSMPUP00000011499 ......................................................................-------
Mpf_ENSMPUP00000011494 ......................................................................-------
Mpf_ENSMPUP00000012716 ......................................................................-------
Mpf_ENSMPUP00000002913 ......................................................................-------
Mpf_ENSMPUP00000003504 ..............................................................evyqeliq-------
Mpf_ENSMPUP00000004361 ......................................................................-------
Mpf_ENSMPUP00000017389 ......................................................................-------
Mpf_ENSMPUP00000015829 ......................................................................-------
Mpf_ENSMPUP00000003644 ......................................................................-------
Mpf_ENSMPUP00000006376 ......................................................................-------
Mpf_ENSMPUP00000014536 ......................................................................-------
Mpf_ENSMPUP00000011501 ......................................................................-------
Mpf_ENSMPUP00000017670 ......................................................................-------
Mpf_ENSMPUP00000006727 ......................................................................-------
Mpf_ENSMPUP00000000961 ......................................................................-------
Mpf_ENSMPUP00000004942 ......................................................................-------
Mpf_ENSMPUP00000002151 ......................................................................-------
Mpf_ENSMPUP00000014680 ......................................................................-------
Mpf_ENSMPUP00000005563 ......................................................................-------
Mpf_ENSMPUP00000011333 ......................................................................-------
Mpf_ENSMPUP00000000969 ......................................................................-------
Mpf_ENSMPUP00000010395 ......................................................................-IKKMNE
Mpf_ENSMPUP00000015361 ......................................................................-------
Mpf_ENSMPUP00000001991 ......................................................................-------
Mpf_ENSMPUP00000005637 ......................................................................-------
Mpf_ENSMPUP00000007307 ......................................................................-------
Mpf_ENSMPUP00000008193 ......................................................................-------
Mpf_ENSMPUP00000007177 ......................................................................-------
Mpf_ENSMPUP00000010360 ......................................................................-------
Mpf_ENSMPUP00000010611 ......................................................................-------
Mpf_ENSMPUP00000007161 ......................................................................-------
Mpf_ENSMPUP00000006134 ......................................................................-------
Mpf_ENSMPUP00000004983 ......................................................................-IKKMNE
Mpf_ENSMPUP00000001920 ......................................................................-------
Mpf_ENSMPUP00000013542 ......................................................................-------
Mpf_ENSMPUP00000008337 ......................................................................-------
Mpf_ENSMPUP00000013626 ......................................................................-------
Mpf_ENSMPUP00000001949 ......................................................................-------
Mpf_ENSMPUP00000017721 ......................................................................-------
Mpf_ENSMPUP00000001109 ......................................................................-------
Mpf_ENSMPUP00000001935 ......................................................................-------
Mpf_ENSMPUP00000006252 ......................................................................-------
Mpf_ENSMPUP00000005676 ......................................................................-------
Mpf_ENSMPUP00000005196 ......................................................................-------
Mpf_ENSMPUP00000012589 ......................................................................-------
Mpf_ENSMPUP00000010571 ......................................................................-------
Mpf_ENSMPUP00000011589 ......................................................................-------
Mpf_ENSMPUP00000005676 ......................................................................-------
Mpf_ENSMPUP00000002533 ......................................................................-------
Mpf_ENSMPUP00000004215 ......................................................................-------
Mpf_ENSMPUP00000013399 ......................................................................-------
Mpf_ENSMPUP00000010530 ......................................................................---ELQI
Mpf_ENSMPUP00000006089 ......................................................................-------
Mpf_ENSMPUP00000016498 ......................................................................-------
Mpf_ENSMPUP00000007327 ......................................................................-------
Mpf_ENSMPUP00000001749 ......................................................................-------
Mpf_ENSMPUP00000016475 ......................................................................-------
Mpf_ENSMPUP00000013206 ......................................................................-------
Mpf_ENSMPUP00000006140 ......................................................................-------
Mpf_ENSMPUP00000005780 ......................................................................-------
Mpf_ENSMPUP00000001869 ......................................................................---ELQI
Mpf_ENSMPUP00000012475 ......................................................................-------
Mpf_ENSMPUP00000008316 ......................................................................-------
Mpf_ENSMPUP00000001167 ......................................................................-------
Mpf_ENSMPUP00000008230 ......................................................................-------
Mpf_ENSMPUP00000017717 ......................................................................-------
Mpf_ENSMPUP00000010272 ......................................................................-------
Mpf_ENSMPUP00000003964 ......................................................................-------
Mpf_ENSMPUP00000017478 ......................................................................--EALEQ
Mpf_ENSMPUP00000010168 ......................................................................-------
Mpf_ENSMPUP00000009546 ......................................................................-------
Mpf_ENSMPUP00000002870 ......................................................................-------
Mpf_ENSMPUP00000000151 ......................................................................-------
Mpf_ENSMPUP00000000216 ......................................................................NLKKLLE
Mpf_ENSMPUP00000007012 ......................................................................--RQITN
Mpf_ENSMPUP00000012096 ......................................................................--KKISE
Mpf_ENSMPUP00000004281 ......................................................................-------
Mpf_ENSMPUP00000004460 ......................................................................-------
Mpf_ENSMPUP00000011499 ......................................................................-------
Mpf_ENSMPUP00000003498 ......................................................................-------
Mpf_ENSMPUP00000006723 ......................................................................-------
Mpf_ENSMPUP00000006149 ......................................................................-------
Mpf_ENSMPUP00000011052 ......................................................................-------
Mpf_ENSMPUP00000015653 ......................................................................-------
Mpf_ENSMPUP00000014937 ......................................................................-------
Mpf_ENSMPUP00000006713 ......................................................................HAVRLQE
Mpf_ENSMPUP00000005370 ......................................................................-------
Mpf_ENSMPUP00000017142 ......................................................................-------
Mpf_ENSMPUP00000011052 ......................................................................-------
Mpf_ENSMPUP00000000930 ......................................................................-------
Mpf_ENSMPUP00000016865 ......................................................................-------
Mpf_ENSMPUP00000000090 ......................................................................--REIKQ
Mpf_ENSMPUP00000012035 ......................................................................-------
Mpf_ENSMPUP00000009068 ......................................................................-------
Mpf_ENSMPUP00000000172 ......................................................................-------
Mpf_ENSMPUP00000013402 ......................................................................-------
Mpf_ENSMPUP00000012726 ......................................................................-------
Mpf_ENSMPUP00000010329 ......................................................................HAVRLQE
Mpf_ENSMPUP00000005886 ....................sevylispdtkkialeknfkeisfcsqgirhvdhfgficressggggfhf-------
Mpf_ENSMPUP00000011911 ......................................................................-------
Mpf_ENSMPUP00000013895 ......................................................................-----QL
Mpf_ENSMPUP00000009754 ......................................................................-------
Mpf_ENSMPUP00000017452 ......................................................................-------
Mpf_ENSMPUP00000004281 ......................................................................-------
Mpf_ENSMPUP00000017577 ......................................................................-------
Mpf_ENSMPUP00000004977 ......................................................................-------
Mpf_ENSMPUP00000017884 ......................................................................-------
Mpf_ENSMPUP00000007027 ......................................................................-------
Mpf_ENSMPUP00000012725 ......................................................................-------
Mpf_ENSMPUP00000000871 ......................................................................-------
Mpf_ENSMPUP00000006220 ......................................................................-------
Mpf_ENSMPUP00000008418 ......................................................................-------
Mpf_ENSMPUP00000003932 ......................................................................-------
Mpf_ENSMPUP00000001861 ......................................................................-------
Mpf_ENSMPUP00000008418 ......................................................................-------
Mpf_ENSMPUP00000006249 ......................................................................-------
Mpf_ENSMPUP00000003836 ......................................................................-------
Mpf_ENSMPUP00000015858 ......................................................................-------
Mpf_ENSMPUP00000002835 ......................................................................-------
Mpf_ENSMPUP00000004473 ......................................................................-MHKLLE
Mpf_ENSMPUP00000000137 ......................................................................-------
Mpf_ENSMPUP00000001907 ......................................................................-------
Mpf_ENSMPUP00000014024 ......................................................................-------
Mpf_ENSMPUP00000001742 ......................................................................-------
Mpf_ENSMPUP00000000172 ......................................................................NLQKLTE
Mpf_ENSMPUP00000005480 ......................................................................-------
Mpf_ENSMPUP00000018515 ......................................................................----RIN
Mpf_ENSMPUP00000009502 ......................................................................-------
Mpf_ENSMPUP00000013672 ......................................................................-------
Mpf_ENSMPUP00000011336 ......................................................................-MHKLLK
Mpf_ENSMPUP00000001410 ......................................................................-------
Mpf_ENSMPUP00000003424 ......................................................................-------
Mpf_ENSMPUP00000007040 ......................................................................-------
Mpf_ENSMPUP00000019493 ......................................................................-------
Mpf_ENSMPUP00000018830 ......................................................................-------
Mpf_ENSMPUP00000003141 pshvqpsdseknrtmlfqvgrfeinlispdtksvvleknfkdisscsqgikhvdhfgficresaepglgq-------
Mpf_ENSMPUP00000010983 ......................................................................-------
Mpf_ENSMPUP00000010498 ......................................................................-------
Mpf_ENSMPUP00000012786 ......................................................................-------
Mpf_ENSMPUP00000014114 ......................................................................-------
Mpf_ENSMPUP00000007256 ......................................................................-------
Mpf_ENSMPUP00000005608 ......................................................................-------
Mpf_ENSMPUP00000002033 ......................................................................-------
Mpf_ENSMPUP00000016751 ......................................................................-------
Mpf_ENSMPUP00000016435 ......................................................................-------
Mpf_ENSMPUP00000001167 ......................................................................-------
Mpf_ENSMPUP00000001585 ......................................................................-------
Mpf_ENSMPUP00000002351 ......................................................................-------
Mpf_ENSMPUP00000011499 ......................................................................NFQKLHE
Mpf_ENSMPUP00000005375 ......................................................................-------
Mpf_ENSMPUP00000015986 ......................................................................-------
Mpf_ENSMPUP00000004747 ......................................................................-------
Mpf_ENSMPUP00000009754 ......................................................................-------
Mpf_ENSMPUP00000002257 ......................................................................-------
Mpf_ENSMPUP00000006734 ......................................................................-------
Mpf_ENSMPUP00000003502 ......................................................................-------
Mpf_ENSMPUP00000011019 ......................................................................-------
Mpf_ENSMPUP00000003673 ......................................................................-------
Mpf_ENSMPUP00000000383 ......................................................................-------
Mpf_ENSMPUP00000008997 ......................................................................-------
Mpf_ENSMPUP00000010040 ......................................................................-------
Mpf_ENSMPUP00000007257 ......................................................................-------
Mpf_ENSMPUP00000016774 ......................................................................-------
Mpf_ENSMPUP00000001960 ......................................................................-------
Mpf_ENSMPUP00000007610 ......................................................................-------
Mpf_ENSMPUP00000017612 ......................................................................HAARLQE
Mpf_ENSMPUP00000007907 ......................................................................-------
Mpf_ENSMPUP00000014021 ......................................................................-------
Mpf_ENSMPUP00000008982 ......................................................................-------
Mpf_ENSMPUP00000005803 ......................................................................-------
Mpf_ENSMPUP00000002728 ......................................................................-------
Mpf_ENSMPUP00000007017 ......................................................................-------
Mpf_ENSMPUP00000003752 ......................................................................-------
Mpf_ENSMPUP00000001306 ......................................................................------L
Mpf_ENSMPUP00000005338 ......................................................................-------
Mpf_ENSMPUP00000001689 ......................................................................-------
Mpf_ENSMPUP00000010415 ......................................................................-------
Mpf_ENSMPUP00000006220 ......................................................................-------
Mpf_ENSMPUP00000016350 ......................................................................-------
Mpf_ENSMPUP00000018773 ......................................................................-------
Mpf_ENSMPUP00000017599 ......................................................................-------
Mpf_ENSMPUP00000016349 ......................................................................-------
Mpf_ENSMPUP00000015036 ......................................................................-------
Mpf_ENSMPUP00000007938 ......................................................................-------
Mpf_ENSMPUP00000007257 ......................................................................NFQKLMQ
Mpf_ENSMPUP00000005203 ......................................................................-------
Mpf_ENSMPUP00000000650 ......................................................................-------
Mpf_ENSMPUP00000007937 ......................................................................-------
Mpf_ENSMPUP00000007017 ......................................................................-------
Mpf_ENSMPUP00000012780 ......................................................................-------
Mpf_ENSMPUP00000002522 ......................................................................-------
Mpf_ENSMPUP00000004905 ......................................................................-------
Mpf_ENSMPUP00000011326 ......................................................................-------
Mpf_ENSMPUP00000009449 ......................................................................-------
Mpf_ENSMPUP00000000014 ......................................................................-------
Mpf_ENSMPUP00000012737 ......................................................................-------
Mpf_ENSMPUP00000002136 ......................................................................-------
Mpf_ENSMPUP00000017782 ......................................................................----FHY
Mpf_ENSMPUP00000013550 ......................................................................-------
Mpf_ENSMPUP00000017362 ......................................................................-------
Mpf_ENSMPUP00000006996 ......................................................................-------
Mpf_ENSMPUP00000004785 ......................................................................-------
Mpf_ENSMPUP00000014164 ......................................................................-------
Mpf_ENSMPUP00000016592 ......................................................................-------
Mpf_ENSMPUP00000000486 ......................................................................-------
Mpf_ENSMPUP00000003712 ......................................................................-------
Mpf_ENSMPUP00000006850 ......................................................................-------
Mpf_ENSMPUP00000015574 ......................................................................-------
Mpf_ENSMPUP00000014962 ......................................................................-------
Mpf_ENSMPUP00000016814 ......................................................................-------
Mpf_ENSMPUP00000000139 ......................................................................-------
Mpf_ENSMPUP00000012020 ......................................................................-------
Mpf_ENSMPUP00000006069 ......................................................................-------
Mpf_ENSMPUP00000017142 ......................................................................NLQKLVH
Mpf_ENSMPUP00000013991 ......................................................................-------
Mpf_ENSMPUP00000010353 ......................................................................-------
Mpf_ENSMPUP00000000014 ......................................................................-------
Mpf_ENSMPUP00000009546 ......................................................................-------
Mpf_ENSMPUP00000012020 ......................................................................-------
Mpf_ENSMPUP00000016751 ......................................................................-------
Mpf_ENSMPUP00000000216 ......................................................................-------
Mpf_ENSMPUP00000010854 ......................................................................-------
Mpf_ENSMPUP00000016813 ......................................................................-------
Mpf_ENSMPUP00000002870 ......................................................................-------
Mpf_ENSMPUP00000003651 ......................................................................-------
Mpf_ENSMPUP00000002370 ......................................................................--EVLEE
Mpf_ENSMPUP00000006780 ......................................................................-------
Mpf_ENSMPUP00000002802 ..............................ammestfpqqkdldqvqlhleevrffdvfgfseaagawqc-------
Mpf_ENSMPUP00000011336 ......................................................................-------
Mpf_ENSMPUP00000003120 ......................................................................-------
Mpf_ENSMPUP00000005803 ......................................................................-------
Mpf_ENSMPUP00000004980 ......................................................................-------
Mpf_ENSMPUP00000015621 ......................................................................-------
Mpf_ENSMPUP00000003141 ......................................................................-------
Mpf_ENSMPUP00000013099 ......................................................................-------
Mpf_ENSMPUP00000010983 ......................................................................-------
Mpf_ENSMPUP00000004910 ......................................................................-------
Mpf_ENSMPUP00000016233 ......................................................................-------
Mpf_ENSMPUP00000002953 ......................................................................-------
Mpf_ENSMPUP00000011716 ......................................................................-------
Mpf_ENSMPUP00000007767 ......................................................................-------
Mpf_ENSMPUP00000014585 ......................................................................-------
Mpf_ENSMPUP00000014164 ......................................................................-------
Mpf_ENSMPUP00000005886 ......................................................................-------
Mpf_ENSMPUP00000013797 ......................................................................-------
Mpf_ENSMPUP00000004108 ......................................................................-------
Mpf_ENSMPUP00000009167 ......................................................................-------
Mpf_ENSMPUP00000016226 ......................................................................-------
Mpf_ENSMPUP00000014024 ......................................................................-------
Mpf_ENSMPUP00000008448 ......................................................................-------
Mpf_ENSMPUP00000010607 ......................................................................-------
Mpf_ENSMPUP00000015774 ......................................................................-------
Mpf_ENSMPUP00000008639 ......................................................................-------
Mpf_ENSMPUP00000012941 ......................................................................-------
Mpf_ENSMPUP00000016218 ......................................................................-------
Mpf_ENSMPUP00000007001 ......................................................................-------
Mpf_ENSMPUP00000001986 ......................................................................-------
Mpf_ENSMPUP00000010415 ......................................................................-------
Mpf_ENSMPUP00000003836 ......................................................................-------
Mpf_ENSMPUP00000007027 ......................................................................-------
Mpf_ENSMPUP00000002688 ......................................................................-------
Mpf_ENSMPUP00000001373 ......................................................................-------
Mpf_ENSMPUP00000013700 ......................................................................-------
Mpf_ENSMPUP00000016589 ......................................................................-------
Mpf_ENSMPUP00000015325 ......................................................................-------
Mpf_ENSMPUP00000001960 ......................................................................-------
Mpf_ENSMPUP00000006310 ......................................................................-------
Mpf_ENSMPUP00000016747 ......................................................................-------
Mpf_ENSMPUP00000013323 ......................................................................------D
Mpf_ENSMPUP00000007350 ......................................................................-------
Mpf_ENSMPUP00000017588 ......................................................................-------
Mpf_ENSMPUP00000007745 ......................................................................-------
Mpf_ENSMPUP00000006409 ......................................................................-------
Mpf_ENSMPUP00000015574 ......................................................................-------
Mpf_ENSMPUP00000008365 ......................................................................-------
Mpf_ENSMPUP00000001054 ......................................................................-------
Mpf_ENSMPUP00000017488 ......................................................................-------
Mpf_ENSMPUP00000005234 ......................................................................---QMIS
Mpf_ENSMPUP00000013182 ......................................................................-------
Mpf_ENSMPUP00000011513 ......................................................................-------
Mpf_ENSMPUP00000005385 ......................................................................-------
Mpf_ENSMPUP00000009077 ......................................................................-------
Mpf_ENSMPUP00000001767 ......................................................................---ELWL
Mpf_ENSMPUP00000007827 ......................................................................-------
Mpf_ENSMPUP00000000541 ......................................................................-------
Mpf_ENSMPUP00000001809 ......................................................................-------
Mpf_ENSMPUP00000005803 ......................................................................-------
Mpf_ENSMPUP00000013182 ......................................................................-------
Mpf_ENSMPUP00000005315 ......................................................................-------
Mpf_ENSMPUP00000014585 ......................................................................-------
Mpf_ENSMPUP00000015166 ......................................................................-------
Mpf_ENSMPUP00000002409 ......................................................................-------
Mpf_ENSMPUP00000005807 ......................................................................-------
Mpf_ENSMPUP00000013796 ......................................................................-------
Mpf_ENSMPUP00000017782 ......................................................................-------
Mpf_ENSMPUP00000019464 ......................................................................-------
Mpf_ENSMPUP00000012725 ......................................................................-------
Mpf_ENSMPUP00000010996 ......................................................................-------
Mpf_ENSMPUP00000007938 ......................................................................-------
Mpf_ENSMPUP00000009654 ......................................................................-------
Mpf_ENSMPUP00000005385 ......................................................................-------
Mpf_ENSMPUP00000006310 ......................................................................-------
Mpf_ENSMPUP00000007963 ......................................................................-------
Mpf_ENSMPUP00000002310 ......................................................................-------
Mpf_ENSMPUP00000000486 ......................................................................-------
Mpf_ENSMPUP00000007805 ......................................................................-------
Mpf_ENSMPUP00000010246 ......................................................................-------
Mpf_ENSMPUP00000004460 ......................................................................-------
Mpf_ENSMPUP00000014791 ......................................................................-------
Mpf_ENSMPUP00000003154 ......................................................................-------
Mpf_ENSMPUP00000005214 ......................................................................---HLRR
Mpf_ENSMPUP00000003932 ......................................................................-------
Mpf_ENSMPUP00000008710 ......................................................................-------
Mpf_ENSMPUP00000005632 ......................................................................-------
Mpf_ENSMPUP00000002828 ......................................................................-------
Mpf_ENSMPUP00000017859 ......................................................................-------
Mpf_ENSMPUP00000013754 ......................................................................-------
Mpf_ENSMPUP00000004548 ......................................................................-------
Mpf_ENSMPUP00000000646 ......................................................................-------
Mpf_ENSMPUP00000004473 ......................................................................-------
Mpf_ENSMPUP00000000402 ......................................................................-------
Mpf_ENSMPUP00000007412 ......................................................................-----YE
Mpf_ENSMPUP00000004935 ......................................................................-------
Mpf_ENSMPUP00000011513 ......................................................................-------
Mpf_ENSMPUP00000001759 ......................................................................-------
Mpf_ENSMPUP00000008353 ......................................................................-------
Mpf_ENSMPUP00000012083 ......................................................................-------
Mpf_ENSMPUP00000006956 ......................................................................-------
Mpf_ENSMPUP00000014860 ......................................................................-------
Mpf_ENSMPUP00000009647 ......................................................................-------
Mpf_ENSMPUP00000005803 ......................................................................-------
Mpf_ENSMPUP00000005109 ......................................................................-------
Mpf_ENSMPUP00000006149 ......................................................................-------
Mpf_ENSMPUP00000001981 ......................................................................-------
Mpf_ENSMPUP00000017916 ......................................................................-----TK
Mpf_ENSMPUP00000003318 ......................................................................-------
Mpf_ENSMPUP00000017175 ......................................................................-------
Mpf_ENSMPUP00000016038 ......................................................................-------
Mpf_ENSMPUP00000016192 ......................................................................-------
Mpf_ENSMPUP00000015325 ......................................................................NIRKNLA
Mpf_ENSMPUP00000000660 ......................................................................-------
Mpf_ENSMPUP00000005493 ......................................................................-------
Mpf_ENSMPUP00000009754 ......................................................................-------
Mpf_ENSMPUP00000013796 ......................................................................-------
Mpf_ENSMPUP00000010667 ......................................................................-------
Mpf_ENSMPUP00000013126 ......................................................................-------
Mpf_ENSMPUP00000018046 ......................................................................-------
Mpf_ENSMPUP00000006359 ......................................................................-------
Mpf_ENSMPUP00000015086 ......................................................................-------
Mpf_ENSMPUP00000008387 ......................................................................NIRKNLA
Mpf_ENSMPUP00000015207 ......................................................................-------
Mpf_ENSMPUP00000004217 ......................................................................-------
Mpf_ENSMPUP00000015689 ......................................................................-------
Mpf_ENSMPUP00000015159 ......................................................................-------
Mpf_ENSMPUP00000018833 ......................................................................-------
Mpf_ENSMPUP00000007866 ......................................................................-------
Mpf_ENSMPUP00000007938 ......................................................................-------
Mpf_ENSMPUP00000010694 ......................................................................-------
Mpf_ENSMPUP00000013131 ......................................................................-------
Mpf_ENSMPUP00000000312 ......................................................................-------
Mpf_ENSMPUP00000019132 ......................................................................-------
Mpf_ENSMPUP00000015959 ......................................................................-------
Mpf_ENSMPUP00000012612 ......................................................................-------
Mpf_ENSMPUP00000007938 ......................................................................-------
Mpf_ENSMPUP00000007989 ......................................................................-------
Mpf_ENSMPUP00000016156 ......................................................................-------
Mpf_ENSMPUP00000013721 ......................................................................-------
Mpf_ENSMPUP00000005447 ......................................................................-------
Mpf_ENSMPUP00000015768 ......................................................................-------
Mpf_ENSMPUP00000004215 ......................................................................-------
Mpf_ENSMPUP00000010108 ......................................................................-------
Mpf_ENSMPUP00000002188 ......................................................................-------
Mpf_ENSMPUP00000013446 ......................................................................-------
Mpf_ENSMPUP00000012407 ......................................................................-------
Mpf_ENSMPUP00000017043 ......................................................................-------
Mpf_ENSMPUP00000007898 ......................................................................-------
Mpf_ENSMPUP00000017064 ......................................................................--KQIFD
Mpf_ENSMPUP00000009754 ......................................................................-------
Mpf_ENSMPUP00000016461 ......................................................................-------
Mpf_ENSMPUP00000008230 ......................................................................-------
Mpf_ENSMPUP00000001993 ......................................................................-------
Mpf_ENSMPUP00000014500 ......................................................................-------
Mpf_ENSMPUP00000002405 ......................................................................-------
Mpf_ENSMPUP00000002933 ......................................................................-------
Mpf_ENSMPUP00000007268 ......................................................................-------
Mpf_ENSMPUP00000010983 ......................................................................-------
Mpf_ENSMPUP00000010498 ......................................................................-------
Mpf_ENSMPUP00000018101 ......................................................................-------
Mpf_ENSMPUP00000002033 ......................................................................-------
Mpf_ENSMPUP00000010694 ......................................................................-------
Mpf_ENSMPUP00000008353 ......................................................................-------
Mpf_ENSMPUP00000009754 ......................................................................-------
Mpf_ENSMPUP00000015718 ......................................................................-------
Mpf_ENSMPUP00000002358 ......................................................................-------
Mpf_ENSMPUP00000005077 ......................................................................-------
Mpf_ENSMPUP00000009107 ......................................................................-------
Mpf_ENSMPUP00000016101 ......................................................................-------
Mpf_ENSMPUP00000011911 ......................................................................-------
Mpf_ENSMPUP00000007938 ......................................................................-------
Mpf_ENSMPUP00000009676 ......................................................................HARVLQE
Mpf_ENSMPUP00000005809 ......................................................................-------
Mpf_ENSMPUP00000016410 ......................................................................-------
Mpf_ENSMPUP00000006638 ......................................................................-------
Mpf_ENSMPUP00000005803 ......................................................................-------
Mpf_ENSMPUP00000010983 ......................................................................-------
Mpf_ENSMPUP00000000717 ......................................................................-------
Mpf_ENSMPUP00000002793 ......................................................................-------
Mpf_ENSMPUP00000007833 ......................................................................-------
Mpf_ENSMPUP00000002271 ......................................................................-------
Mpf_ENSMPUP00000010974 ......................................................................-------
Mpf_ENSMPUP00000010755 ......................................................................-------
Mpf_ENSMPUP00000013112 ......................................................................-------


                        10          20         30                                       40          
                         |           |          |                                        |          
d1dbha2                IQKNID..GWEGKDIG.QCCNEFIMEGTLTRV......G..................A.......KHERHIFLF...
Mpf_ENSMPUP00000000236 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001054 ------..--------.-----------LGKW......K..................K.......EPELAAFVF...
Mpf_ENSMPUP00000001986 ------..--------.---------------......-..................-.......DLELTVFVF...
Mpf_ENSMPUP00000006133 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009494 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004093 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012215 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016175 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009909 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010977 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016638 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000018612 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000018966 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004660 ------..--------.----FVLKAGYLEKR......Rkdhsfl............Gfe.....WQKRWCALS...
Mpf_ENSMPUP00000002149 ------..--------.------ILESIFLKR......Sqqkkktspl.........N.......FKKRLFLLT...
Mpf_ENSMPUP00000018066 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017958 ------..--------.---------------......-..................Rtepi...TKDLDFQLQ...
Mpf_ENSMPUP00000011450 --A---..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016402 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004951 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011363 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015445 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015195 ------..--------.--D-NIIKQGYLEKK......Skdhsff............Gse.....WQKRWCVVS...
Mpf_ENSMPUP00000011751 WQSSIE..DWEGEDIL.VRSSELIYSGELTRV......Tqpqa..............K.......SQQRMFFLF...
Mpf_ENSMPUP00000009831 WQASVL..DWEGEDIL.DRSSELIYTGEMAWIyqpy..G..................R.......NQQRVFFLF...
Mpf_ENSMPUP00000004111 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005349 ------..--------.-------LEEILIKR......Sqqkkktspl.........N.......YKERLFVLT...
Mpf_ENSMPUP00000006137 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009095 ------..--------.-----LLKEGFMIKR......Aqgrkrfgmk.........N.......FKKRWFRLT...
Mpf_ENSMPUP00000005832 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000014567 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015198 ------..--------.--N-LILKMGPVDKR......K..................Glf.....ARRRQLLLT...
Mpf_ENSMPUP00000008441 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005146 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010667 ------..--------.---------------......-..................-.......-Q-------...
Mpf_ENSMPUP00000000642 WQVSIV..GWEGLDIL.DRSSELIHSGELTKV......Trhg...............K.......SQQRTFFLF...
Mpf_ENSMPUP00000015373 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003213 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012196 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012194 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003212 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001158 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010667 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013386 ------..--------.-------LEEQLIKK......Sqqkrrtsps.........N.......FKVRFFVLT...
Mpf_ENSMPUP00000016712 ------..--------.---------------......-..................-.......NKDLEFQLH...
Mpf_ENSMPUP00000003302 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003768 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008012 ------..--------.--------------L......-..................-.......---------...
Mpf_ENSMPUP00000002625 ------..--------.------ILEELLLKR......Sqqkkkmsps.........N.......YKERLFVLT...
Mpf_ENSMPUP00000010667 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006140 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015670 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008341 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017573 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012859 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012131 ------..--------.------LKEGEMYKR......Aqgrtrigkk.........N.......FKKRWFCLT...
Mpf_ENSMPUP00000000172 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013200 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003522 ------..------LD.LTARRMVHEGPLSWRisk...D..................K.......SLDLHVLLL...
Mpf_ENSMPUP00000011499 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011494 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012716 ------..--------.-----VLKQGYMMKK......Ghkrk..............N.......WTERWFVLK...
Mpf_ENSMPUP00000002913 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003504 ------..--------.----DVLKQGYLWKR......Ghlrr..............N.......WAERWFQLQ...
Mpf_ENSMPUP00000004361 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017389 ------..--------.---------------......-..................-.......-------LT...
Mpf_ENSMPUP00000015829 ------..--------.--------EGALRFMva....Ddaaagsg...........Gtaq....WQKCRLLLR...
Mpf_ENSMPUP00000003644 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006376 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000014536 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011501 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017670 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006727 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000000961 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004942 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002151 ------..--------.-------HMGVLVLR......Gntkintfnwakirklsf.K.......RKHFLIKLH...
Mpf_ENSMPUP00000014680 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005563 ------..-----NLD.LTKRKMIHEGPLVWKvnr...D..................K.......TIDLYTLLL...
Mpf_ENSMPUP00000011333 ------..--------.NPNAPVVRRGWLYKQ......D..................Stgmkl..WKKRWFVLS...
Mpf_ENSMPUP00000000969 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010395 IQKNID..GWEGKDIG.QCCNEFIMEGTLTRV......G..................A.......KHERHIFLF...
Mpf_ENSMPUP00000015361 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001991 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005637 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007307 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008193 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007177 ------..-----NLD.ITKKKLVHEGPLTWRvtk...D..................K.......AVEVHVLLL...
Mpf_ENSMPUP00000010360 ------..GYDG-NLS.ELG-KLLMQGSFSVW......Tdhkkghskvkdlarf...K.......PMQRHLFLH...
Mpf_ENSMPUP00000010611 ------..--------.------QMEGFLNRK......Heweahnkkassr......S.......WHNVYCVIN...
Mpf_ENSMPUP00000007161 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006134 ------..--------.---------------......-..................-.......-K-------...
Mpf_ENSMPUP00000004983 IQKNID..GWEGKDIG.QCCNEFIMEGPLTRI......G..................A.......KHERHIFLF...
Mpf_ENSMPUP00000001920 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013542 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008337 ------..--------.--QRQLQLEGPLCWK......Ttsg...............R.......LKDVLAVLL...
Mpf_ENSMPUP00000013626 ------..--------.---------------......Kvrq...............K.......KQDGALYLM...
Mpf_ENSMPUP00000001949 ------..-------G.----HADCQGWLYKK......Kekgtflsn..........K.......WKKFWVVLK...
Mpf_ENSMPUP00000017721 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001109 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001935 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006252 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005676 ------..--------.---------------......-..................-.......GKDLLLQLE...
Mpf_ENSMPUP00000005196 ------..--------.-------REGWVVHY......S..................Nkdtl...RKRHYWRLD...
Mpf_ENSMPUP00000012589 ------..--------.---------------......-..................-.......-SEYFLGLT...
Mpf_ENSMPUP00000010571 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011589 ------..--------.--SAPVTKAGWLFKQ......Ass................Gvkq....WNKRWFVLV...
Mpf_ENSMPUP00000005676 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002533 ------..--------.------VREGYLLKR......Keepaslttrf........A.......FKKRYFWLS...
Mpf_ENSMPUP00000004215 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013399 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010530 LTEAIR..SWEGDDIT.TLG-SVVYMSQVMVQ......Cag................See.....KNERYLLLF...
Mpf_ENSMPUP00000006089 ------..----VNLK.EQG-QLVRQDEFLVR......Tgr................R.......KSLRRVFLF...
Mpf_ENSMPUP00000016498 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007327 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001749 ------..-----NLN.ELG-KMIMQGAFSVW......Tghkkgatkmkdfarf...K.......PMQRHLFLY...
Mpf_ENSMPUP00000016475 ------..--------.------DREGWLLKL......G..................Grvkt...WKRRWFILT...
Mpf_ENSMPUP00000013206 ------..--------.-----VVVRGWLHKQ......D..................Ssgmrl..WKRRWFVLA...
Mpf_ENSMPUP00000006140 ------..--------.---------DTVGIW......G..................E.......GKDMYLILE...
Mpf_ENSMPUP00000005780 ------..-----ALI.SKERTLLHDGLVYWK......Tatg...............R.......FKDILALLL...
Mpf_ENSMPUP00000001869 LSEPIQ..AWEGESIK.TLGNVLFMSQVMVQY......Gtce...............E.......KEERYLLLF...
Mpf_ENSMPUP00000012475 ------..--------.-------REGWLLKL......Ag.................Grvkt...WKRRWFILT...
Mpf_ENSMPUP00000008316 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001167 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008230 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017717 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010272 ------..----VSLK.EQG-PLRCQDEFIVC......Cgr................R.......KHLRHVFLF...
Mpf_ENSMPUP00000003964 ------..--------.-------REGWLLKL......E..................Ggrvkt..WKRRWFILT...
Mpf_ENSMPUP00000017478 LQSHIE..GWEGSNLT.DICTQLLLQGTLLKI......Sag................N.......IQERAFFLF...
Mpf_ENSMPUP00000010168 ------..--------.------VKEGWMVHY......S..................Srdtl...RKRHYWRLD...
Mpf_ENSMPUP00000009546 ------..--------.--GPPLIKSGYCVKQ......Gnvrk..............S.......WKRRFFVLD...
Mpf_ENSMPUP00000002870 ------..--------.--DSAVIKAGYCVKQ......Gavmk..............N.......WKRRYFQLD...
Mpf_ENSMPUP00000000151 ------..-----DLK.EQG-QLLHRDPFTVI......Cgr................K.......KCLRHVFLF...
Mpf_ENSMPUP00000000216 IYEMLG..EEE--DIV.NPSNELIKEGQILKL......Aarnt..............S.......AQERYLFLF...
Mpf_ENSMPUP00000007012 FQLSIE..NLDQ-SLA.HYG-RPKIDGELKIT......Sverr..............S.......KMDRYAFLL...
Mpf_ENSMPUP00000012096 FQSSIE..NLQ-VKLE.EYG-RPKIDGELKVR......Sivnh..............T.......KQDRYLFLF...
Mpf_ENSMPUP00000004281 ------..-----NLD.VQG-ELILQDAFQVW......Dpkslir............K.......GRERHLFLF...
Mpf_ENSMPUP00000004460 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011499 ------..--------.--------SGNLLRKf.....Knsn...............G.......WQKLWVVFT...
Mpf_ENSMPUP00000003498 ------..--------.------HIRGWLHKQ......D..................Ssglrl..WKRRWFVLS...
Mpf_ENSMPUP00000006723 ------..--------.----SVQMEGYLGRK......Hdlegpnkkasnr......S.......WNNLYCVLR...
Mpf_ENSMPUP00000006149 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011052 ------..-----KIV.AQG-KLLLQDTFLVT......Dqdsgllp...........R.......CKERRVFLF...
Mpf_ENSMPUP00000015653 ------..--------.-LG-QPDCDGWLLLR......Kvpggfmgp..........R.......WRRCWFVLK...
Mpf_ENSMPUP00000014937 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006713 IQSLLI..NWKGPDLT.IYG-ELVLEGTFRVH......R..................V.......RNERTFFLF...
Mpf_ENSMPUP00000005370 ------..--------.------LKEGWMVHY......T..................Skdtl...RKRHYWRLD...
Mpf_ENSMPUP00000017142 ------..--------.-SGEGSAISGYLTRC......Kkg................Krh.....WKKLWFVIK...
Mpf_ENSMPUP00000011052 ------..-FDE-NIE.SQG-ELILQESFQVW......Dpktlir............K.......GRERHLFLF...
Mpf_ENSMPUP00000000930 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016865 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000000090 FQLSIE..NLNQ-PVL.LFG-RPQGDGEIRIT......Tldkh..............T.......KQERHIFLF...
Mpf_ENSMPUP00000012035 ------..--------.-------KEGWLHFR......Plitdkgkrvgg.......Sirp....WKQMYVVLR...
Mpf_ENSMPUP00000009068 ------..--------.----PVLKEGWLKRQ......Rsimk..............N.......WQQRWFVLR...
Mpf_ENSMPUP00000000172 ------..--------.-------LSGYLLRKfkns..N..................G.......WQKLWVVFT...
Mpf_ENSMPUP00000013402 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012726 ------..--------.---------------......-..................Q.......WQKCRLLLRseg
Mpf_ENSMPUP00000010329 IQSLLT..NWKGPDLT.SYG-ELVLEGTFRIQ......R..................A.......KNERTLFLF...
Mpf_ENSMPUP00000005886 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011911 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013895 IFNSLT..NCLG----.--PRKLLHSGKLYKT......K..................S.......NKELHGFLF...
Mpf_ENSMPUP00000009754 ------..--------.----PVIKAGWLDKN......Ppqg...............Syi.....YQKRWVRLD...
Mpf_ENSMPUP00000017452 ------..--------.---KKLVRDGGVFLK......Satg...............R.......LKEVQAVLL...
Mpf_ENSMPUP00000004281 ------..------LT.AQG-KLLQQDTFYVI......Eldtgmqs...........R.......TKERRVFLF...
Mpf_ENSMPUP00000017577 ------..--------.-PTHTVQHEGFLLRK......Reldanrkssnr.......S.......WVSLYCVLS...
Mpf_ENSMPUP00000004977 ------..--------.-LRRRLIHDGCLLWK......Tatg...............R.......FKDVLMLLM...
Mpf_ENSMPUP00000017884 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007027 ------..-------G.LAGESLEKSGYLLKM......G..................Srvkt...WKRRWFVLR...
Mpf_ENSMPUP00000012725 ------..--------.------SFEGTLYKR......Gallk..............G.......WKPRWFVLDvt.
Mpf_ENSMPUP00000000871 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006220 ------..--------.-----IIKQGCLLKQ......Ghrrk..............N.......WKVRKFILR...
Mpf_ENSMPUP00000008418 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003932 ------..--------.------------Q--......-..................-.......---------...
Mpf_ENSMPUP00000001861 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008418 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006249 ------..--------.----RPIKMGWLKKQ......Rsivk..............N.......WQQRYFVLR...
Mpf_ENSMPUP00000003836 ------..--------.----RPTCRGYLHKR......Thsgfvk............G.......WRKRWFVLK...
Mpf_ENSMPUP00000015858 ------..--------.-----PVKEGPLFIH......Rtkgkghlms.........S.......FKKLHFSLT...
Mpf_ENSMPUP00000002835 ------..--------.------LKGSQLLKV......K..................Snsw....RRERFYKLQ...
Mpf_ENSMPUP00000004473 VYERLG..GEE--DIV.NPANELIKEGPIQKL......Sakn...............Gt......AQDRHLFLF...
Mpf_ENSMPUP00000000137 ------..--------.--G-RGDCEGWLWKK......Kdaksyfsq..........K.......WKKYWFVLK...
Mpf_ENSMPUP00000001907 ------..-----KLT.AQG-KLLGQDTFWVT......Epeaggllss.........R.......GRERRVFLF...
Mpf_ENSMPUP00000014024 ------..--------.----TLLREGPVLKI......Sfrrs..............D.......PMERYLFLF...
Mpf_ENSMPUP00000001742 ------..--------.-----SIKEGQLLKQ......Tssfq..............R.......WKKRYFKLR...
Mpf_ENSMPUP00000000172 LQRDLV..GIE--NLI.TPGREFIREGCLHKL......Tkk................G.......LQQRMFFLF...
Mpf_ENSMPUP00000005480 ------..--------.SPAETVIKEGMLTKQ......Nnsfq..............R.......SKRRYFKLR...
Mpf_ENSMPUP00000018515 IVENCF..GAAGQPLT.IPGRVLIGEGVLTKL......Crk................K.......PKARQFFLF...
Mpf_ENSMPUP00000009502 ------..--------.------TKEGYLTKQ......G..................Glvkt...WKTRWFTLH...
Mpf_ENSMPUP00000013672 ------..--------.---------------......-..................G.......TKKGTVYLT...
Mpf_ENSMPUP00000011336 VYELLG..GEE--DIV.SPTKELIKEGHILKL......Sakn...............Gt......TQDRYLILF...
Mpf_ENSMPUP00000001410 ------..--------.-----------LKKV......Rsns...............R.......IYHRYFLLD...
Mpf_ENSMPUP00000003424 ------..--------.AQE---QMEGMLCRK......Qemeafgkkaanr......S.......WQNVYCVLR...
Mpf_ENSMPUP00000007040 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000019493 ------..--------.---QYLVYNGDLVEY......Eadhma.............Q.......LQRVHGFLM...
Mpf_ENSMPUP00000018830 AVESCF..GASGQPLA.LPGRVLLGEGVLTKE......Crk................K.......AKPRIFFLF...
Mpf_ENSMPUP00000003141 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010983 ------..--------.-----ALKQGWLHKK......Gggsstlsrr.........N.......WKKRWFVLR...
Mpf_ENSMPUP00000010498 ------..--------.---------------......-..................-.......----TLHLC...
Mpf_ENSMPUP00000012786 ------..--------.--------SGFLARKihadmdGkktprgkr..........G.......WKTFYAVLK...
Mpf_ENSMPUP00000014114 ------..--------.---SGVVMEGYLFKR......Asnaf..............Kt......WNRRWFSIQ...
Mpf_ENSMPUP00000007256 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005608 ------..-------T.ESGPPVERCGVLSKW......Tnyih..............G.......WQDRWVVLK...
Mpf_ENSMPUP00000002033 ------..--------.-----RSYEGTLYKK......Gafm...............Kp......WKARWFVLDkt.
Mpf_ENSMPUP00000016751 ------..--------.---------------......-..................-.......--------T...
Mpf_ENSMPUP00000016435 ------..--------.---------GTLMRKvr....Sk.................Sw......KKLRYFRLQ...
Mpf_ENSMPUP00000001167 ------..--------.-----VRKVGYLRKP......K..................S.......MHKRFFVLRaas
Mpf_ENSMPUP00000001585 ------..--------.-----LYFEGFLLVK......R..................Seyqe...YKHYWTELR...
Mpf_ENSMPUP00000002351 ------..-----DIK.KLG-KLLMHGSFNVW......Tvhkdrykmkdfirf....K.......PSQRQIYLF...
Mpf_ENSMPUP00000011499 LKKDLI..GID--NLV.IPGREFIRLGSLSKL......Sgk................G.......LQQRMFFLF...
Mpf_ENSMPUP00000005375 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015986 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004747 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009754 ------..--------.--P-TVSHSGFLYKT......Asagkllqdrra.......Ree.....FSRRWCVLS...
Mpf_ENSMPUP00000002257 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000006734 ------..-----SPE.ETR-QLLLEGSLRMK......Egkd...............G.......KMDVYCFLF...
Mpf_ENSMPUP00000003502 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011019 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000003673 ------..--------.-LGKDCIMHGYMSKM......Gnpflt.............Q.......WQRRYFYLF...
Mpf_ENSMPUP00000000383 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008997 ------..--------.-------KHGVLTRK......Thadmdgkrtprgrr....G.......WKKFYAVLK...
Mpf_ENSMPUP00000010040 ------..--------.---SGLLMEGHLFKR......Asnaf..............Kt......WSRRWFTIQ...
Mpf_ENSMPUP00000007257 ------..-------S.ANTEDSSMSGYLYRS......K..................Gnkkp...WKHLWFVIK...
Mpf_ENSMPUP00000016774 ------..--------.-PGAAVYKHGALVRKvha...Dpdcrktprgkr.......G.......WKSFHGILK...
Mpf_ENSMPUP00000001960 ------..--------.----DARICAFLWRK......Kwlg...............Q.......WAKQLCVIK...
Mpf_ENSMPUP00000007610 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017612 VQRRLG..GWTGPELS.AFG-ELVLEGAFRGG......Ggggprl............R.......GGERLLFLF...
Mpf_ENSMPUP00000007907 ------..--------.---------------......-..................R.......IYNRFFTLD...
Mpf_ENSMPUP00000014021 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000008982 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005803 ------..--------.----RKVKSGWLDKL......Spqg...............Krm.....FQKRWVKFD...
Mpf_ENSMPUP00000002728 ------..--------.---------------......-..................K.......GLVRLFYLD...
Mpf_ENSMPUP00000007017 ------..-------V.ELSGTVVKQGYLAKQ......Ghkrk..............N.......WKVRRFVLR...
Mpf_ENSMPUP00000003752 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001306 VFNSVT..NCLG----.--PRKFLHSGKLYKA......K..................S.......NKELYGFLF...
Mpf_ENSMPUP00000005338 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000001689 ------..------LC.SQKGGVIKQGWLHKA......Nvnstitvtm.........Kv......FKRRYFYLTqlp
Mpf_ENSMPUP00000010415 ------..--------.-------ICAFLLRK......K..................Rfgq....WSKLLCVVK...
Mpf_ENSMPUP00000006220 ------..--------.------IREGYLVKR......G..................Smfnt...WKPMWVVLL...
Mpf_ENSMPUP00000016350 ------..-------I.RPGSVVSKKGYLHFK......Eplys..............N.......WAKHFVVVR...
Mpf_ENSMPUP00000018773 ------..--------.---------------......-..................E.......LKHKAVMLR...
Mpf_ENSMPUP00000017599 ------..--------.-----VIKEGWLHKR......Geyi...............Kt......WRPRYFLLK...
Mpf_ENSMPUP00000016349 ------..-------I.RPGSVVSKKGYLHFK......Eplys..............N.......WAKHFVVVR...
Mpf_ENSMPUP00000015036 ------..--------.--------EGWLYYK......Qvltkkgkkagg.......Glrq....WKRVYAALR...
Mpf_ENSMPUP00000007938 ------..--------.---PSPLLSGWLDKL......Spq................Gnyv....FQRRFVQFN...
Mpf_ENSMPUP00000007257 IQYSLN..GHH--EIV.QPGRVFLKEGTLMKL......S..................Rkv.....MQPRVFFLF...
Mpf_ENSMPUP00000005203 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000000650 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007937 ------..--------.----NIVKKGYLLKK......Gkgk...............R.......WKNLYFILE...
Mpf_ENSMPUP00000007017 ------..--------.-----VLKEGFLVKR......Ghivh..............N.......WKARWFILR...
Mpf_ENSMPUP00000012780 ------..--------.---------GWLLKW......Tnylk..............G.......YQRRWFVLS...
Mpf_ENSMPUP00000002522 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004905 ------..--------.-------YESFLQKK......Gphdq..............D.......YKKFWAGLQ...
Mpf_ENSMPUP00000011326 ------..------LG.SQKGGITKHGWLYKG......Nmnsaisvtmr........S.......FKRRFFHLLqlg
Mpf_ENSMPUP00000009449 ------..--------.---------------......Tpwgkr.............G.......WKMFHTLLR...
Mpf_ENSMPUP00000000014 ------..--------.-------KKGWLTKQyed...G..................Q.......WKKHWFVLA...
Mpf_ENSMPUP00000012737 ------..--------.---------GWMSIL......Depg...............E.......WKKHWFVLT...
Mpf_ENSMPUP00000002136 ------..--------.-----IVKEGWLHKR......Geyi...............Kt......WRPRYFLLK...
Mpf_ENSMPUP00000017782 LQVAFP..GASDADLVpKLSRNYLKEGYMEKT......Gpkqte.............G.......FRKRWFTMD...
Mpf_ENSMPUP00000013550 ------..--------.-LGRDCIMHGYMLKL......Gnpflt.............Q.......WQRRYFYLF...
Mpf_ENSMPUP00000017362 ------..-------T.DPS-VIVMADWLKIR......Gtlk...............S.......WTKLWCVLK...
Mpf_ENSMPUP00000006996 ------..--------.-----SIMEGPLSKW......Tnvmk..............G.......WQYRWFVLD...
Mpf_ENSMPUP00000004785 ------..--------.------VCRGYLVKM......Ggkik..............S.......WKKRWFVFDrl.
Mpf_ENSMPUP00000014164 ------..--------.---RDCRICAFLLRK......K..................Rfgq....WAKQLTVIK...
Mpf_ENSMPUP00000016592 ------..--------.--GTGVFKSGWLYKG......Nfnstvnntvtvr......S.......FKKRYFQLTqlp
Mpf_ENSMPUP00000000486 ------..--------.--E-NIIKSGTLYRL......Tvqn...............N.......WKAFTFVLS...
Mpf_ENSMPUP00000003712 ------..--------.---NGIVMEGYLFKR......Asnafktwnrk........Kpd.....HIRRWFSIQ...
Mpf_ENSMPUP00000006850 ------..--------.--------RGSLVKM......G..................Grikt...WKKRWFCFD...
Mpf_ENSMPUP00000015574 ------..--------.-P-------------......-..................-.......---------...
Mpf_ENSMPUP00000014962 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016814 ------..--------.---RQLLLEGPVRVK......Egre...............G.......KLDVYLFLF...
Mpf_ENSMPUP00000000139 ------..--------.-----VSKKGYLHFL......Ephta..............G.......WAKRFVVVR...
Mpf_ENSMPUP00000012020 ------..--------.-------KAGYLNLR......S..................KtglvtttWERLYFFTQ...
Mpf_ENSMPUP00000006069 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000017142 IEHSVR..GQG--DLL.QPGREFLKEGTLMKV......Tgk................S.......RRPRHLFLM...
Mpf_ENSMPUP00000013991 ------..--------.----KILKEGPLLKN......Cnsfk..............R.......WKLRYFLVR...
Mpf_ENSMPUP00000010353 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000000014 ------..--------.--------DNPVHRS......R..................K.......WQRRFFILY...
Mpf_ENSMPUP00000009546 ------..--------.----QNRICGFLDIE......Ehensg.............K.......FLRRYFILD...
Mpf_ENSMPUP00000012020 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016751 ------..--------.---------------......-..................-.......TWDRQFYFT...
Mpf_ENSMPUP00000000216 ------..--------.--SGNSVVCSFLQYM......E..................Kskp....WQKAWCVIP...
Mpf_ENSMPUP00000010854 ------..--------.----GVAKAGYLHKK......Ggtqlqll...........K.......WPLRFVIIH...
Mpf_ENSMPUP00000016813 ------..--------.----NMKHSGYLWAI......Gknvwk.............R.......WKKRFFVLVqvs
Mpf_ENSMPUP00000002870 ------..--------.----QNRICGFLDIE......Enensg.............K.......FLRRYFILDtr.
Mpf_ENSMPUP00000003651 ------..--------.-------KEGYLQKA......Kiadggkklrk........N.......WSTSWIVLS...
Mpf_ENSMPUP00000002370 WQSHIE..GWEDLNII.ALCYKLSLHSFMLNLv.....S..................Hfp.....FEERLIFLI...
Mpf_ENSMPUP00000006780 ------..--------.-----MKHSGYLYAL......Gqkvwk.............R.......WKKRYFVLVqvs
Mpf_ENSMPUP00000002802 --FMCN..NPEKATVV.NQDGQPLIEGKLKEK......Qvrwkfik...........R.......WKTRYFTLA...
Mpf_ENSMPUP00000011336 ------..--------.-------ICSFLHYM......Ekggk..............G.......WHKAWFVVP...
Mpf_ENSMPUP00000003120 ------..--------.-------MEGVLYKW......Tnylt..............G.......WQPRWFVLD...
Mpf_ENSMPUP00000005803 ------..--------.---------------......-..................-.......--KKWCVLE...
Mpf_ENSMPUP00000004980 ------..--------.-------MEGVLYKW......Tnyls..............G.......WQPRWFLLC...
Mpf_ENSMPUP00000015621 ------..--------.----TVVKEGWVQKR......Geyik..............N.......WRPRYFLLK...
Mpf_ENSMPUP00000003141 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013099 ------..--------.-------RNGNLYKK......Sdgi...............Rkv.....WQKRKCSVK...
Mpf_ENSMPUP00000010983 ------..--------.----EFIVRGWLHKEvk....Nspkmssl...........K.......LKKRWFVLT...
Mpf_ENSMPUP00000004910 ------..--------.----VVIMADSLKIR......Gtlk...............S.......WTKLWCVLK...
Mpf_ENSMPUP00000016233 ------..--------.---------------......-..................G.......TKRGTVFLT...
Mpf_ENSMPUP00000002953 ------..--------.---------------......-..................E.......VHKRWWQLR...
Mpf_ENSMPUP00000011716 ------..--------.-----FVKSGWLLRQ......Stilk..............R.......WKKNWFDLW...
Mpf_ENSMPUP00000007767 ------..--------.---------GFLTIF......Edvsgfg............A.......WHRRWCVLS...
Mpf_ENSMPUP00000014585 ------..--------.---RKYLKQGFMEKT......Gpkq...............Kep.....FKKRWFVLD...
Mpf_ENSMPUP00000014164 ------..--------.---EEVPCCGYLNVLv.....Nq.................G.......WKERWCRLK...
Mpf_ENSMPUP00000005886 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013797 ------..--------.---------------......H..................Sqd.....VSDCYLELF...
Mpf_ENSMPUP00000004108 ------..--------.--------YGYLMKY......Tnlvt..............G.......WQYRFFVLN...
Mpf_ENSMPUP00000009167 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016226 ------..--------.----VITKEGMLHYK......Agtsylgke..........H.......WKTCFVVLS...
Mpf_ENSMPUP00000014024 ------..--------.------IMCGFLQLV......Gdkwgk.............S.......GPRGWCVIP...
Mpf_ENSMPUP00000008448 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010607 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015774 ------..--------.-------KVGFLYKK......Sdgi...............Rrv.....WQKRKCGVK...
Mpf_ENSMPUP00000008639 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012941 ------..--------.-------------VT......Kitengkkvrk........N.......WLSSWAVLQ...
Mpf_ENSMPUP00000016218 ------..--------.-----LLCHGELKNK......S..................G.......-HKLYIFLF...
Mpf_ENSMPUP00000007001 ---KIEf.ECKIFPLI.SQSRWLVKSGELTAL......Efslspglrrkl.......N.......TRPVHLHLF...
Mpf_ENSMPUP00000001986 ------..--------.---------------......Kekklelvarr........K.......WKQYWVTLK...
Mpf_ENSMPUP00000010415 ------..--------.--------CGYLNVL......Sns................R.......WRERWCRVK...
Mpf_ENSMPUP00000003836 ------..--------.-------CLGLLHQS......Dgstd..............R.......WVQHYCILK...
Mpf_ENSMPUP00000007027 ------..--------.--GSKPTVKGWLTKV......Khg................H.......SKLVWCALV...
Mpf_ENSMPUP00000002688 ------..KIKPFPLV.SSSRWLVKRGELTAYve....Dtvlfsrrt..........S.......KQQVYFFLF...
Mpf_ENSMPUP00000001373 ------..--------.------EKKGYLLKK......Sdgl...............Rkv.....WQRRKCAVK...
Mpf_ENSMPUP00000013700 ------..--------.---RQLVKDGFLVEV......Ses................S.......RKLRHVFLF...
Mpf_ENSMPUP00000016589 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015325 ------..--------.-------RKGYLSKR......Ssdnt..............K.......WQTKWFALL...
Mpf_ENSMPUP00000001960 ------..--------.----------YLNVLvn....S..................Q.......WKSRWCSVR...
Mpf_ENSMPUP00000006310 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016747 ------..-----SLI.DNSRVLCCHGELKNN......-..................R.......GVKLHVFLF...
Mpf_ENSMPUP00000013323 SWEVVE..GLRG-EMS.YTQEPAIQKGFLLKK......Rkwplk.............G.......WHKRFFYLD...
Mpf_ENSMPUP00000007350 ------..--------.--STKVQLYGVLWKR......Pfgrpsa............K.......WSRRFFIIK...
Mpf_ENSMPUP00000017588 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007745 ------..--------.---------------......-..................-.......---WYCRLS...
Mpf_ENSMPUP00000006409 ------..--------.-------LCGYLSKF......Ggkgpir............G.......WKSRWFFYD...
Mpf_ENSMPUP00000015574 ------..--------.-----VRLCGHLRKQ......K..................S.......QRRRFFVLR...
Mpf_ENSMPUP00000008365 ------..--------.---------GVLHRT......Ktvdkgkrlrkk.......H.......WSASWTVLE...
Mpf_ENSMPUP00000001054 ------..--------.---------------......-..................K.......WKHYWVSLK...
Mpf_ENSMPUP00000017488 ------..--------.-------KIGNRRRQ......E..................R.......FWYCRLALN...
Mpf_ENSMPUP00000005234 IQKKMEf.KIKSVPII.SHSRWLLKQGELQQM......Sgpktsrtlrt........Kkl.....FREIYLFLF...
Mpf_ENSMPUP00000013182 ------..--------.---------------......K..................G.......YRQHWVVFK...
Mpf_ENSMPUP00000011513 ------..--------.--NEPLEKSGYLLKM......S..................Grvkt...WKRRWFVLK...
Mpf_ENSMPUP00000005385 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009077 ------..--------.---------------......-..................-.......-----VLLF...
Mpf_ENSMPUP00000001767 LHSNID..AID-----.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007827 ------..--------.------TMEGYLYVQ......Ekrhfgt............S.......WVKHYCTYQ...
Mpf_ENSMPUP00000000541 ------..--------.-------KAGWIKKS......S..................Ggllgf..WKDRYLLLC...
Mpf_ENSMPUP00000001809 ------..--------.-------KSGLLNVT......Kiaqggrklrk........N.......WSSSWVVLA...
Mpf_ENSMPUP00000005803 ------..--------.-----SIKEGMLKIK......Eepskilsgn.........K.......FQDRYFVLR...
Mpf_ENSMPUP00000013182 --S---..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005315 ------..--------.-PSAPPEKVGWVRKF......C..................GkgifreiWKNRYVVLK...
Mpf_ENSMPUP00000014585 ------..--------.-------REGFLWKR......G..................Rdnaq...FLRRKFVLLak.
Mpf_ENSMPUP00000015166 ------..--------.-------KEGHLLKK......Rkwplk.............G.......WHKRYFVLE...
Mpf_ENSMPUP00000002409 ------..------I-.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005807 ------..--------.------IRRGWLTIN......Nislmkg............G.......SKEYWFVLT...
Mpf_ENSMPUP00000013796 ------..--------.------------KLQ......Hlpsq..............E.......QQDRLLVLY...
Mpf_ENSMPUP00000017782 ------..--------.------YREGFLWKR......Grdn...............Gq......FLSRKFVLT...
Mpf_ENSMPUP00000019464 ------..--------.-------HTGFLRTW......Ggpgtaptps.........Gt......GRRCWFVLK...
Mpf_ENSMPUP00000012725 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010996 ------..--------.----------FLNQQ......Qmeenli............S.......WRRLYCVLR...
Mpf_ENSMPUP00000007938 ------..--------.------PRVGLLRCR......Eepprllgn..........R.......FQERFFLLR...
Mpf_ENSMPUP00000009654 ------..--------.-------RGGWLWRQ......Ssilr..............R.......WKRNWFALWl..
Mpf_ENSMPUP00000005385 ------..--------.---------------......K..................G.......YKQYWCTFK...
Mpf_ENSMPUP00000006310 ------..--------.---------------......K..................A.......FKQYWFIFK...
Mpf_ENSMPUP00000007963 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002310 ------..--------.----IPIKQGMLLKR......Sgksln.............Ke......WKKKYVTLC...
Mpf_ENSMPUP00000000486 ------..--------.----NILKKGYLEIR......Kdhd...............Sy......WQSCYAELS...
Mpf_ENSMPUP00000007805 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010246 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004460 ------..--------.-----IVKQGYVKMK......S..................Rklgi...YRRCWLVFRkss
Mpf_ENSMPUP00000014791 ------..--------.---------------......-..................-.......TRDLSLFLF...
Mpf_ENSMPUP00000003154 ------..--------.-------HEGFMLKK......Rkwplk.............G.......WHKRFFVLD...
Mpf_ENSMPUP00000005214 VQALLS..GRQA-KGL.TSGRWFLRQGWLLVV......Pphg...............E.......PRPRMFFLF...
Mpf_ENSMPUP00000003932 ------..--------.-----VCKRGYLRKQ......K..................H.......GHRRYFVLKlet
Mpf_ENSMPUP00000008710 ------..------IG.SGRAIPIKQGVLLKR......Sgksln.............Ke......WKKKYVTLC...
Mpf_ENSMPUP00000005632 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002828 ------..--------.--HRQLLKDSFMVELve....G..................A.......RKLRHVFLF...
Mpf_ENSMPUP00000017859 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013754 ------..--------.-----PTMEGPLRRK......Tllkegrrpals.......S.......WTRYWVILS...
Mpf_ENSMPUP00000004548 ------..--------.--G-QPTIEGYLYTQ......Ekwalgi............S.......WVKYYCQYE...
Mpf_ENSMPUP00000000646 ------..--------.---------------......-..................-.......--------T...
Mpf_ENSMPUP00000004473 ------..--------.--------CSSLQVS......D..................Sgvv....WSEVWATIP...
Mpf_ENSMPUP00000000402 ------..--------.-------IEGVLWLK......Ddgkk..............S.......WKKRYFLLR...
Mpf_ENSMPUP00000007412 LHARLDfgRVKSLPLI.SASRWLLKRGELFVV......Eetrlfrkla.........S.......RPTCYLFLF...
Mpf_ENSMPUP00000004935 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000011513 ------..--------.---------------......-..................Y.......SKRVWCTLI...
Mpf_ENSMPUP00000001759 ------..--------.----QWTMEGYLYVQ......E..................Krplgft.WIKHYCTYD...
Mpf_ENSMPUP00000008353 ------..--------.-PFRGLMKLGTVERR......Gam................Gi......WKELFCELS...
Mpf_ENSMPUP00000012083 ------..--------.-------LEGALYLK......Edgkk..............S.......WKRRYFLLR...
Mpf_ENSMPUP00000006956 ------..--------.----QFTAEGYLYVQ......Ekrpapfgs..........S.......WVKHYC---...
Mpf_ENSMPUP00000014860 ------..--------.-------IQGFLQLR......G..................Sgrkl...WKRFFCFLR...
Mpf_ENSMPUP00000009647 ------..GKK-PVLS.LPHRRLVCCCQLYEV......Pdpnrpqrl..........G.......LHQREVFLF...
Mpf_ENSMPUP00000005803 ------..--------.-----PEKCGYLELR......G..................Y.......KAKIFTVLS...
Mpf_ENSMPUP00000005109 ------..--------.-------IQGVLRRK......Tllkegkkptva.......S.......WTKYWAALC...
Mpf_ENSMPUP00000006149 ------..--------.---------------......-..................-.......-----LVFKkas
Mpf_ENSMPUP00000001981 ------..--------.----IPIKQSFLLKR......Sgnsln.............Ke......WKKKYVTLS...
Mpf_ENSMPUP00000017916 VEKSIV..GMKT-VLS.VPHRRLVCCSRLFEV......Tdvnklqkq..........A.......AHQREVFLF...
Mpf_ENSMPUP00000003318 ------..--------.--SRTLLIDGRVELK......R..................Glq.....RQERHLFLF...
Mpf_ENSMPUP00000017175 ------..------LS.LPHRRLVCYCRLFEV......Pdpnkpqkl..........G.......LHQREIFLF...
Mpf_ENSMPUP00000016038 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000016192 ------..-----PLI.SQARWLVRHGELVEL......Aplpaappaklkl......S.......SKAVYLHLF...
Mpf_ENSMPUP00000015325 IERMIIe.GCE--ILL.DTSQTFVRQGSLIQV......PmsekgkitrgrlgslslkK.......EGERQCFLF...
Mpf_ENSMPUP00000000660 ------..--------.----YPEIHGFLHAK......Eqgkk..............S.......WKKIYFLLR...
Mpf_ENSMPUP00000005493 --E---..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009754 ------..--------.---------------......Sllglglpsg.........G.......FHDRYFILN...
Mpf_ENSMPUP00000013796 ------..--------.---------------......H..................Sqd.....VSDCYLELF...
Mpf_ENSMPUP00000010667 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013126 ------..--------.------IRKGWLTIN......Nigimkg............G.......SKEYWFVLT...
Mpf_ENSMPUP00000018046 ------..--------.----CPEIQGFLHVK......Elgrk..............S.......WRKLYVCLR...
Mpf_ENSMPUP00000006359 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015086 ---LII..HCKDLRVF.H--------------......-..................-.......---------...
Mpf_ENSMPUP00000008387 IERMIVe.GCD--ILL.DTSQTFIRQGSLIQV......PsvergklskvrlgslslkK.......EGERQCFLF...
Mpf_ENSMPUP00000015207 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000004217 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015689 ------..--------.A--------------......-..................-.......---------...
Mpf_ENSMPUP00000015159 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000018833 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007866 ------..--------.--------SGTLRVQ......Qagelq.............D.......WARVHGVLK...
Mpf_ENSMPUP00000007938 ------..--------.----RPLRTGMLELR......G..................H.......KAKVFAALS...
Mpf_ENSMPUP00000010694 ------..--------.---------------......-..................R.......WEKRWCD--...
Mpf_ENSMPUP00000013131 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000000312 ------..--------.---------------......-..................-.......--VNWFILF...
Mpf_ENSMPUP00000019132 ------..--------.----TVLKEGVLEKR......S..................Ggllql..WKRKRCVLT...
Mpf_ENSMPUP00000015959 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000012612 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000007938 ------..--------.---------------......-..................-.......PPRLWCVLR...
Mpf_ENSMPUP00000007989 ------..KVKALPLV.SWSRRLELQGELTEL......Gcrrggvlftsrp......R.......FTPLCLLLF...
Mpf_ENSMPUP00000016156 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013721 ------..--------.---------------......-..................-.......PHNYGLVLY...
Mpf_ENSMPUP00000005447 ------..--------.------RIEGWLSIP......Nrgnikry...........G.......WKKQYVVVS...
Mpf_ENSMPUP00000015768 ------..--------.--------RGPLTQL......Gghpp..............R.......WQPIFCVLR...
Mpf_ENSMPUP00000004215 ------..--------.------VKQGFLYLL......Qqqtfgk............K.......WRRFGAVLY...
Mpf_ENSMPUP00000010108 ------..--------.---------------......-..................-.......PRRAWFVLT...
Mpf_ENSMPUP00000002188 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000013446 ------..--------.-------LEGWLSLPvr....Nntkkf.............G.......WVKKYVIVS...
Mpf_ENSMPUP00000012407 ------..--------.------AYEGFLSVP......Rpsgvrr............G.......WQRVFAALS...
Mpf_ENSMPUP00000017043 ------..--------.---------GMIMKR......SgghripglnccgqgracyR.......WSKRWLIVK...
Mpf_ENSMPUP00000007898 ------..----LDLC.NPARTLLLSEELLLY......Eg.................R.......NKAIEVTLFay.
Mpf_ENSMPUP00000017064 VVYEVD..GCPA-NLL.SSHRSLVQRVETISL......Gehpcd.............R.......GEQVTLFLF...
Mpf_ENSMPUP00000009754 ------..--------.--------AGSLELR......G..................F.......KNKLYVAVV...
Mpf_ENSMPUP00000016461 ------..--------.------VKTGALQWW......Cdwkph.............K.......WVDVCVALEqft
Mpf_ENSMPUP00000008230 ------..--------.------VMEGPLFLQ......Sqrfgtk............R.......WRKTWAVLY...
Mpf_ENSMPUP00000001993 ------..--------.----EVCKQDYFIKS......Pppqlffsas.........S.......WKRRYFILS...
Mpf_ENSMPUP00000014500 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002405 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002933 ------..-----QSK.EPSSGLHLEGWMKVP......Rnnkrgqq...........G.......WDRKYIVLE...
Mpf_ENSMPUP00000007268 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010983 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010498 ------..--------.--------EGQVKLR......Dgk................K.......WKTRWLVLR...
Mpf_ENSMPUP00000018101 ------..--------.---------------......Kkagark............G.......WQRALAVVC...
Mpf_ENSMPUP00000002033 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010694 ------..--------.---------------......-..................-.......YSPTFLALR...
Mpf_ENSMPUP00000008353 ------..--------.------IKESLLYLY......Td.................Rt......WMPYIFSLS...
Mpf_ENSMPUP00000009754 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000015718 ------..--------.---------GHVRIP......Kpagvkk............G.......WQRALAVVC...
Mpf_ENSMPUP00000002358 ------..--------.------------KVP......Kptgvkk............G.......WQRAYAVVC...
Mpf_ENSMPUP00000005077 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000009107 ------..--------.-------MEGFLEFQ......Qqlwsaqrqpcl.......Sl......WDGCHGTLR...
Mpf_ENSMPUP00000016101 ------..--------.---RQLLLCETLTETvy....Gdrgqli............K.......SKERRVFLL...
Mpf_ENSMPUP00000011911 ------..--------.----TPVKDGILYQQ......Hikfgkk............S.......WRKVWGLLY...
Mpf_ENSMPUP00000007938 ------..--------.------LRLGRLWLR......Spthsalap..........Gl......WLSGFGLLR...
Mpf_ENSMPUP00000009676 IEAHIE..GME--DLQ.APLRRFLRQEMVIEV......Kavg...............G.......KKDRSLFLF...
Mpf_ENSMPUP00000005809 ------..--------.-------YEGPLWKS......Srff...............G.......WRLFWVVLE...
Mpf_ENSMPUP00000016410 ------..--------.---------------......N..................R.......WTRRQVILC...
Mpf_ENSMPUP00000006638 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000005803 ------..--------.---------GQLYYK......Dchald.............Q.......WRKGWFSME...
Mpf_ENSMPUP00000010983 ------..--------.-------FHSFLYMK......Gglmn..............S.......WKRRWCVLK...
Mpf_ENSMPUP00000000717 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000002793 ------..--------.---------------......-..................-.......TKERRVFLL...
Mpf_ENSMPUP00000007833 ------..--------.----RILLSGIYNVR......Kgktqlh............K.......WAERLVVLC...
Mpf_ENSMPUP00000002271 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010974 ------..--------.---------------......-..................-.......---------...
Mpf_ENSMPUP00000010755 ------..--------.-----LTCCGRDQVC......Y..................R.......WSKRWLVVK...
Mpf_ENSMPUP00000013112 ------..--------.---------------......-..................-.......---------...


                                     50          60                                  70             
                                      |           |                                   |             
d1dbha2                ......DG.......LMICC..KSNHGQP........................RLPGASN..AE.............
Mpf_ENSMPUP00000000236 ......--.......-----..-------........................--PLERG..FI.............
Mpf_ENSMPUP00000001054 ......KTa......VVLVY..KDGSKQKkklvgshr................LSIYEDW..DP.............
Mpf_ENSMPUP00000001986 ......KRa......VILVY..KENCKLKkklpsnsrp...............AHNSADL..DP.............
Mpf_ENSMPUP00000006133 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009494 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004093 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012215 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016175 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009909 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010977 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016638 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000018612 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000018966 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004660 ......KT.......VFYYY..GSDKDKQ........................Q------..--.............
Mpf_ENSMPUP00000002149 ......VH.......KLSYY..EYDFE--........................-----RG..RR.............
Mpf_ENSMPUP00000018066 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017958 ......DP.......FLLY-..-------........................-------..--.............
Mpf_ENSMPUP00000011450 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016402 ......--.......-----..-------........................-----NQ..RK.............
Mpf_ENSMPUP00000004951 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011363 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015445 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015195 ......RG.......LFYYY..ANEKSKQ........................P------..--.............
Mpf_ENSMPUP00000011751 ......DH.......QLIYC..KK-----........................--DLLRR..DV.............
Mpf_ENSMPUP00000009831 ......DH.......QMVLC..KK-----........................--DLIRR..DI.............
Mpf_ENSMPUP00000004111 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005349 ......KS.......MLTYY..EGRPEKK........................YR-----..--.............
Mpf_ENSMPUP00000006137 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009095 ......NH.......EFTYQ..RSKGDQP........................-------..--.............
Mpf_ENSMPUP00000005832 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000014567 ......--.......-----..----KVF........................-------..--.............
Mpf_ENSMPUP00000015198 ......EGp......HLYYV..DPVNKVL........................-------..--.............
Mpf_ENSMPUP00000008441 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005146 ......--.......-----..-------........................---YEKD..DK.............
Mpf_ENSMPUP00000010667 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000000642 ......DH.......QLVSC..KK-----........................--DLLRR..DV.............
Mpf_ENSMPUP00000015373 ......--.......-----..---R---........................-------..--.............
Mpf_ENSMPUP00000003213 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012196 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012194 ......--.......-----..----K--........................-------..--.............
Mpf_ENSMPUP00000003212 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001158 ......--.......-----..-------........................------N..DR.............
Mpf_ENSMPUP00000010667 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013386 ......KT.......SLAYF..ENR----........................-----QG..KK.............
Mpf_ENSMPUP00000016712 ......EP.......FLLY-..-------........................-------..--.............
Mpf_ENSMPUP00000003302 ......--.......-----..-------........................-----HD..DK.............
Mpf_ENSMPUP00000003768 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008012 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002625 ......KT.......NLSYY..EYDKMKR........................G------..--.............
Mpf_ENSMPUP00000010667 ......--.......-----..-N-----........................-------..--.............
Mpf_ENSMPUP00000006140 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015670 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008341 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017573 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012859 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012131 ......SR.......ELTYH..KQPGSKD........................A------..--.............
Mpf_ENSMPUP00000000172 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013200 ......--.......-LHIY..DPENRL-........................-------..--.............
Mpf_ENSMPUP00000003522 ......ED.......LLVLL..QRQDEKLllkchsk.................TAAGSSD..SK.............
Mpf_ENSMPUP00000011499 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011494 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012716 ......PN.......IISYY..VSEDLKD........................K------..--.............
Mpf_ENSMPUP00000002913 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000003504 ......PS.......SLCYF..GSEECKE........................K------..--.............
Mpf_ENSMPUP00000004361 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017389 ......DT.......ELILY..TRKRDSV........................K------..--.............
Mpf_ENSMPUP00000015829 ......RAvagerf.RLEFF..VPPKASR........................P------..--.............
Mpf_ENSMPUP00000003644 ......--.......--Q--..-------........................-------..--.............
Mpf_ENSMPUP00000006376 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000014536 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011501 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017670 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000006727 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000000961 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004942 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002151 ......AN.......ILVLC..KDTLEFT........................-------..--.............
Mpf_ENSMPUP00000014680 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005563 ......ED.......ILVLL..QKQDDRLvlrchsk.................ILASTAD..SK.............
Mpf_ENSMPUP00000011333 ......DL.......CLFYY..RDEKEEG........................I------..--.............
Mpf_ENSMPUP00000000969 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010395 ......DG.......LMICC..KSNHGQP........................RLPGASN..AE.............
Mpf_ENSMPUP00000015361 ......--.......---VY..KD-----........................-------..--.............
Mpf_ENSMPUP00000001991 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005637 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007307 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008193 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007177 ......DD.......LLLLL..QRQDERLllkshsr.................TLTPTPD..GK.............
Mpf_ENSMPUP00000010360 ......EK.......AVLFC..KRREESG........................E-GYEKA..PS.............
Mpf_ENSMPUP00000010611 ......NQ.......EMGFY..KDAKTAA........................-----SG..IP.............
Mpf_ENSMPUP00000007161 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000006134 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004983 ......DG.......LMISC..KPNHSQS........................RLPGYSS..AE.............
Mpf_ENSMPUP00000001920 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013542 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008337 ......TD.......VLLLL..QEKDQKY........................VFASVDS..K-.............
Mpf_ENSMPUP00000013626 ......AE.......RIAWA..PE-----........................-----GK..DR.............
Mpf_ENSMPUP00000001949 ......GT.......SLYWY..SNQMAEK........................A------..--.............
Mpf_ENSMPUP00000017721 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001109 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001935 ......--.......-----..-------........................-SLSGGP..EF.............
Mpf_ENSMPUP00000006252 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005676 ......DE.......TLKLV..EPQSQAL........................-------..--.............
Mpf_ENSMPUP00000005196 ......CK.......CITLF..QNNTTNR........................-------..--.............
Mpf_ENSMPUP00000012589 ......PV.......GVVVY..KNKKQVG........................KYFWPRI..TK.............
Mpf_ENSMPUP00000010571 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011589 ......DR.......CLFYY..KDEKEES........................I------..--.............
Mpf_ENSMPUP00000005676 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002533 ......GE.......ALSYS..KSPEWQM........................-------..--.............
Mpf_ENSMPUP00000004215 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013399 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010530 ......PN.......ILLM-..-------........................LSASPRM..SG.............
Mpf_ENSMPUP00000006089 ......EE.......LLLFS..KPRRGPT........................-----GT..DT.............
Mpf_ENSMPUP00000016498 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007327 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001749 ......EK.......AIVFC..KRRVESG........................-EGSDRY..PS.............
Mpf_ENSMPUP00000016475 ......DN.......CLYYF..EYTTDKE........................P------..--.............
Mpf_ENSMPUP00000013206 ......DY.......CLFYY..KDSREEA........................V------..--.............
Mpf_ENSMPUP00000006140 ......ND.......TLSLV..DPMDRSV........................-------..--.............
Mpf_ENSMPUP00000005780 ......TD.......VLLFL..QEKDQKY........................IFAAVDQ..K-.............
Mpf_ENSMPUP00000001869 ......SS.......VLIM-..-------........................LSASPRM..SG.............
Mpf_ENSMPUP00000012475 ......DN.......CLYYF..EYTTDKE........................P------..--.............
Mpf_ENSMPUP00000008316 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001167 ......--.......-----..-------........................A------..--.............
Mpf_ENSMPUP00000008230 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017717 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010272 ......ED.......LILFS..KTRKVEG........................-----GY..DT.............
Mpf_ENSMPUP00000003964 ......DN.......CLYYF..EYTTDKE........................P------..--.............
Mpf_ENSMPUP00000017478 ......DN.......LLVYC..KRKSRVTgskkstk.................RTKSING..SL.............
Mpf_ENSMPUP00000010168 ......SK.......CLTLF..QNESGSK........................Y------..--.............
Mpf_ENSMPUP00000009546 ......DF.......TISYF..KCEQDRE........................P------..--.............
Mpf_ENSMPUP00000002870 ......EN.......TIGYF..KSELEKE........................P------..--.............
Mpf_ENSMPUP00000000151 ......EH.......LLLFS..KLKGPEG........................-----GS..ET.............
Mpf_ENSMPUP00000000216 ......NN.......MLLYC..VPR----........................--FSLVG..SK.............
Mpf_ENSMPUP00000007012 ......DK.......ALLIC..KR-----........................-----RG..DS.............
Mpf_ENSMPUP00000012096 ......DK.......VVIVC..KR-----........................-----RG..YS.............
Mpf_ENSMPUP00000004281 ......EI.......SLVFS..KEIKDSS........................-----GH..TK.............
Mpf_ENSMPUP00000004460 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011499 ......NF.......CLFFY..KSHQDNH........................P------..--.............
Mpf_ENSMPUP00000003498 ......GH.......CLFYY..KDSREES........................V------..--.............
Mpf_ENSMPUP00000006723 ......NS.......ELTFY..KDAKNLA........................L-----G..VP.............
Mpf_ENSMPUP00000006149 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011052 ......EQ.......IVIFS..EPLDKKK........................GF---SM..PG.............
Mpf_ENSMPUP00000015653 ......RH.......TLYWY..RQPQDEK........................A------..--.............
Mpf_ENSMPUP00000014937 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000006713 ......DK.......ALLIT..KK-----........................-----RG..DH.............
Mpf_ENSMPUP00000005370 ......SK.......CITLF..QNDTGSR........................Y------..--.............
Mpf_ENSMPUP00000017142 ......GK.......VLYTY..MASEDTV........................A------..--.............
Mpf_ENSMPUP00000011052 ......EM.......SLVFS..KEVKDSS........................-----GR..SK.............
Mpf_ENSMPUP00000000930 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016865 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000000090 ......DL.......AVIVC..KR-----........................-----KG..DN.............
Mpf_ENSMPUP00000012035 ......GH.......SLYLY..KDKREQT........................T------..-P.............
Mpf_ENSMPUP00000009068 ......GD.......QLFYY..KDKDETK........................P------..--.............
Mpf_ENSMPUP00000000172 ......NF.......CLFFY..KTHQDDY........................P------..--.............
Mpf_ENSMPUP00000013402 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012726 ..egggGS.......RLEFF..VPPKASR........................P------..--.............
Mpf_ENSMPUP00000010329 ......DK.......LLLIT..KK-----........................-----RD..DT.............
Mpf_ENSMPUP00000005886 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011911 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013895 ......ND.......FLLLT..YMVKQFAvssgsekl................FSSKSNA..QF.............
Mpf_ENSMPUP00000009754 ......AD.......HLRYF..DSNKDAY........................S------..--.............
Mpf_ENSMPUP00000017452 ......TD.......ILVFL..QEKDQKY........................VFASLDQ..K-.............
Mpf_ENSMPUP00000004281 ......EQ.......IVIFS..ELLRKGS........................-----LT..PG.............
Mpf_ENSMPUP00000017577 ......KG.......ELGFY..KDAKGPA........................-----SR..GT.............
Mpf_ENSMPUP00000004977 ......TD.......VLLFL..QEKDQKY........................IFPALDK..--.............
Mpf_ENSMPUP00000017884 ......--.......-----..-------........................-----DQ..KN.............
Mpf_ENSMPUP00000007027 ......QG.......QIMYY..KSPSDVI........................-------..--.............
Mpf_ENSMPUP00000012725 ......KH.......QLRYY..DSGEDTN........................C------..--.............
Mpf_ENSMPUP00000000871 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000006220 ......EDpa.....YLHYY..DPAGGED........................P------..--.............
Mpf_ENSMPUP00000008418 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000003932 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001861 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008418 ......-N.......MLMIL..KKDA---........................-MSLVNP..LD.............
Mpf_ENSMPUP00000006249 ......AQ.......QLFFY..KDEEDTK........................P------..--.............
Mpf_ENSMPUP00000003836 ......HDg......CLHYY..RHKKDE-........................-------..GK.............
Mpf_ENSMPUP00000015858 ......TE.......ALSFA..KTPSSKK........................-------..--.............
Mpf_ENSMPUP00000002835 ......ED.......CKTIW..QESRKVM........................R-----T..PE.............
Mpf_ENSMPUP00000004473 ......NS.......MILYC..VPK----........................--LRLMG..QK.............
Mpf_ENSMPUP00000000137 ......DA.......SLYWY..INEEDEK........................A------..--.............
Mpf_ENSMPUP00000001907 ......EQ.......IVIFS..EALGGGV........................R--GGSQ..AG.............
Mpf_ENSMPUP00000014024 ......NN.......MLLYC..IPK----........................--VIQVG..AQ.............
Mpf_ENSMPUP00000001742 ......GR.......TLYYA..KDSKSLI........................-------..--.............
Mpf_ENSMPUP00000000172 ......SD.......MLLYT..SK-----........................--GVTGS..SH.............
Mpf_ENSMPUP00000005480 ......GR.......TLYYA..KTAKSII........................-------..--.............
Mpf_ENSMPUP00000018515 ......ND.......ILVY-..-------........................GNIVIQK..KK.............
Mpf_ENSMPUP00000009502 ......RN.......ELKYF..KDQMSPE........................P------..--.............
Mpf_ENSMPUP00000013672 ......PY.......RIIFL..SKGRDAM........................QSF----..--.............
Mpf_ENSMPUP00000011336 ......ND.......RLLYC..VPR----........................--LRLLG..QK.............
Mpf_ENSMPUP00000001410 ......ADmq.....SLRWE..PSKKDSE........................-------..--.............
Mpf_ENSMPUP00000003424 ......RG.......SLGFY..KDAKAAS........................-----AG..VP.............
Mpf_ENSMPUP00000007040 ......P-.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000019493 ......ND.......CLLVA..TWL----........................---PQRR..GM.............
Mpf_ENSMPUP00000018830 ......ND.......ILVY-..-------........................GSVVLPK..RK.............
Mpf_ENSMPUP00000003141 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010983 ......QS.......RLMYF..ENDSEDK........................L------..--.............
Mpf_ENSMPUP00000010498 ......ND.......VLVLA..RDVPPAV........................-------..--.............
Mpf_ENSMPUP00000012786 ......GT.......VLYLQ..KDEYKPE........................K----AL..SE.............
Mpf_ENSMPUP00000014114 ......NS.......QLVYQ..KKVKDAL........................T------..--.............
Mpf_ENSMPUP00000007256 ......--.......-----..K------........................-------..--.............
Mpf_ENSMPUP00000005608 ......NN.......TLSYY..KSE----........................-----DE..TE.............
Mpf_ENSMPUP00000002033 ......KH.......QLRYY..DHRVDTE........................C------..--.............
Mpf_ENSMPUP00000016751 ......CD.......CLKLI..DPQTQVT........................-------..--.............
Mpf_ENSMPUP00000016435 ......DD.......GMTVW..HARQAGS........................-------..--.............
Mpf_ENSMPUP00000001167 ..eaggPA.......RLEYY..ENEKKW-........................-----RH..KS.............
Mpf_ENSMPUP00000001585 ......GT.......TLFFY..SDKKSPT........................Y------..--.............
Mpf_ENSMPUP00000002351 ......ER.......GIVFC..KIR----........................MEPSDQGlaPH.............
Mpf_ENSMPUP00000011499 ......ND.......VLLYT..SR-----........................--GLTAS..NQ.............
Mpf_ENSMPUP00000005375 ......N-.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015986 ......G-.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004747 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009754 ......DG.......VLSYY..ENERAVT........................P------..--.............
Mpf_ENSMPUP00000002257 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000006734 ......TD.......LLLVT..KAVKKAE........................-------..RT.............
Mpf_ENSMPUP00000003502 ......--.......---IL..KKKKKKK........................EWTWDES..KM.............
Mpf_ENSMPUP00000011019 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000003673 ......PN.......RLEW-..-------........................-----RG..EG.............
Mpf_ENSMPUP00000000383 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008997 ......GT.......ILYLQ..KDE----........................YRPDKAL..SE.............
Mpf_ENSMPUP00000010040 ......SN.......QLVYQ..KKYKDPV........................T------..--.............
Mpf_ENSMPUP00000007257 ......NK.......VLYTY..AASEDVA........................A------..--.............
Mpf_ENSMPUP00000016774 ......GM.......ILYLQ..KEE----........................YQPGKAL..SE.............
Mpf_ENSMPUP00000001960 ......DT.......RLLCY..KSSKDHS........................P------..--.............
Mpf_ENSMPUP00000007610 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017612 ......SR.......MLLVA..KR-----........................-----RG..PE.............
Mpf_ENSMPUP00000007907 ......TDlq.....ALRWE..PSKKDLE........................-------..--.............
Mpf_ENSMPUP00000014021 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008982 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005803 ......GL.......SISYY..NNEKEKY........................S------..--.............
Mpf_ENSMPUP00000002728 ......EHrt.....RLRWR..PSRKSEK........................A------..--.............
Mpf_ENSMPUP00000007017 ......KDpa.....FLHYY..DPSKEEN........................R----PV..GG.............
Mpf_ENSMPUP00000003752 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001306 ......ND.......FLLLT..QIIKPLGssgsdkv.................FSPKSHL..LY.............
Mpf_ENSMPUP00000005338 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000001689 ....dgSY.......ILNSY..KDEKNSK........................ES-----..--.............
Mpf_ENSMPUP00000010415 ......DA.......RLLCY..KSSKDQQ........................P------..--.............
Mpf_ENSMPUP00000006220 ......ED.......GIEFY..KKKSDNS........................P------..--.............
Mpf_ENSMPUP00000016350 ......RP.......YVFIY..NSDKDPV........................E------..--.............
Mpf_ENSMPUP00000018773 ......CH.......AVLVS..KP-----........................-------..--.............
Mpf_ENSMPUP00000017599 ......SDg......SFIGY..KERPDA-........................-----PD..QT.............
Mpf_ENSMPUP00000016349 ......RP.......YVFIY..NSDKDPV........................E------..--.............
Mpf_ENSMPUP00000015036 ......AR.......SLSLS..KERREPGpaaagaaaavaged..........E------..--.............
Mpf_ENSMPUP00000007938 ......GR.......SLMYF..GSDKDPF........................P------..--.............
Mpf_ENSMPUP00000007257 ......ND.......ALLYT..TPM----........................-----QS..GM.............
Mpf_ENSMPUP00000005203 ......--.......-L---..-------........................-------..--.............
Mpf_ENSMPUP00000000650 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007937 ......GSda.....QLIYF..ESEKRAT........................-------..--.............
Mpf_ENSMPUP00000007017 ......QN.......TLLYY..KLEGGRK........................VT-----..--.............
Mpf_ENSMPUP00000012780 ......NG.......LLSYY..RNQ----........................-----GE..MA.............
Mpf_ENSMPUP00000002522 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004905 ......GC.......TLYFY..NSNRDSQ........................-----HV..EK.............
Mpf_ENSMPUP00000011326 ....dgSY.......NLNFY..KD-----........................-----EK..IS.............
Mpf_ENSMPUP00000009449 ......GM.......VLYFL..KGEDHCP........................P-AGESL..VG.............
Mpf_ENSMPUP00000000014 ......DQ.......SLRYY..RDS----........................A----AE..EA.............
Mpf_ENSMPUP00000012737 ......DS.......SLKYY..RDSTAEE........................A------..--.............
Mpf_ENSMPUP00000002136 ......SDg......SFTGY..KERPQDV........................E------..--.............
Mpf_ENSMPUP00000017782 ......DR.......RLMYF..KDPLDAF........................A------..--.............
Mpf_ENSMPUP00000013550 ......PN.......RLEWR..GE-----........................-------..-G.............
Mpf_ENSMPUP00000017362 ......PG.......VLLIY..KTQKNGQ........................W------..--.............
Mpf_ENSMPUP00000006996 ......YNag.....LLSYY..TSKDKMM........................RGSR---..--.............
Mpf_ENSMPUP00000004785 ......KR.......TLSYY..VDKHETK........................L------..--.............
Mpf_ENSMPUP00000014164 ......ED.......QLLCY..KSSKDRQ........................P------..--.............
Mpf_ENSMPUP00000016592 ....dnSY.......IMNFY..KD-----........................-----EK..IS.............
Mpf_ENSMPUP00000000486 ......RT.......YLMAF..QP-----........................-----GK..LD.............
Mpf_ENSMPUP00000003712 ......NN.......QLVYQ..KKFKDNP........................T------..--.............
Mpf_ENSMPUP00000006850 ......RQar.....RLAYY..ADKEETK........................L------..--.............
Mpf_ENSMPUP00000015574 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000014962 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016814 ......SD.......MLLVT..KPQRKLN........................K------..-A.............
Mpf_ENSMPUP00000000139 ......RP.......YAYLY..NSDKDSV........................E------..--.............
Mpf_ENSMPUP00000012020 ......GG.......NLMCQ..PRGAVA-........................G------..--.............
Mpf_ENSMPUP00000006069 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000017142 ......SD.......VLLYT..YPQ----........................-----KD..GK.............
Mpf_ENSMPUP00000013991 ......GQ.......RLCFA..-------........................-----HH..PT.............
Mpf_ENSMPUP00000010353 ......--.......---AY..EDIKEVH........................-------..--.............
Mpf_ENSMPUP00000000014 ......EH.......GLLRY..ALD----........................-----EM..PT.............
Mpf_ENSMPUP00000009546 ......TQanc....LLWYM..DNPQNLA........................M----GA..GA.............
Mpf_ENSMPUP00000012020 ......--.......-----..-PQTQVT........................-------..--.............
Mpf_ENSMPUP00000016751 ......QG.......GNLMS..QARGDVA........................G------..--.............
Mpf_ENSMPUP00000000216 ......KQdpl....VLYMY..GAPQDVR........................A------..--.............
Mpf_ENSMPUP00000010854 ......KR.......CIYYF..KSSTSAS........................P------..--.............
Mpf_ENSMPUP00000016813 ......QY.......TFAMC..SY-----........................-----RE..KK.............
Mpf_ENSMPUP00000002870 ......ED.......SFVWY..MDNPQNL........................PSGSSR-..--.............
Mpf_ENSMPUP00000003651 ......SR.......KLEFY..KESKQQA........................LS---NM..KT.............
Mpf_ENSMPUP00000002370 ......DS.......VVMLC..VATTRRLkn......................SKASTDG..HR.............
Mpf_ENSMPUP00000006780 ......QY.......TFAMC..SY-----........................-----RE..KK.............
Mpf_ENSMPUP00000002802 ......GN.......QLLFQ..KGKSKDD........................P------..-D.............
Mpf_ENSMPUP00000011336 ......ENepl....VLYIY..GAPQDVK........................A------..--.............
Mpf_ENSMPUP00000003120 ......NG.......ILSYY..DSQDDVC........................-----KG..S-.............
Mpf_ENSMPUP00000005803 ......GG.......FLSYY..ENDKSTA........................P------..--.............
Mpf_ENSMPUP00000004980 ......GG.......ILSYY..DSPEDAW........................-------..--.............
Mpf_ENSMPUP00000015621 ......TDgs.....FIGYK..EKPQDV-........................-------..--.............
Mpf_ENSMPUP00000003141 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013099 ......NG.......FLTIS..HGTA---........................-------..--.............
Mpf_ENSMPUP00000010983 ......HN.......SLDYY..KSSEKNA........................LK-----..--.............
Mpf_ENSMPUP00000004910 ......PG.......VLLIY..KTPKVGQ........................W------..--.............
Mpf_ENSMPUP00000016233 ......SY.......RVIFV..TSH----........................-------..--.............
Mpf_ENSMPUP00000002953 ......DN.......AVEI-..-------........................-------..--.............
Mpf_ENSMPUP00000011716 ......SDg......HLIYY..DDQTRHS........................V----ED..KI.............
Mpf_ENSMPUP00000007767 ......GN.......CISYW..TYPDDEK........................R------..--.............
Mpf_ENSMPUP00000014585 ......PQer.....RLLYY..KNPLDAF........................E------..--.............
Mpf_ENSMPUP00000014164 ......CN.......TLYFH..KDHTDLR........................TH-----..--.............
Mpf_ENSMPUP00000005886 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013797 ......HS.......YLYFQ..AR-----........................-----GS..KG.............
Mpf_ENSMPUP00000004108 ......NEag.....LLEYF..VNE----........................-----QS..RN.............
Mpf_ENSMPUP00000009167 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016226 ......NG.......ILYQY..PDRTDVT........................PLLSVNM..GG.............
Mpf_ENSMPUP00000014024 ......RDdpl....VLYVY..AAPQDMR........................A------..--.............
Mpf_ENSMPUP00000008448 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010607 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015774 ......YG.......CLTIS..HSTIN--........................-------..--.............
Mpf_ENSMPUP00000008639 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012941 ......GS.......SLLFT..KTQGSST........................S--WFGS..NQ.............
Mpf_ENSMPUP00000016218 ......QD.......ILVLT..RPVTRNE........................-----RH..FY.............
Mpf_ENSMPUP00000007001 ......ND.......CLLLS..RPR----........................-----EG..SR.............
Mpf_ENSMPUP00000001986 ......GC.......TLLFY..ETYGKNS........................-----MD..QS.............
Mpf_ENSMPUP00000010415 ......DN.......RLIFH..KDRTDLK........................TH-----..--.............
Mpf_ENSMPUP00000003836 ......DG.......CLYFY..ASIRSTQ........................A------..--.............
Mpf_ENSMPUP00000007027 ......GR.......TFYYY..RSHEDKR........................P------..--.............
Mpf_ENSMPUP00000002688 ......ND.......VLIIT..KKKSEES........................Y----NV..ND.............
Mpf_ENSMPUP00000001373 ......NG.......ILTIS..HATSNRQ........................-------..--.............
Mpf_ENSMPUP00000013700 ......TD.......VLLCA..KLKKTSA........................G----KH..QQ.............
Mpf_ENSMPUP00000016589 ......--.......-----..----E--........................-------..--.............
Mpf_ENSMPUP00000015325 ......QN.......LLFYF..ESDSSSR........................P------..--.............
Mpf_ENSMPUP00000001960 ......DS.......HLHFY..QDRNRSK........................-------..--.............
Mpf_ENSMPUP00000006310 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000016747 ......QE.......VLVIT..RAVTHNE........................-----QL..CY.............
Mpf_ENSMPUP00000013323 ......KG.......ILKYA..KSQTDI-........................-------..--.............
Mpf_ENSMPUP00000007350 ......ES.......FLLYY..SESEKKN........................F-ESNKY..FN.............
Mpf_ENSMPUP00000017588 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007745 ......PNhk.....VLHYG..DLEESPQ........................G----EV..PH.............
Mpf_ENSMPUP00000006409 ......EKkc.....HLYYS..RTAQDAN........................P------..--.............
Mpf_ENSMPUP00000015574 ......ADpp.....RLECY..ESEKKFR........................------A..GR.............
Mpf_ENSMPUP00000008365 ......GG.......VLTFF..KDSKASA........................AGGLRQP..PK.............
Mpf_ENSMPUP00000001054 ......GC.......TLFFY..ESDGRSG........................I-----D..HN.............
Mpf_ENSMPUP00000017488 ......HK.......VLHYG..DLDDNPQ........................-----GE..VT.............
Mpf_ENSMPUP00000005234 ......ND.......LLVIC..RQI----........................-----PG..DK.............
Mpf_ENSMPUP00000013182 ......ET.......TLSYY..KSQ----........................-----DE..AP.............
Mpf_ENSMPUP00000011513 ......GG.......ELLYY..KSPSDVI........................R------..--.............
Mpf_ENSMPUP00000005385 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009077 ......GHq......HFYIC..ENF----........................-TLSPVG..DV.............
Mpf_ENSMPUP00000001767 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007827 ......RD.......-----..--SKQITmv......................PFDQKSG..GK.............
Mpf_ENSMPUP00000000541 ......QA.......QLLVY..ENEDEQK........................C------..--.............
Mpf_ENSMPUP00000001809 ......GN.......SLVFY..REPPPAA........................PSSIWGP..AG.............
Mpf_ENSMPUP00000005803 ......DG.......YLFLY..KDSKSSK........................Y------..--.............
Mpf_ENSMPUP00000013182 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005315 ......GD.......QLYVS..DKE----........................-----VK..DE.............
Mpf_ENSMPUP00000014585 ......EG.......LLKYY..TKEEGKG........................P------..--.............
Mpf_ENSMPUP00000015166 ......DG.......ILHYA..TTRQDIT........................KG-----..--.............
Mpf_ENSMPUP00000002409 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005807 ......AE.......SLSWY..KDEEEKE........................K------..--.............
Mpf_ENSMPUP00000013796 ......PS.......SLAIF..SE-----........................-----EA..EG.............
Mpf_ENSMPUP00000017782 ......EReg.....SLKYF..NRNDAKE........................P------..--.............
Mpf_ENSMPUP00000019464 ......GN.......LLFSF..ESRESRA........................P------..--.............
Mpf_ENSMPUP00000012725 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010996 ......GG.......KLYCF..YSPQEIE........................A-----K..VE.............
Mpf_ENSMPUP00000007938 ......GH.......CLLLL..KEKKSSK........................P------..--.............
Mpf_ENSMPUP00000009654 ......DG.......TLGYY..RDETAQD........................-------..EE.............
Mpf_ENSMPUP00000005385 ......DT.......SISCY..KSK----........................-----EE..SS.............
Mpf_ENSMPUP00000006310 ......DT.......SIAYF..KNK----........................-----EL..EQ.............
Mpf_ENSMPUP00000007963 ......-D.......VLEYY..KNDHSKK........................P------..--.............
Mpf_ENSMPUP00000002310 ......DNg......VLTYH..PSLHDYM........................QNVH---..--.............
Mpf_ENSMPUP00000000486 ......PY.......NLYFY..SLD----........................-----SS..GN.............
Mpf_ENSMPUP00000007805 ......--.......---L-..-------........................-------..--.............
Mpf_ENSMPUP00000010246 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004460 ...skgPQ.......RLEKY..PDEKSVC........................L------..--.............
Mpf_ENSMPUP00000014791 ......ND.......ALLVS..SRGTVHT........................PFERTSK..ST.............
Mpf_ENSMPUP00000003154 ......NG.......MLKYS..KAPLDIQ........................-------..-K.............
Mpf_ENSMPUP00000005214 ......SD.......VLLMA..KPRPPLH........................LL---QS..GT.............
Mpf_ENSMPUP00000003932 ...adaPA.......RLEYY..ENARKFRhsvraaaaaaaaaasgaavpalipP------..--.............
Mpf_ENSMPUP00000008710 ......DNg......LLTYH..PSLHDYM........................QNIH---..--.............
Mpf_ENSMPUP00000005632 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002828 ......TD.......LLLCT..KLKKQSG........................G----KT..QQ.............
Mpf_ENSMPUP00000017859 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013754 ......GS.......TLLYY..GAKSLRG........................--TDRKH..YK.............
Mpf_ENSMPUP00000004548 ......--.......-----..-KETKML........................TMTPMEQ..KP.............
Mpf_ENSMPUP00000000646 ......AT.......HLLFI..DSH----........................-----QK..ET.............
Mpf_ENSMPUP00000004473 ......ASeplel..VLHLQ..RDSQDGG........................P------..--.............
Mpf_ENSMPUP00000000402 ......AS.......GIYYV..PKGKAK-........................-------..VS.............
Mpf_ENSMPUP00000007412 ......ND.......VLVVT..KKK----........................-----SE..DS.............
Mpf_ENSMPUP00000004935 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000011513 ......GK.......TLYYF..RSQEDKF........................P------..--.............
Mpf_ENSMPUP00000001759 ......KGsktf...TMSVS..EMKSSGK........................M----NG..LV.............
Mpf_ENSMPUP00000008353 ......PL.......EFRLY..LNTEERL........................C------..--.............
Mpf_ENSMPUP00000012083 ......AS.......GIYYV..PKGKTKT........................SRDLA--..CF.............
Mpf_ENSMPUP00000006956 ......--.......--MYR..KAAKKFNii......................PFEHRSG..GK.............
Mpf_ENSMPUP00000014860 ......RS.......GLYYS..TKGT---........................-----SK..DP.............
Mpf_ENSMPUP00000009647 ......ND.......LLVVT..KIFQKKK........................I-----L..VT.............
Mpf_ENSMPUP00000005803 ......GS.......SVWLC..KNEQDFK........................SGLG---..--.............
Mpf_ENSMPUP00000005109 ......GT.......QLFYY..AAKSLKA........................T----ER..KH.............
Mpf_ENSMPUP00000006149 ...skgPK.......RLEKF..SDERAAY........................F------..--.............
Mpf_ENSMPUP00000001981 ......SNg......FLLYH..PSINDYI........................HSTH---..--.............
Mpf_ENSMPUP00000017916 ......ND.......LLVIL..KLCPKKK........................-----SS..ST.............
Mpf_ENSMPUP00000003318 ......ND.......LFVVA..KIK----........................-----YN..NN.............
Mpf_ENSMPUP00000017175 ......ND.......LLVVT..KIFQKKK........................-----NS..VT.............
Mpf_ENSMPUP00000016038 ......PD.......VLEYY..RSKHASK........................P------..--.............
Mpf_ENSMPUP00000016192 ......ND.......CLLLS..RRK----........................-----EL..GK.............
Mpf_ENSMPUP00000015325 ......SK.......HLIIC..TRG----........................---SGGK..LH.............
Mpf_ENSMPUP00000000660 ......RS.......GLYFS..TKGTSKE........................P------..RH.............
Mpf_ENSMPUP00000005493 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009754 ......SS.......CLRLY..KEIRSHR........................P------..--.............
Mpf_ENSMPUP00000013796 ......HS.......YLYFQ..AR-----........................-----GS..KG.............
Mpf_ENSMPUP00000010667 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013126 ......AE.......NLSWY..KDDETHS........................LS---ET..DM.............
Mpf_ENSMPUP00000018046 ......RS.......GLYCS..TKGASKE........................P------..--.............
Mpf_ENSMPUP00000006359 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015086 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000008387 ......TK.......HFLIC..TRSSGGK........................LHLL---..--.............
Mpf_ENSMPUP00000015207 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000004217 ......--.......-----..-------........................-------..CK.............
Mpf_ENSMPUP00000015689 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015159 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000018833 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007866 ......GT.......SLFCY..RQPEDAD........................T----GE..EP.............
Mpf_ENSMPUP00000007938 ......PG.......ELALY..KSEQAFS........................SGIG---..--.............
Mpf_ENSMPUP00000010694 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013131 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000000312 ......ND.......ALVHA..QFS----........................T------..--.............
Mpf_ENSMPUP00000019132 ......ER.......GLQLF..EAKGTGG........................R------..--.............
Mpf_ENSMPUP00000015959 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000012612 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000007938 ......AA.......L-EMF..ASES---........................-----SP..EP.............
Mpf_ENSMPUP00000007989 ......SD.......LLLIT..QPK----........................-----SG..QR.............
Mpf_ENSMPUP00000016156 ......--.......----Y..KKD----........................-------..--.............
Mpf_ENSMPUP00000013721 ......EN.......KVAY-..--ERQVP........................PRAIINS..AG.............
Mpf_ENSMPUP00000005447 ......SK.......KILFY..NDEQDKE........................Q----SS..PSmvldidklfhvrp
Mpf_ENSMPUP00000015768 ......GDg......RLEWF..SHREEYEnggh....................P------..--.............
Mpf_ENSMPUP00000004215 ......GEsdcala.RLELQ..EGPEKPRrgea....................A------..--.............
Mpf_ENSMPUP00000010108 ......RD.......SLDQF..SSS----........................-----GK..GA.............
Mpf_ENSMPUP00000002188 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000013446 ......SK.......KILFY..DSEQDKE........................-----QS..NP.............
Mpf_ENSMPUP00000012407 ......DS.......RLLLF..DAPDPRL........................-----SP..AS.............
Mpf_ENSMPUP00000017043 ......DS.......FLLYM..KPDSGAI........................A------..--.............
Mpf_ENSMPUP00000007898 ......SD.......LLLFT..KEDEPGR........................CDVL---..--.............
Mpf_ENSMPUP00000017064 ......ND.......CLEIA..RKRHKVIgtfrsp..................PGHTRPP..AS.............
Mpf_ENSMPUP00000009754 ......GD.......KVQLY..KNLEEYH........................LGIG---..--.............
Mpf_ENSMPUP00000016461 gldgarDS.......ILFIY..YVVHEEK........................K------..--.............
Mpf_ENSMPUP00000008230 ......PAsphgva.RLEFF..DHKGSSS........................GGGR-GG..SR.............
Mpf_ENSMPUP00000001993 ......KSgersl..RLSYY..KDQHRRG........................SIEIDRN..SS.............
Mpf_ENSMPUP00000014500 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002405 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002933 ......GS.......KVLIY..DNEAREA........................G----QR..PV.............
Mpf_ENSMPUP00000007268 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010983 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010498 ......KPspvadclLMLVY..KDKAERA........................-------..--.............
Mpf_ENSMPUP00000018101 ......DF.......KLFLYnmDEEKDSK........................PNVVVSQ..VI.............
Mpf_ENSMPUP00000002033 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010694 ......GS.......CLYKF..LAP----........................--PVTTW..DW.............
Mpf_ENSMPUP00000008353 ......LE.......SLKCF..RVRNNEK........................-------..--.............
Mpf_ENSMPUP00000009754 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000015718 ......DF.......KLFLY..DVAEGKA........................-----SQ..PS.............
Mpf_ENSMPUP00000002358 ......DC.......KLFLY..DLPEGKStq......................PGVVASQ..VL.............
Mpf_ENSMPUP00000005077 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000009107 ......GS.......SLSLF..WDKRTAA........................-------..EN.............
Mpf_ENSMPUP00000016101 ......ND.......MLVCA..NINFKPAnnrgqlei................SSLVPLG..PK.............
Mpf_ENSMPUP00000011911 ......AGspsgva.RLESW..EVREGGLgptgdrp.................TGPSRRG..--.............
Mpf_ENSMPUP00000007938 ......GD.......LLFLC..PASGPGP........................------P..AP.............
Mpf_ENSMPUP00000009676 ......TD.......LIICT..TLKRKSGslrrssmslyta............ASVIDTA..SK.............
Mpf_ENSMPUP00000005809 ......HG.......VLSWY..RKQPDAV........................RNIYRQG..CK.............
Mpf_ENSMPUP00000016410 ......GT.......CLIVS..SVKDSLT........................GK-----..--.............
Mpf_ENSMPUP00000006638 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000005803 ......KS.......SLRFC..LQMQEVQ........................-------..--.............
Mpf_ENSMPUP00000010983 ......DE.......TFLWF..RSKQ---........................-------..--.............
Mpf_ENSMPUP00000000717 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000002793 ......SD.......VLMCA..TVSARTAdsnal...................A---SPG..RK.............
Mpf_ENSMPUP00000007833 ......GT.......CLIVS..SVKDCQT........................G------..--.............
Mpf_ENSMPUP00000002271 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010974 ......--.......-----..-------........................-------..--.............
Mpf_ENSMPUP00000010755 ......DS.......FLLYM..CLETGAI........................S------..--.............
Mpf_ENSMPUP00000013112 ......--.......-----..-------........................-------..--.............


                                                                                                    
                                                                                                    
d1dbha2                ..........................................................................Y..
Mpf_ENSMPUP00000000236 ..........................................................................Y..
Mpf_ENSMPUP00000001054 ..........................................................................F..
Mpf_ENSMPUP00000001986 ..........................................................................F..
Mpf_ENSMPUP00000006133 ..........................................................................-..
Mpf_ENSMPUP00000009494 ..........................................................................-..
Mpf_ENSMPUP00000004093 ..........................................................................-..
Mpf_ENSMPUP00000012215 ..........................................................................-..
Mpf_ENSMPUP00000016175 ..........................................................................-..
Mpf_ENSMPUP00000009909 ..........................................................................-..
Mpf_ENSMPUP00000010977 ..........................................................................-..
Mpf_ENSMPUP00000016638 ..........................................................................-..
Mpf_ENSMPUP00000018612 ..........................................................................-..
Mpf_ENSMPUP00000018966 ..........................................................................-..
Mpf_ENSMPUP00000004660 ..........................................................................-..
Mpf_ENSMPUP00000002149 ..........................................................................G..
Mpf_ENSMPUP00000018066 ..........................................................................-..
Mpf_ENSMPUP00000017958 ..........................................................................-..
Mpf_ENSMPUP00000011450 ..........................................................................-..
Mpf_ENSMPUP00000016402 ..........................................................................L..
Mpf_ENSMPUP00000004951 ..........................................................................-..
Mpf_ENSMPUP00000011363 ..........................................................................-..
Mpf_ENSMPUP00000015445 ..........................................................................-..
Mpf_ENSMPUP00000015195 ..........................................................................-..
Mpf_ENSMPUP00000011751 ..........................................................................L..
Mpf_ENSMPUP00000009831 ..........................................................................L..
Mpf_ENSMPUP00000004111 ..........................................................................-..
Mpf_ENSMPUP00000005349 ..........................................................................-..
Mpf_ENSMPUP00000006137 ..........................................................................-..
Mpf_ENSMPUP00000009095 ..........................................................................-..
Mpf_ENSMPUP00000005832 ..........................................................................-..
Mpf_ENSMPUP00000014567 ..........................................................................-..
Mpf_ENSMPUP00000015198 ..........................................................................-..
Mpf_ENSMPUP00000008441 ..........................................................................Y..
Mpf_ENSMPUP00000005146 ..........................................................................L..
Mpf_ENSMPUP00000010667 ..........................................................................-..
Mpf_ENSMPUP00000000642 ..........................................................................L..
Mpf_ENSMPUP00000015373 ..........................................................................-..
Mpf_ENSMPUP00000003213 ..........................................................................-..
Mpf_ENSMPUP00000012196 ..........................................................................-..
Mpf_ENSMPUP00000012194 ..........................................................................-..
Mpf_ENSMPUP00000003212 ..........................................................................-..
Mpf_ENSMPUP00000001158 ..........................................................................L..
Mpf_ENSMPUP00000010667 ..........................................................................-..
Mpf_ENSMPUP00000013386 ..........................................................................R..
Mpf_ENSMPUP00000016712 ..........................................................................-..
Mpf_ENSMPUP00000003302 ..........................................................................L..
Mpf_ENSMPUP00000003768 ..........................................................................-..
Mpf_ENSMPUP00000008012 ..........................................................................-..
Mpf_ENSMPUP00000002625 ..........................................................................-..
Mpf_ENSMPUP00000010667 ..........................................................................-..
Mpf_ENSMPUP00000006140 ..........................................................................-..
Mpf_ENSMPUP00000015670 ..........................................................................-..
Mpf_ENSMPUP00000008341 ..........................................................................-..
Mpf_ENSMPUP00000017573 ..........................................................................-..
Mpf_ENSMPUP00000012859 ..........................................................................-..
Mpf_ENSMPUP00000012131 ..........................................................................-..
Mpf_ENSMPUP00000000172 ..........................................................................-..
Mpf_ENSMPUP00000013200 ..........................................................................-..
Mpf_ENSMPUP00000003522 ..........................................................................Q..
Mpf_ENSMPUP00000011499 ..........................................................................-..
Mpf_ENSMPUP00000011494 ..........................................................................-..
Mpf_ENSMPUP00000012716 ..........................................................................-..
Mpf_ENSMPUP00000002913 ..........................................................................-..
Mpf_ENSMPUP00000003504 ..........................................................................-..
Mpf_ENSMPUP00000004361 ..........................................................................-..
Mpf_ENSMPUP00000017389 ..........................................................................-..
Mpf_ENSMPUP00000015829 ..........................................................................-..
Mpf_ENSMPUP00000003644 ..........................................................................-..
Mpf_ENSMPUP00000006376 ..........................................................................-..
Mpf_ENSMPUP00000014536 ..........................................................................-..
Mpf_ENSMPUP00000011501 ..........................................................................-..
Mpf_ENSMPUP00000017670 ..........................................................................-..
Mpf_ENSMPUP00000006727 ..........................................................................-..
Mpf_ENSMPUP00000000961 ..........................................................................-..
Mpf_ENSMPUP00000004942 ..........................................................................L..
Mpf_ENSMPUP00000002151 ..........................................................................-..
Mpf_ENSMPUP00000014680 ..........................................................................-..
Mpf_ENSMPUP00000005563 ..........................................................................H..
Mpf_ENSMPUP00000011333 ..........................................................................-..
Mpf_ENSMPUP00000000969 ..........................................................................-..
Mpf_ENSMPUP00000010395 ..........................................................................Y..
Mpf_ENSMPUP00000015361 ..........................................................................-..
Mpf_ENSMPUP00000001991 ..........................................................................-..
Mpf_ENSMPUP00000005637 ..........................................................................N..
Mpf_ENSMPUP00000007307 ..........................................................................-..
Mpf_ENSMPUP00000008193 ..........................................................................-..
Mpf_ENSMPUP00000007177 ..........................................................................T..
Mpf_ENSMPUP00000010360 ..........................................................................Y..
Mpf_ENSMPUP00000010611 ..........................................................................Y..
Mpf_ENSMPUP00000007161 ..........................................................................-..
Mpf_ENSMPUP00000006134 ..........................................................................-..
Mpf_ENSMPUP00000004983 ..........................................................................Y..
Mpf_ENSMPUP00000001920 ..........................................................................-..
Mpf_ENSMPUP00000013542 ..........................................................................-..
Mpf_ENSMPUP00000008337 ..........................................................................-..
Mpf_ENSMPUP00000013626 ..........................................................................F..
Mpf_ENSMPUP00000001949 ..........................................................................-..
Mpf_ENSMPUP00000017721 ..........................................................................-..
Mpf_ENSMPUP00000001109 ..........................................................................-..
Mpf_ENSMPUP00000001935 ..........................................................................Q..
Mpf_ENSMPUP00000006252 ..........................................................................-..
Mpf_ENSMPUP00000005676 ..........................................................................-..
Mpf_ENSMPUP00000005196 ..........................................................................-..
Mpf_ENSMPUP00000012589 ..........................................................................V..
Mpf_ENSMPUP00000010571 ..........................................................................-..
Mpf_ENSMPUP00000011589 ..........................................................................-..
Mpf_ENSMPUP00000005676 ..........................................................................-..
Mpf_ENSMPUP00000002533 ..........................................................................-..
Mpf_ENSMPUP00000004215 ..........................................................................-..
Mpf_ENSMPUP00000013399 ..........................................................................-..
Mpf_ENSMPUP00000010530 ..........................................................................F..
Mpf_ENSMPUP00000006089 ..........................................................................F..
Mpf_ENSMPUP00000016498 ..........................................................................-..
Mpf_ENSMPUP00000007327 ..........................................................................-..
Mpf_ENSMPUP00000001749 ..........................................................................Y..
Mpf_ENSMPUP00000016475 ..........................................................................-..
Mpf_ENSMPUP00000013206 ..........................................................................-..
Mpf_ENSMPUP00000006140 ..........................................................................-..
Mpf_ENSMPUP00000005780 ..........................................................................-..
Mpf_ENSMPUP00000001869 ..........................................................................F..
Mpf_ENSMPUP00000012475 ..........................................................................-..
Mpf_ENSMPUP00000008316 ..........................................................................-..
Mpf_ENSMPUP00000001167 ..........................................................................-..
Mpf_ENSMPUP00000008230 ..........................................................................-..
Mpf_ENSMPUP00000017717 ..........................................................................-..
Mpf_ENSMPUP00000010272 ..........................................................................Y..
Mpf_ENSMPUP00000003964 ..........................................................................-..
Mpf_ENSMPUP00000017478 ..........................................................................Y..
Mpf_ENSMPUP00000010168 ..........................................................................-..
Mpf_ENSMPUP00000009546 ..........................................................................-..
Mpf_ENSMPUP00000002870 ..........................................................................-..
Mpf_ENSMPUP00000000151 ..........................................................................F..
Mpf_ENSMPUP00000000216 ..........................................................................F..
Mpf_ENSMPUP00000007012 ..........................................................................Y..
Mpf_ENSMPUP00000012096 ..........................................................................Y..
Mpf_ENSMPUP00000004281 ..........................................................................Y..
Mpf_ENSMPUP00000004460 ..........................................................................-..
Mpf_ENSMPUP00000011499 ..........................................................................-..
Mpf_ENSMPUP00000003498 ..........................................................................-..
Mpf_ENSMPUP00000006723 ..........................................................................Y..
Mpf_ENSMPUP00000006149 ..........................................................................-..
Mpf_ENSMPUP00000011052 ..........................................................................F..
Mpf_ENSMPUP00000015653 ..........................................................................-..
Mpf_ENSMPUP00000014937 ..........................................................................-..
Mpf_ENSMPUP00000006713 ..........................................................................F..
Mpf_ENSMPUP00000005370 ..........................................................................-..
Mpf_ENSMPUP00000017142 ..........................................................................-..
Mpf_ENSMPUP00000011052 ..........................................................................Y..
Mpf_ENSMPUP00000000930 ..........................................................................-..
Mpf_ENSMPUP00000016865 ..........................................................................-..
Mpf_ENSMPUP00000000090 ..........................................................................Y..
Mpf_ENSMPUP00000012035 ..........................................................................S..
Mpf_ENSMPUP00000009068 ..........................................................................-..
Mpf_ENSMPUP00000000172 ..........................................................................-..
Mpf_ENSMPUP00000013402 ..........................................................................-..
Mpf_ENSMPUP00000012726 ..........................................................................-..
Mpf_ENSMPUP00000010329 ..........................................................................F..
Mpf_ENSMPUP00000005886 ..........................................................................-..
Mpf_ENSMPUP00000011911 ..........................................................................-..
Mpf_ENSMPUP00000013895 ..........................................................................K..
Mpf_ENSMPUP00000009754 ..........................................................................-..
Mpf_ENSMPUP00000017452 ..........................................................................-..
Mpf_ENSMPUP00000004281 ..........................................................................Y..
Mpf_ENSMPUP00000017577 ..........................................................................H..
Mpf_ENSMPUP00000004977 ..........................................................................-..
Mpf_ENSMPUP00000017884 ..........................................................................H..
Mpf_ENSMPUP00000007027 ..........................................................................R..
Mpf_ENSMPUP00000012725 ..........................................................................-..
Mpf_ENSMPUP00000000871 ..........................................................................-..
Mpf_ENSMPUP00000006220 ..........................................................................-..
Mpf_ENSMPUP00000008418 ..........................................................................-..
Mpf_ENSMPUP00000003932 ..........................................................................-..
Mpf_ENSMPUP00000001861 ..........................................................................-..
Mpf_ENSMPUP00000008418 ..........................................................................H..
Mpf_ENSMPUP00000006249 ..........................................................................-..
Mpf_ENSMPUP00000003836 ..........................................................................C..
Mpf_ENSMPUP00000015858 ..........................................................................-..
Mpf_ENSMPUP00000002835 ..........................................................................S..
Mpf_ENSMPUP00000004473 ..........................................................................F..
Mpf_ENSMPUP00000000137 ..........................................................................-..
Mpf_ENSMPUP00000001907 ..........................................................................Y..
Mpf_ENSMPUP00000014024 ..........................................................................F..
Mpf_ENSMPUP00000001742 ..........................................................................-..
Mpf_ENSMPUP00000000172 ..........................................................................F..
Mpf_ENSMPUP00000005480 ..........................................................................-..
Mpf_ENSMPUP00000018515 ..........................................................................Y..
Mpf_ENSMPUP00000009502 ..........................................................................-..
Mpf_ENSMPUP00000013672 ..........................................................................-..
Mpf_ENSMPUP00000011336 ..........................................................................F..
Mpf_ENSMPUP00000001410 ..........................................................................-..
Mpf_ENSMPUP00000003424 ..........................................................................Y..
Mpf_ENSMPUP00000007040 ..........................................................................-..
Mpf_ENSMPUP00000019493 ..........................................................................Y..
Mpf_ENSMPUP00000018830 ..........................................................................Y..
Mpf_ENSMPUP00000003141 ..........................................................................-..
Mpf_ENSMPUP00000010983 ..........................................................................-..
Mpf_ENSMPUP00000010498 ..........................................................................-..
Mpf_ENSMPUP00000012786 ..........................................................................E..
Mpf_ENSMPUP00000014114 ..........................................................................-..
Mpf_ENSMPUP00000007256 ..........................................................................-..
Mpf_ENSMPUP00000005608 ..........................................................................Y..
Mpf_ENSMPUP00000002033 ..........................................................................-..
Mpf_ENSMPUP00000016751 ..........................................................................-..
Mpf_ENSMPUP00000016435 ..........................................................................-..
Mpf_ENSMPUP00000001167 ..........................................................................S..
Mpf_ENSMPUP00000001585 ..........................................................................-..
Mpf_ENSMPUP00000002351 ..........................................................................Y..
Mpf_ENSMPUP00000011499 ..........................................................................F..
Mpf_ENSMPUP00000005375 ..........................................................................-..
Mpf_ENSMPUP00000015986 ..........................................................................-..
Mpf_ENSMPUP00000004747 ..........................................................................-..
Mpf_ENSMPUP00000009754 ..........................................................................-..
Mpf_ENSMPUP00000002257 ..........................................................................-..
Mpf_ENSMPUP00000006734 ..........................................................................K..
Mpf_ENSMPUP00000003502 ..........................................................................L..
Mpf_ENSMPUP00000011019 ..........................................................................-..
Mpf_ENSMPUP00000003673 ..........................................................................E..
Mpf_ENSMPUP00000000383 ..........................................................................-..
Mpf_ENSMPUP00000008997 ..........................................................................G..
Mpf_ENSMPUP00000010040 ..........................................................................-..
Mpf_ENSMPUP00000007257 ..........................................................................-..
Mpf_ENSMPUP00000016774 ..........................................................................A..
Mpf_ENSMPUP00000001960 ..........................................................................-..
Mpf_ENSMPUP00000007610 ..........................................................................-..
Mpf_ENSMPUP00000017612 ..........................................................................Y..
Mpf_ENSMPUP00000007907 ..........................................................................-..
Mpf_ENSMPUP00000014021 ..........................................................................-..
Mpf_ENSMPUP00000008982 ..........................................................................-..
Mpf_ENSMPUP00000005803 ..........................................................................-..
Mpf_ENSMPUP00000002728 ..........................................................................-..
Mpf_ENSMPUP00000007017 ..........................................................................F..
Mpf_ENSMPUP00000003752 ..........................................................................-..
Mpf_ENSMPUP00000001306 ..........................................................................K..
Mpf_ENSMPUP00000005338 ..........................................................................-..
Mpf_ENSMPUP00000001689 ..........................................................................-..
Mpf_ENSMPUP00000010415 ..........................................................................-..
Mpf_ENSMPUP00000006220 ..........................................................................-..
Mpf_ENSMPUP00000016350 ..........................................................................-..
Mpf_ENSMPUP00000018773 ..........................................................................-..
Mpf_ENSMPUP00000017599 ..........................................................................L..
Mpf_ENSMPUP00000016349 ..........................................................................-..
Mpf_ENSMPUP00000015036 ..........................................................................-..
Mpf_ENSMPUP00000007938 ..........................................................................-..
Mpf_ENSMPUP00000007257 ..........................................................................Y..
Mpf_ENSMPUP00000005203 ..........................................................................-..
Mpf_ENSMPUP00000000650 ..........................................................................-..
Mpf_ENSMPUP00000007937 ..........................................................................-..
Mpf_ENSMPUP00000007017 ..........................................................................-..
Mpf_ENSMPUP00000012780 ..........................................................................H..
Mpf_ENSMPUP00000002522 ..........................................................................-..
Mpf_ENSMPUP00000004905 ..........................................................................L..
Mpf_ENSMPUP00000011326 ..........................................................................K..
Mpf_ENSMPUP00000009449 ..........................................................................Q..
Mpf_ENSMPUP00000000014 ..........................................................................A..
Mpf_ENSMPUP00000012737 ..........................................................................D..
Mpf_ENSMPUP00000002136 ..........................................................................-..
Mpf_ENSMPUP00000017782 ..........................................................................-..
Mpf_ENSMPUP00000013550 ..........................................................................E..
Mpf_ENSMPUP00000017362 ..........................................................................-..
Mpf_ENSMPUP00000006996 ..........................................................................-..
Mpf_ENSMPUP00000004785 ..........................................................................-..
Mpf_ENSMPUP00000014164 ..........................................................................-..
Mpf_ENSMPUP00000016592 ..........................................................................K..
Mpf_ENSMPUP00000000486 ..........................................................................E..
Mpf_ENSMPUP00000003712 ..........................................................................-..
Mpf_ENSMPUP00000006850 ..........................................................................-..
Mpf_ENSMPUP00000015574 ..........................................................................-..
Mpf_ENSMPUP00000014962 ..........................................................................-..
Mpf_ENSMPUP00000016814 ..........................................................................K..
Mpf_ENSMPUP00000000139 ..........................................................................-..
Mpf_ENSMPUP00000012020 ..........................................................................-..
Mpf_ENSMPUP00000006069 ..........................................................................-..
Mpf_ENSMPUP00000017142 ..........................................................................Y..
Mpf_ENSMPUP00000013991 ..........................................................................F..
Mpf_ENSMPUP00000010353 ..........................................................................-..
Mpf_ENSMPUP00000000014 ..........................................................................T..
Mpf_ENSMPUP00000009546 ..........................................................................V..
Mpf_ENSMPUP00000012020 ..........................................................................-..
Mpf_ENSMPUP00000016751 ..........................................................................-..
Mpf_ENSMPUP00000000216 ..........................................................................-..
Mpf_ENSMPUP00000010854 ..........................................................................-..
Mpf_ENSMPUP00000016813 ..........................................................................A..
Mpf_ENSMPUP00000002870 ..........................................................................-..
Mpf_ENSMPUP00000003651 ..........................................................................G..
Mpf_ENSMPUP00000002370 ..........................................................................Y..
Mpf_ENSMPUP00000006780 ..........................................................................S..
Mpf_ENSMPUP00000002802 ..........................................................................D..
Mpf_ENSMPUP00000011336 ..........................................................................-..
Mpf_ENSMPUP00000003120 ..........................................................................-..
Mpf_ENSMPUP00000005803 ..........................................................................-..
Mpf_ENSMPUP00000004980 ..........................................................................K..
Mpf_ENSMPUP00000015621 ..........................................................................-..
Mpf_ENSMPUP00000003141 ..........................................................................-..
Mpf_ENSMPUP00000013099 ..........................................................................N..
Mpf_ENSMPUP00000010983 ..........................................................................-..
Mpf_ENSMPUP00000004910 ..........................................................................-..
Mpf_ENSMPUP00000016233 ..........................................................................-..
Mpf_ENSMPUP00000002953 ..........................................................................-..
Mpf_ENSMPUP00000011716 ..........................................................................H..
Mpf_ENSMPUP00000007767 ..........................................................................K..
Mpf_ENSMPUP00000014585 ..........................................................................-..
Mpf_ENSMPUP00000014164 ..........................................................................-..
Mpf_ENSMPUP00000005886 ..........................................................................-..
Mpf_ENSMPUP00000013797 ..........................................................................L..
Mpf_ENSMPUP00000004108 ..........................................................................Q..
Mpf_ENSMPUP00000009167 ..........................................................................-..
Mpf_ENSMPUP00000016226 ..........................................................................-..
Mpf_ENSMPUP00000014024 ..........................................................................-..
Mpf_ENSMPUP00000008448 ..........................................................................-..
Mpf_ENSMPUP00000010607 ..........................................................................-..
Mpf_ENSMPUP00000015774 ..........................................................................-..
Mpf_ENSMPUP00000008639 ..........................................................................-..
Mpf_ENSMPUP00000012941 ..........................................................................S..
Mpf_ENSMPUP00000016218 ..........................................................................Q..
Mpf_ENSMPUP00000007001 ..........................................................................F..
Mpf_ENSMPUP00000001986 ..........................................................................S..
Mpf_ENSMPUP00000010415 ..........................................................................-..
Mpf_ENSMPUP00000003836 ..........................................................................-..
Mpf_ENSMPUP00000007027 ..........................................................................-..
Mpf_ENSMPUP00000002688 ..........................................................................Y..
Mpf_ENSMPUP00000001373 ..........................................................................-..
Mpf_ENSMPUP00000013700 ..........................................................................Y..
Mpf_ENSMPUP00000016589 ..........................................................................-..
Mpf_ENSMPUP00000015325 ..........................................................................-..
Mpf_ENSMPUP00000001960 ..........................................................................-..
Mpf_ENSMPUP00000006310 ..........................................................................-..
Mpf_ENSMPUP00000016747 ..........................................................................Q..
Mpf_ENSMPUP00000013323 ..........................................................................-..
Mpf_ENSMPUP00000007350 ..........................................................................I..
Mpf_ENSMPUP00000017588 ..........................................................................-..
Mpf_ENSMPUP00000007745 ..........................................................................D..
Mpf_ENSMPUP00000006409 ..........................................................................-..
Mpf_ENSMPUP00000015574 ..........................................................................A..
Mpf_ENSMPUP00000008365 ..........................................................................Ls.
Mpf_ENSMPUP00000001054 ..........................................................................S..
Mpf_ENSMPUP00000017488 ..........................................................................Fe.
Mpf_ENSMPUP00000005234 ..........................................................................Y..
Mpf_ENSMPUP00000013182 ..........................................................................G..
Mpf_ENSMPUP00000011513 ..........................................................................-..
Mpf_ENSMPUP00000005385 ..........................................................................-..
Mpf_ENSMPUP00000009077 ..........................................................................Y..
Mpf_ENSMPUP00000001767 ..........................................................................-..
Mpf_ENSMPUP00000007827 ..........................................................................G..
Mpf_ENSMPUP00000000541 ..........................................................................-..
Mpf_ENSMPUP00000001809 ..........................................................................S..
Mpf_ENSMPUP00000005803 ..........................................................................-..
Mpf_ENSMPUP00000013182 ..........................................................................-..
Mpf_ENSMPUP00000005315 ..........................................................................K..
Mpf_ENSMPUP00000014585 ..........................................................................-..
Mpf_ENSMPUP00000015166 ..........................................................................-..
Mpf_ENSMPUP00000002409 ..........................................................................-..
Mpf_ENSMPUP00000005807 ..........................................................................-..
Mpf_ENSMPUP00000013796 ..........................................................................L..
Mpf_ENSMPUP00000017782 ..........................................................................-..
Mpf_ENSMPUP00000019464 ..........................................................................-..
Mpf_ENSMPUP00000012725 ..........................................................................-..
Mpf_ENSMPUP00000010996 ..........................................................................P..
Mpf_ENSMPUP00000007938 ..........................................................................-..
Mpf_ENSMPUP00000009654 ..........................................................................D..
Mpf_ENSMPUP00000005385 ..........................................................................G..
Mpf_ENSMPUP00000006310 ..........................................................................G..
Mpf_ENSMPUP00000007963 ..........................................................................-..
Mpf_ENSMPUP00000002310 ..........................................................................-..
Mpf_ENSMPUP00000000486 ..........................................................................Q..
Mpf_ENSMPUP00000007805 ..........................................................................-..
Mpf_ENSMPUP00000010246 ..........................................................................-..
Mpf_ENSMPUP00000004460 ..........................................................................-..
Mpf_ENSMPUP00000014791 ..........................................................................Y..
Mpf_ENSMPUP00000003154 ..........................................................................G..
Mpf_ENSMPUP00000005214 ..........................................................................F..
Mpf_ENSMPUP00000003932 ..........................................................................-..
Mpf_ENSMPUP00000008710 ..........................................................................-..
Mpf_ENSMPUP00000005632 ..........................................................................-..
Mpf_ENSMPUP00000002828 ..........................................................................Y..
Mpf_ENSMPUP00000017859 ..........................................................................-..
Mpf_ENSMPUP00000013754 ..........................................................................S..
Mpf_ENSMPUP00000004548 ..........................................................................G..
Mpf_ENSMPUP00000000646 ..........................................................................W..
Mpf_ENSMPUP00000004473 ..........................................................................-..
Mpf_ENSMPUP00000000402 ..........................................................................R..
Mpf_ENSMPUP00000007412 ..........................................................................F..
Mpf_ENSMPUP00000004935 ..........................................................................-..
Mpf_ENSMPUP00000011513 ..........................................................................-..
Mpf_ENSMPUP00000001759 ..........................................................................T..
Mpf_ENSMPUP00000008353 ..........................................................................-..
Mpf_ENSMPUP00000012083 ..........................................................................I..
Mpf_ENSMPUP00000006956 ..........................................................................L..
Mpf_ENSMPUP00000014860 ..........................................................................R..
Mpf_ENSMPUP00000009647 ..........................................................................Y..
Mpf_ENSMPUP00000005803 ..........................................................................-..
Mpf_ENSMPUP00000005109 ..........................................................................Fks
Mpf_ENSMPUP00000006149 ..........................................................................-..
Mpf_ENSMPUP00000001981 ..........................................................................-..
Mpf_ENSMPUP00000017916 ..........................................................................Y..
Mpf_ENSMPUP00000003318 ..........................................................................F..
Mpf_ENSMPUP00000017175 ..........................................................................Y..
Mpf_ENSMPUP00000016038 ..........................................................................-..
Mpf_ENSMPUP00000016192 ..........................................................................F..
Mpf_ENSMPUP00000015325 ..........................................................................L..
Mpf_ENSMPUP00000000660 ..........................................................................L..
Mpf_ENSMPUP00000005493 ..........................................................................-..
Mpf_ENSMPUP00000009754 ..........................................................................-..
Mpf_ENSMPUP00000013796 ..........................................................................L..
Mpf_ENSMPUP00000010667 ..........................................................................-..
Mpf_ENSMPUP00000013126 ..........................................................................S..
Mpf_ENSMPUP00000018046 ..........................................................................-..
Mpf_ENSMPUP00000006359 ..........................................................................-..
Mpf_ENSMPUP00000015086 ..........................................................................-..
Mpf_ENSMPUP00000008387 ..........................................................................-..
Mpf_ENSMPUP00000015207 ..........................................................................-..
Mpf_ENSMPUP00000004217 ..........................................................................V..
Mpf_ENSMPUP00000015689 ..........................................................................-..
Mpf_ENSMPUP00000015159 ..........................................................................-..
Mpf_ENSMPUP00000018833 ..........................................................................-..
Mpf_ENSMPUP00000007866 ..........................................................................L..
Mpf_ENSMPUP00000007938 ..........................................................................-..
Mpf_ENSMPUP00000010694 ..........................................................................-..
Mpf_ENSMPUP00000013131 ..........................................................................-..
Mpf_ENSMPUP00000000312 ..........................................................................-..
Mpf_ENSMPUP00000019132 ..........................................................................-..
Mpf_ENSMPUP00000015959 ..........................................................................-..
Mpf_ENSMPUP00000012612 ..........................................................................-..
Mpf_ENSMPUP00000007938 ..........................................................................L..
Mpf_ENSMPUP00000007989 ..........................................................................L..
Mpf_ENSMPUP00000016156 ..........................................................................-..
Mpf_ENSMPUP00000013721 ..........................................................................Y..
Mpf_ENSMPUP00000005447 vtqgdvyraeteeipkifqilyanegecrkdvemepvqqaektnfqnhkghefiptlyhfpanceacakplwhvF..
Mpf_ENSMPUP00000015768 ..........................................................................-..
Mpf_ENSMPUP00000004215 ..........................................................................-..
Mpf_ENSMPUP00000010108 ..........................................................................R..
Mpf_ENSMPUP00000002188 ..........................................................................-..
Mpf_ENSMPUP00000013446 ..........................................................................Y..
Mpf_ENSMPUP00000012407 ..........................................................................G..
Mpf_ENSMPUP00000017043 ..........................................................................-..
Mpf_ENSMPUP00000007898 ..........................................................................-..
Mpf_ENSMPUP00000017064 ..........................................................................L..
Mpf_ENSMPUP00000009754 ..........................................................................-..
Mpf_ENSMPUP00000016461 ..........................................................................-..
Mpf_ENSMPUP00000008230 ..........................................................................R..
Mpf_ENSMPUP00000001993 ..........................................................................-..
Mpf_ENSMPUP00000014500 ..........................................................................-..
Mpf_ENSMPUP00000002405 ..........................................................................-..
Mpf_ENSMPUP00000002933 ..........................................................................E..
Mpf_ENSMPUP00000007268 ..........................................................................-..
Mpf_ENSMPUP00000010983 ..........................................................................-..
Mpf_ENSMPUP00000010498 ..........................................................................-..
Mpf_ENSMPUP00000018101 ..........................................................................D..
Mpf_ENSMPUP00000002033 ..........................................................................-..
Mpf_ENSMPUP00000010694 ..........................................................................T..
Mpf_ENSMPUP00000008353 ..........................................................................-..
Mpf_ENSMPUP00000009754 ..........................................................................-..
Mpf_ENSMPUP00000015718 ..........................................................................V..
Mpf_ENSMPUP00000002358 ..........................................................................D..
Mpf_ENSMPUP00000005077 ..........................................................................-..
Mpf_ENSMPUP00000009107 ..........................................................................M..
Mpf_ENSMPUP00000016101 ..........................................................................Y..
Mpf_ENSMPUP00000011911 ..........................................................................-..
Mpf_ENSMPUP00000007938 ..........................................................................E..
Mpf_ENSMPUP00000009676 ..........................................................................Y..
Mpf_ENSMPUP00000005809 ..........................................................................H..
Mpf_ENSMPUP00000016410 ..........................................................................-..
Mpf_ENSMPUP00000006638 ..........................................................................-..
Mpf_ENSMPUP00000005803 ..........................................................................-..
Mpf_ENSMPUP00000010983 ..........................................................................-..
Mpf_ENSMPUP00000000717 ..........................................................................-..
Mpf_ENSMPUP00000002793 ..........................................................................Y..
Mpf_ENSMPUP00000007833 ..........................................................................-..
Mpf_ENSMPUP00000002271 ..........................................................................-..
Mpf_ENSMPUP00000010974 ..........................................................................-..
Mpf_ENSMPUP00000010755 ..........................................................................-..
Mpf_ENSMPUP00000013112 ..........................................................................-..


                                      80                           90                               
                                       |                            |                               
d1dbha2                RLKEKFF..M......RKVQ......I.........NDKDD....TNE..........................YKH
Mpf_ENSMPUP00000000236 VHKPPVH..Irf....DEIS......F.........VNFAR....GTTtt........................RSF
Mpf_ENSMPUP00000001054 RFRHMIP..T......EALQ......V.........RALAS....ADAean.......................AVC
Mpf_ENSMPUP00000001986 KFRWLIP..I......SALQ......V.........RLGNTa...GTE..........................NNS
Mpf_ENSMPUP00000006133 --K----..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000009494 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000004093 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000012215 -F-----..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000016175 -------..-......----......-.........-----....-SS..........................RYF
Mpf_ENSMPUP00000009909 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010977 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000016638 -------..-......----......-.........E----....---..........................---
Mpf_ENSMPUP00000018612 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000018966 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000004660 --KGEFS..I......DGYN......V.........RMNNTlrk.DGK..........................KDC
Mpf_ENSMPUP00000002149 SKKGSID..V......EKIT......C.........VETVV....PEKnppperqiprrgeessemeqisiierFPY
Mpf_ENSMPUP00000018066 -------..-......----......L.........T----....-DNq.........................RKL
Mpf_ENSMPUP00000017958 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011450 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000016402 FFRRHYP..L......NTVT......F.........CDLD-....---..........................---
Mpf_ENSMPUP00000004951 --KNWVP..T......SKHA......V.........TVSYF....YDS..........................TRN
Mpf_ENSMPUP00000011363 -------..-......HEIRn.....I.........SCAAQ....DPE..........................DLS
Mpf_ENSMPUP00000015445 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000015195 --KGTFL..I......KGYS......V.........RMAPYlrk.DSK..........................KES
Mpf_ENSMPUP00000011751 YYKGRVD..M......DGQE......V.........VDLED....GKDrdlhvs....................VKN
Mpf_ENSMPUP00000009831 YYKGRID..M......DKYE......V.........VDIED....GRDddfnvs....................MKN
Mpf_ENSMPUP00000004111 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000005349 --KGFID..V......AKIK......C.........VEIVK....NDEgvvpcq....................NKY
Mpf_ENSMPUP00000006137 ---FKVS..A......QGIT......L.........TDNQR....---..........................-KL
Mpf_ENSMPUP00000009095 --LCSIP..I......ENIL......A.........VERLE....EESfk........................MKN
Mpf_ENSMPUP00000005832 -------..-......-NCA......I.........VRGIK....YNQ..........................ATP
Mpf_ENSMPUP00000014567 -FRRHYP..L......TTLR......F.........CGMDP....E--..........................-QR
Mpf_ENSMPUP00000015198 --KGEIP..W......SQEL......R.........PE---....-AK..........................NFK
Mpf_ENSMPUP00000008441 VAKDPVN..R......RACH......I.........LECCD....---..........................---
Mpf_ENSMPUP00000005146 TPKIGFP..W......SEIR......N.........I---S....FND..........................KKF
Mpf_ENSMPUP00000010667 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000000642 YYRGRTD..M......DDVE......L.........VDLED....GRDkdwnls....................VKN
Mpf_ENSMPUP00000015373 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000003213 -------..-......----......-.........--AAQ....DPE..........................DLC
Mpf_ENSMPUP00000012196 -----CQ..L......HRIS......F.........CADDK....TDK..........................RIF
Mpf_ENSMPUP00000012194 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000003212 -------..-......----......-.........--AAQ....DPE..........................DLC
Mpf_ENSMPUP00000001158 TPKIGFP..W......SEIR......N.........I---S....FND..........................KKF
Mpf_ENSMPUP00000010667 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013386 TLKGSIE..L......SRIK......C.........VEIVK....SDIsipch.....................YKY
Mpf_ENSMPUP00000016712 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000003302 TPKIGFP..W......SEIR......N.........I---S....FND..........................KKF
Mpf_ENSMPUP00000003768 ----L--..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000008012 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000002625 SRKGSIE..I......KKIR......C.........VEKVN....LEEqtpae.....................RQY
Mpf_ENSMPUP00000010667 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000006140 -------..-......ADAT......V.........TVISE....KSEedvlvecrv.................RFL
Mpf_ENSMPUP00000015670 --RGIIL..T......DNIT......N.........QLIEN....---..........................---
Mpf_ENSMPUP00000008341 -------..-......----......-.........--I--....---..........................---
Mpf_ENSMPUP00000017573 -------..-......----......-.........--C--....---..........................---
Mpf_ENSMPUP00000012859 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000012131 --IYTIP..V......KNIL......A.........VEKLE....ESSfn........................KKN
Mpf_ENSMPUP00000000172 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013200 TPKISFP..W......NEIR......N.........ISYSD....---..........................--K
Mpf_ENSMPUP00000003522 TFSPVLK..L......NAVL......V.........RSVAT....D--..........................KRA
Mpf_ENSMPUP00000011499 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011494 --ITCKD..M......RNLR......F.........ALKQE....GHS..........................RRD
Mpf_ENSMPUP00000012716 --KGDIL..Ld.....ENCC......V.........ESLPD....KDG..........................KKC
Mpf_ENSMPUP00000002913 ------V..V......INYS......I.........VKGLK....YNQ..........................ATP
Mpf_ENSMPUP00000003504 --RGTIP..Ld.....AQCC......V.........EVLPD....REG..........................KRC
Mpf_ENSMPUP00000004361 -------..-......-N--......-.........-----....---..........................---
Mpf_ENSMPUP00000017389 ---W---..-......-HYL......C.........LRRYG....YDS..........................NLF
Mpf_ENSMPUP00000015829 --KVSIP..L......SAIIevr...T.........TMPLE....MPE..........................KDN
Mpf_ENSMPUP00000003644 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000006376 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000014536 -------..-......----......-.........--ILK....ISY..........................KRS
Mpf_ENSMPUP00000011501 -------..-......----......-.........-----....---..........................NSC
Mpf_ENSMPUP00000017670 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000006727 -------..-......----......-.........-----....---..........................--I
Mpf_ENSMPUP00000000961 ----F--..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000004942 IYRDRLR..I......NRFA......W.........PKVLK....ISY..........................KRN
Mpf_ENSMPUP00000002151 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000014680 -----IS..L......SGIK......I.........I----....-DE..........................KTG
Mpf_ENSMPUP00000005563 TFSPVIK..L......NTVL......V.........RQVAT....DNK..........................ALF
Mpf_ENSMPUP00000011333 --LGSIL..L......PSFQ......I.........AMLTS....EDHvn........................RKY
Mpf_ENSMPUP00000000969 -------..-......TLVV......V.........EDDDQ....GKE..........................QEH
Mpf_ENSMPUP00000010395 RLKEKFF..M......RKVQ......I.........NDKDD....TSE..........................YKH
Mpf_ENSMPUP00000015361 ----KLR..I......NRFP......W.........PKVLK....ISY..........................KRS
Mpf_ENSMPUP00000001991 -------..-......----......-.........-----....---..........................--H
Mpf_ENSMPUP00000005637 KCSHFFQ..L......KNIS......F.........CGYHP....KNN..........................KYF
Mpf_ENSMPUP00000007307 ------K..L......TLVV......V.........EDDDQ....GRE..........................QEH
Mpf_ENSMPUP00000008193 -------..-......----......-.........-----....YNK..........................VTP
Mpf_ENSMPUP00000007177 MLRPVLR..L......TSAI......T.........REVAT....DHK..........................AFY
Mpf_ENSMPUP00000010360 SYKQSLN..M......AAVG......I.........TESVK....GDV..........................RKF
Mpf_ENSMPUP00000010611 HSEVPVS..L......KEAI......C.........EVALD....YKK..........................KKH
Mpf_ENSMPUP00000007161 --RKVIP..L......KMCF......A.........ARNLS....MPD..........................LEN
Mpf_ENSMPUP00000006134 ---DKLV..V......LECY......V.........RKDLV....YTK..........................ANP
Mpf_ENSMPUP00000004983 RLKEKFV..M......RKIQ......I.........CDKDD....TCE..........................YKN
Mpf_ENSMPUP00000001920 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013542 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000008337 --HPVIS..L......QKLI......V.........REVAN....EEK..........................AMF
Mpf_ENSMPUP00000013626 TISHMYA..D......IKCQ......K.........ISPEG....KAK..........................IQL
Mpf_ENSMPUP00000001949 --DGFVN..L......PDFT......V.........ERASE....-CK..........................KKH
Mpf_ENSMPUP00000017721 -------..-......----......-.........--CTP....SDP..........................EPR
Mpf_ENSMPUP00000001109 ---KNIP..L......KMCF......V.........TRSLA....SADp.........................ENR
Mpf_ENSMPUP00000001935 HCSHFFQ..M......KNIS......F.........CGCHP....RNS..........................CYF
Mpf_ENSMPUP00000006252 -------..-......----......-.........--A--....---..........................---
Mpf_ENSMPUP00000005676 --LHAQP..I......VSIR......V.........WGVGR....DSG..........................RDF
Mpf_ENSMPUP00000005196 -YYKEIP..L......SEIL......T.........VEPAQ....NFSlvppgt....................NPH
Mpf_ENSMPUP00000012589 HFKE---..-......----......-.........-----....---..........................TQF
Mpf_ENSMPUP00000010571 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011589 --LGSIP..L......LSFR......V.........AAVQP....SDNis........................RKH
Mpf_ENSMPUP00000005676 -------..-......--C-......-.........-----....---..........................---
Mpf_ENSMPUP00000002533 --RSSIP..V......SHIR......A.........VERVD....EGAfq........................LPH
Mpf_ENSMPUP00000004215 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013399 -------..-......----......-.........-----....---..........................NLF
Mpf_ENSMPUP00000010530 IYQGKLP..T......TGMT......I.........TKLED....SEN..........................HRN
Mpf_ENSMPUP00000006089 AYKRSFK..M......ADLG......L.........TECCG....ESN..........................LRF
Mpf_ENSMPUP00000016498 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000007327 -----I-..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000001749 SFKHCLK..M......DEVG......I.........TEYVK....GDN..........................RKF
Mpf_ENSMPUP00000016475 --RGIIP..L......ENLS......I.........REVED....-PR..........................KPN
Mpf_ENSMPUP00000013206 --LGSIP..L......PSYV......I.........SPVAP....EDRis........................RKY
Mpf_ENSMPUP00000006140 --LHSQP..I......ASIR......V.........WGVGR....DNG..........................RDF
Mpf_ENSMPUP00000005780 --PSVIS..L......QKLI......A.........REVAN....EER..........................GMF
Mpf_ENSMPUP00000001869 IYQGKIP..V......AGMV......V.........TRLDE....IEG..........................NDN
Mpf_ENSMPUP00000012475 --RGIIP..L......ENLS......I.........REVED....-SK..........................KPN
Mpf_ENSMPUP00000008316 -------..-......----......-.........---AN....MSH..........................NKS
Mpf_ENSMPUP00000001167 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000008230 -------..-......----......-.........-----....RDK..........................VMF
Mpf_ENSMPUP00000017717 -------..-......--CT......L.........RPGLV....YNK..........................VNP
Mpf_ENSMPUP00000010272 TYKQSFK..T......AEIG......L.........TENVG....DSG..........................LRF
Mpf_ENSMPUP00000003964 --RGIIP..L......ENLS......I.........REVDD....-PR..........................KPN
Mpf_ENSMPUP00000017478 IFRGRIN..T......EVME......V.........ENVED....GTAdyhsngyt..................VTN
Mpf_ENSMPUP00000010168 --YKEIP..L......SEIL......R.........ISSPQ....DFTnisqgs....................NPH
Mpf_ENSMPUP00000009546 --LRTIF..L......KDVLkt....H.........ECLVK....SGDllm.......................RDN
Mpf_ENSMPUP00000002870 --LRVIP..L......KEVHk.....V.........QECKQ....SDImm........................RDN
Mpf_ENSMPUP00000000151 VYKQAFK..T......ADMG......L.........TENIG....DSG..........................LCF
Mpf_ENSMPUP00000000216 TVRTRVG..I......DGMK......I.........VETHN....-EE..........................YPH
Mpf_ENSMPUP00000007012 DLKDFVN..L......HSFQ......V.........RDDSS....GDRenkk......................WTH
Mpf_ENSMPUP00000012096 ELKEVIE..L......LFHK......M.........TDDPT....NNKdvkk......................WSY
Mpf_ENSMPUP00000004281 VYKNKLL..T......SELG......V.........TEHVE....GDP..........................CKF
Mpf_ENSMPUP00000004460 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011499 --LASLP..L......LGYS......L.........TIPSE....SEDih........................KDY
Mpf_ENSMPUP00000003498 --LGSVL..L......PSYS......I.........RPDGP....GAPrg........................RRF
Mpf_ENSMPUP00000006723 HGEEPLA..L......RHAI......C.........EIAAN....YKK..........................KKH
Mpf_ENSMPUP00000006149 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011052 LFKNSIK..V......SCLC......L.........EENVE....NDP..........................CKF
Mpf_ENSMPUP00000015653 --EGLIN..V......SNYS......L.........ESGQD....-QK..........................KKY
Mpf_ENSMPUP00000014937 -------..-......----......-.........-----....--K..........................---
Mpf_ENSMPUP00000006713 VYKGHIP..C......SSLM......L.........IESTR....-DS..........................LCF
Mpf_ENSMPUP00000005370 --YKEIP..L......SEIL......S.........LEPAK....PSDlipnga....................NPH
Mpf_ENSMPUP00000017142 --MESMP..L......LGFT......I.........APEKEeg..SSE..........................VGP
Mpf_ENSMPUP00000011052 LYKSKLF..T......SELG......V.........TEHVE....GDP..........................CKF
Mpf_ENSMPUP00000000930 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000016865 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000000090 EMKEIID..L......QQYK......I.........ANNPT....TDKenkk......................WSY
Mpf_ENSMPUP00000012035 EEEQPIS..V......NACL......I.........DISYS....ETK..........................RKN
Mpf_ENSMPUP00000009068 --QGFIS..L......QGTR......V.........TELLP....GPEda........................GKH
Mpf_ENSMPUP00000000172 --LASLP..L......LGYS......V.........SVPKE....ADGvh........................KEH
Mpf_ENSMPUP00000013402 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000012726 --RLSIP..C......STITdvr...T.........TTALE....MPD..........................REN
Mpf_ENSMPUP00000010329 TYKAHIL..C......GNLM......L.........VEVIP....KEP..........................LSF
Mpf_ENSMPUP00000005886 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011911 -------..-......----......-.........-----....---..........................W--
Mpf_ENSMPUP00000013895 MYKTPIF..L......NEVL......V.........KLPTD....PSS..........................DEP
Mpf_ENSMPUP00000009754 --KRFIS..V......ACIS......R.........VAAIG....DQK..........................---
Mpf_ENSMPUP00000017452 --STVIS..L......KKLI......V.........REVAH....EEK..........................GLF
Mpf_ENSMPUP00000004281 MFKRSIK..M......NYLV......L.........EENVD....NDP..........................CKF
Mpf_ENSMPUP00000017577 GGEPLLS..L......HRAT......S.........EVASD....YKK..........................KKH
Mpf_ENSMPUP00000004977 --PSVVS..L......QNLI......V.........RDIAN....QEK..........................G--
Mpf_ENSMPUP00000017884 ECCMAIP..L......SQIV......F.........IE---....---..........................---
Mpf_ENSMPUP00000007027 KPQGQVE..Ln.....SRCQ......I.........VRGEG....---..........................-AQ
Mpf_ENSMPUP00000012725 --KGHID..L......AEVE......M.........VIPAG....-PSmgapkhts..................DKA
Mpf_ENSMPUP00000000871 ----CLP..L......EE--......-.........-----....---..........................---
Mpf_ENSMPUP00000006220 --LGAIH..L......RGCV......V.........TSVES....SSDvrkse.....................EEN
Mpf_ENSMPUP00000008418 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000003932 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000001861 -----W-..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000008418 SLIHCQP..L......VHIR......V.........WGVGS....SKG..........................RDF
Mpf_ENSMPUP00000006249 --QGCMY..L......PGST......V.........KEIAT....NPEev........................GKF
Mpf_ENSMPUP00000003836 SPLEVIK..L......EGAE......V.........GMDSS....-LG..........................KPF
Mpf_ENSMPUP00000015858 --SALIK..L......ANIR......A.........AEKVE....EKSfg........................SSH
Mpf_ENSMPUP00000002835 QL---FS..I......EDIQe.....V.........RKGHR....TEGmekfardvp.................EDR
Mpf_ENSMPUP00000004473 SVREKMD..I......SGLQ......V.........QDIVK....-PN..........................AAP
Mpf_ENSMPUP00000000137 --EGFIS..L......PEFK......I.........DRASE....C-R..........................KKY
Mpf_ENSMPUP00000001907 VYKSSIK..V......SCLG......L.........EGNLQ....GDP..........................CRF
Mpf_ENSMPUP00000014024 QVRTRID..V......AGMK......V.........RELTD....-AE..........................FPH
Mpf_ENSMPUP00000001742 --FDEVD..L......SDAS......V.........AEAST....-KN..........................ANN
Mpf_ENSMPUP00000000172 RIRGRLP..L......HGML......V.........EEGEH....ERP..........................VPH
Mpf_ENSMPUP00000005480 --FDEVD..L......TDAS......V.........AESST....-KN..........................VNN
Mpf_ENSMPUP00000018515 NKQHIIP..L......ENVT......I.........DSIKD....EGD..........................LRN
Mpf_ENSMPUP00000009502 --IRILD..L......TECS......A.........VQFDY....SQE..........................RVN
Mpf_ENSMPUP00000013672 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011336 SVRARID..V......DGME......L.........KESSN....-LN..........................LPR
Mpf_ENSMPUP00000001410 --KAKID..I......KSIK......E.........VRTGK....NTDifrsngisdqis..............EDC
Mpf_ENSMPUP00000003424 HGEVPVS..L......ARAQ......G.........SVAFD....YRK..........................RKH
Mpf_ENSMPUP00000007040 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000019493 RYNALYP..L......DGLA......V.........VNVKD....NPP..........................MKD
Mpf_ENSMPUP00000018830 RSQHVIP..L......EEVT......L.........EPLPE....TPR..........................AKN
Mpf_ENSMPUP00000003141 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010983 --KGTLE..I......RTA-......-.........KEIID....NTS..........................KEN
Mpf_ENSMPUP00000010498 --MGQWK..L......SDLR......R.........Y----....---..........................---
Mpf_ENSMPUP00000012786 DLKNAVS..V......HHAL......A.........SKATD....YEK..........................KPN
Mpf_ENSMPUP00000014114 -----VV..V......DDLR......L.........CSVKP....CEDie........................RRF
Mpf_ENSMPUP00000007256 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000005608 GCRGSIC..L......SKAV......I.........TPHDF....-DE..........................--C
Mpf_ENSMPUP00000002033 --KGVID..L......AEVE......A.........VAPGT....-PTmgapktvd..................EKA
Mpf_ENSMPUP00000016751 --RLTFP..L......PSVV......L.........YATHQ....ENK..........................RLF
Mpf_ENSMPUP00000016435 TAKPTFS..I......SDVEs.....V.........REGQE....-SEllrslaeelp................LEQ
Mpf_ENSMPUP00000001167 APKRSIP..L......ESCF......N.........INKRA....DSK..........................NKH
Mpf_ENSMPUP00000001585 --VDKLD..L......IDLT......C.........LTDQN....STVk.........................NCA
Mpf_ENSMPUP00000002351 SFKKSMK..L......VTLS......I.........RQLGR....GSS..........................RKF
Mpf_ENSMPUP00000011499 KVHGQLP..L......YGMT......I.........EESED....EWG..........................VPH
Mpf_ENSMPUP00000005375 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000015986 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000004747 -------..-......--VLf.....C.........ARGHD....GTT..........................ESN
Mpf_ENSMPUP00000009754 --NGEIR..A......SEIV......C.........LAVPP....PDThg........................FEH
Mpf_ENSMPUP00000002257 ------S..F......SKKK......I.........TLQNT....SDG..........................IKH
Mpf_ENSMPUP00000006734 VIRPPLL..V......DKIV......C.........RELRD....-PG..........................---
Mpf_ENSMPUP00000003502 VMQDPIY..R......IFYV......S.........HDSQD....---..........................-LK
Mpf_ENSMPUP00000011019 -----V-..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000003673 APQSLLT..M......EEIQ......S.........VEETQ....IKE..........................R-K
Mpf_ENSMPUP00000000383 -----WP..H......SQIR......E.........IHLRR....YNL..........................RRS
Mpf_ENSMPUP00000008997 DLKNAIR..V......HHAL......A.........TRASD....YSK..........................KSN
Mpf_ENSMPUP00000010040 --VVVDD..L......RLCT......V.........KLCPD....-SE..........................RRF
Mpf_ENSMPUP00000007257 --LESQP..L......LGFT......V.........TQVKD....ENS..........................ESR
Mpf_ENSMPUP00000016774 ELKNAIS..I......HHAL......A.........TRASD....YSK..........................RPH
Mpf_ENSMPUP00000001960 --QLDVN..L......LGSS......V.........IHKEKq...VRK..........................KEH
Mpf_ENSMPUP00000007610 -------..-......----......-.........-----....--Dgvfd......................PNC
Mpf_ENSMPUP00000017612 TYKGHIF..C......CNLS......V.........SESPR....D--..........................-PL
Mpf_ENSMPUP00000007907 --KAKLD..I......SAIKe.....I.........RLGKN....TET..........................FRN
Mpf_ENSMPUP00000014021 -------..-......----......-.........----D....---..........................---
Mpf_ENSMPUP00000008982 -------..-......--FQ......W.........REIRK....IST..........................CRK
Mpf_ENSMPUP00000005803 --KGIIP..L......SAIS......T.........VRVQG....DNK..........................---
Mpf_ENSMPUP00000002728 ----KIL..I......DSIYk.....V.........TEGRQ....SEIfhrqaeghfd................PSC
Mpf_ENSMPUP00000007017 SLRGSLVsaL......EDNG......V.........PTGVK....GNV..........................QGN
Mpf_ENSMPUP00000003752 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000001306 MYKTPIF..L......NEVL......V.........KLPTD....PSG..........................DEP
Mpf_ENSMPUP00000005338 --I----..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000001689 --KGCIY..L......DACI......-.........-DVVQ....CPKm.........................RRH
Mpf_ENSMPUP00000010415 --QMELP..L......QGCN......I.........TYTPK....DSKk.........................KKH
Mpf_ENSMPUP00000006220 --KGMIP..L......KGST......L.........TSPCQ....DFGk.........................RMF
Mpf_ENSMPUP00000016350 --RGVIN..L......STAQ......V.........EYSED....QQAmvk.......................TPN
Mpf_ENSMPUP00000018773 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000017599 PPLNNFS..V......AECQ......L.........MKTER....--P..........................RPN
Mpf_ENSMPUP00000016349 --RGVIN..L......STAQ......V.........EYSED....QQAmvk.......................TPN
Mpf_ENSMPUP00000015036 --AAPVC..I......GSCL......V.........DISYS....ETK..........................RRH
Mpf_ENSMPUP00000007938 --KGVIP..L......TAIE......M.........TRSSK....DNK..........................---
Mpf_ENSMPUP00000007257 KLNNMLS..L......AGMK......V.........RKPTQ....-EA..........................YQN
Mpf_ENSMPUP00000005203 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000000650 --LQEW-..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000007937 KPKGLID..L......SVCS......V.........YVVHD....SLFg.........................RPN
Mpf_ENSMPUP00000007017 PPKGRIL..L......DGCTi.....T.........CPCLE....YEN..........................RPL
Mpf_ENSMPUP00000012780 TCRGTIN..L......STAH......F.........D----....-TE..........................DSC
Mpf_ENSMPUP00000002522 -------..-......----......-.........-----....-E-..........................---
Mpf_ENSMPUP00000004905 VLGAFVK..L......TDEV......P.........WESSG....DPG..........................I--
Mpf_ENSMPUP00000011326 EPKGSIF..L......DSCM......G.........V-IQN....NKV..........................RRF
Mpf_ENSMPUP00000009449 MVDEPVG..V......HHSL......A.........TPATH....YTK..........................KPH
Mpf_ENSMPUP00000000014 DLDGEID..L......STCYd.....V.........TEYPV....--Q..........................RNY
Mpf_ENSMPUP00000012737 ELDGEID..L......RSCTd.....V.........TEYAV....--Q..........................RNY
Mpf_ENSMPUP00000002136 --QREAP..L......NNFSvaq...C.........QLMKT....ERP..........................RPN
Mpf_ENSMPUP00000017782 --RGEVF..Igske..SGYT......V.........LDGLP....PSTqghh......................WPH
Mpf_ENSMPUP00000013550 SRQNLLT..M......EQIL......S.........VEETQ....IK-..........................DKK
Mpf_ENSMPUP00000017362 --VGTVL..L......NACE......I.........IERPS....-KK..........................DGF
Mpf_ENSMPUP00000006996 --RGCVR..L......RGAV......I.........GIDDE....DDS..........................---
Mpf_ENSMPUP00000004785 --KGVIY..F......QAIEev....Y.........YDHLR....SAAkk........................RFF
Mpf_ENSMPUP00000014164 --HLRLA..L......DVCS......V.........TYVPK....DSRh.........................KRH
Mpf_ENSMPUP00000016592 EPKGCIF..L......DSCT......G.........V-VQN....NRL..........................RKY
Mpf_ENSMPUP00000000486 DPLLSYH..V......DVCL......A.........VQVDN....LDD..........................CDS
Mpf_ENSMPUP00000003712 --VVVED..L......RLCT......V.........KHCED....-IE..........................RRF
Mpf_ENSMPUP00000006850 --KGVIY..F......QAIEevyydhL.........RCAFK....SPN..........................PRL
Mpf_ENSMPUP00000015574 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000014962 -------..-......--L-......-.........-----....---..........................---
Mpf_ENSMPUP00000016814 VIRPPLM..L......EKLV......C.........R-PLR....D--..........................-PN
Mpf_ENSMPUP00000000139 --RFVLN..L......STAQ......V.........EYSED....QQAmlk.......................TPN
Mpf_ENSMPUP00000012020 --GLIQD..L......DNCS......V.........M-AVD....CED..........................RRY
Mpf_ENSMPUP00000006069 -------..-......-NIS......R.........VELTE....ESE..........................KVS
Mpf_ENSMPUP00000017142 RLKNTLS..V......ASMK......V.........SRPVM....-EK..........................VPY
Mpf_ENSMPUP00000013991 ARFETID..L......SQVA......L.........AESSC....-RN..........................LCH
Mpf_ENSMPUP00000010353 --KRRYL..L......QPIA......V.........EVFSGd...GRN..........................YLL
Mpf_ENSMPUP00000000014 LPQGTIN..M......NQCTd.....V.........VDGEG....RTG..........................QKF
Mpf_ENSMPUP00000009546 GSLQLTY..I......SKVS......I.........ATPKQ....KPK..........................TPF
Mpf_ENSMPUP00000012020 --RANFE..L......TSIT......Q.........FAAHQ....ENK..........................RLV
Mpf_ENSMPUP00000016751 --GLAMD..I......DNCS......V.........M-AVD....CED..........................RRY
Mpf_ENSMPUP00000000216 --QATIP..L......LGYV......V.........DDLPK....SAD..........................LPH
Mpf_ENSMPUP00000010854 --QGAFS..L......SGYNr.....V.........MRAAEet..TSN..........................NVF
Mpf_ENSMPUP00000016813 EPQELLQ..L......DGYT......Vdy.......TDPQP....GLE..........................GGR
Mpf_ENSMPUP00000002870 --VGAIK..L......TYISk.....V.........SDATKl...RPK..........................AEF
Mpf_ENSMPUP00000003651 HKPESVD..L......CGAH......I.........EWAKE....KSS..........................RKN
Mpf_ENSMPUP00000002370 IFRGRIN..T......EVME......V.........ENVDD....GTAdfhssghi..................VVN
Mpf_ENSMPUP00000006780 EPQELMQ..L......EGYT......Vdy.......TDPHP....GLQ..........................GGQ
Mpf_ENSMPUP00000002802 SPIELSK..V......QSVKv.....V.........ARKRR....DRS..........................LPR
Mpf_ENSMPUP00000011336 --QRSLP..L......IGFE......V.........GPPEA....GERpd........................RRH
Mpf_ENSMPUP00000003120 --KGSIK..M......AVCE......I.........KVHSA....DNT..........................R--
Mpf_ENSMPUP00000005803 --NGTIN..I......NEVI......C.........LAVHK....EDFylntg.....................PIF
Mpf_ENSMPUP00000004980 GCKGSIQ..M......AVCE......I.........QVHSV....DNT..........................R--
Mpf_ENSMPUP00000015621 --DLPYP..L......NNFSvak...C.........QLMKT....ERP..........................KPN
Mpf_ENSMPUP00000003141 -------..L......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013099 RPPAKLN..L......LTCQ......V.........KTNPE....E--..........................-KK
Mpf_ENSMPUP00000010983 --LGTLV..L......NSLC......S.........VVPPD....-EKifket.....................GYW
Mpf_ENSMPUP00000004910 --VGTVL..L......HCCE......L.........IERPS....-KK..........................DGF
Mpf_ENSMPUP00000016233 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000002953 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000011716 MPVDCIN..Irig...HECW......D.........IQPPD....GKP..........................KDC
Mpf_ENSMPUP00000007767 NPIGRIN..L......ANCT......S.........HQIEP....ANRefca......................RRN
Mpf_ENSMPUP00000014585 --QGQVF..Lgsne..QGYG......V.........YEDLPkgirGNR..........................WKA
Mpf_ENSMPUP00000014164 --VNAIA..L......RGCE......V.........APGFG....-PR..........................HPF
Mpf_ENSMPUP00000005886 -------..-......----......-.........H----....---..........................---
Mpf_ENSMPUP00000013797 AFQGLLP..L......MELS......V.........CPLEG....--S..........................REH
Mpf_ENSMPUP00000004108 KPRGTLQ..L......AGAV......I.........S---P....SDE..........................DSH
Mpf_ENSMPUP00000009167 -------..-......----......-.........-----....--Kdferakvvhqk...............KDC
Mpf_ENSMPUP00000016226 -------..-......EQCG......G.........CRRAN....TTD..........................RPH
Mpf_ENSMPUP00000014024 --HTSVP..L......LGYQ......V.........TAGTQ....ADS..........................R--
Mpf_ENSMPUP00000008448 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010607 -------..-......----......-.........-----....---..........................R--
Mpf_ENSMPUP00000015774 --RPPVK..L......TLLT......C.........QVRPN....-PE..........................EKK
Mpf_ENSMPUP00000008639 -------..-......----......-.........-----....---..........................R--
Mpf_ENSMPUP00000012941 KPEFTVD..L......KGAT......V.........EMASK....DKSs.........................KKN
Mpf_ENSMPUP00000016218 VYRQPIP..V......QELV......L.........EDLQD....GDVrmggsfrgafsnsdk...........AKN
Mpf_ENSMPUP00000007001 LVFDHAP..F......SSIRgekce.M.........KLHGP....---..........................HKN
Mpf_ENSMPUP00000001986 APRCALF..A......EDSI......V.........QSVPE....HPK..........................KEN
Mpf_ENSMPUP00000010415 --IVSVP..L......RGCD......V.........IPGLD....-SK..........................HPL
Mpf_ENSMPUP00000003836 --SGGLY..L......QGYK......V.........NEQTL....-SF..........................KQS
Mpf_ENSMPUP00000007027 --LGHLP..V......RDAR......I.........EEVDR....SCDsdedyeaggsrrlls...........SHC
Mpf_ENSMPUP00000002688 SLRDQLL..V......ESCD......N.........EELNS....SPGknsstmlysrqss.............ANH
Mpf_ENSMPUP00000001373 --PAKLN..L......LTCQ......V.........KPNAE....DK-..........................--K
Mpf_ENSMPUP00000013700 DCKWYIP..L......ADLV......F.........PSPEE....SEA..........................SPQ
Mpf_ENSMPUP00000016589 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000015325 --SGLYL..L......EGCV......C.........DRAPS....PKPalsgkeple.................KQH
Mpf_ENSMPUP00000001960 VAQQPLS..L......VGCE......V.........V-PDP....SPD..........................HLY
Mpf_ENSMPUP00000006310 -------..-......----......-.........---K-....---..........................---
Mpf_ENSMPUP00000016747 LYRQPIP..V......KDLL......L.........EDLQD....GEVrlggslrgafsnner...........IKN
Mpf_ENSMPUP00000013323 ---EREK..L......HGCIdv....G.........LSVMS....VKK..........................SSK
Mpf_ENSMPUP00000007350 HPKGVIP..L......GGCL......V.........EAREE....-PS..........................MPY
Mpf_ENSMPUP00000017588 --EGAID..I......REIK......E.........IRPGK....TSRdfdryqedpafrpd............QSH
Mpf_ENSMPUP00000007745 SLQDKLP..V......ADIK......A.........VVTGK....DCPhmkekgalkqnkev............LEL
Mpf_ENSMPUP00000006409 --LDSID..L......SSAV......F.........DCKAD....AEE..........................--G
Mpf_ENSMPUP00000015574 PPKLSVS..L......AGAC......T.........ISKRV....DAR..........................QRH
Mpf_ENSMPUP00000008365 TPEYTVD..L......RGAS......L.........SWAPK....DKSs.........................RKN
Mpf_ENSMPUP00000001054 IPKHAVW..V......ENSI......V.........QAVPE....HPK..........................KDF
Mpf_ENSMPUP00000017488 SLQEKIP..V......ADIK......A.........IVTGK....DCPhmkeksalkqnkev............LEL
Mpf_ENSMPUP00000005234 QVFDSAP..R......GLLR......V.........EELEDq...GQT..........................LAN
Mpf_ENSMPUP00000013182 DPIQQLN..L......KGCE......V.........VPDVN....VSG..........................QKF
Mpf_ENSMPUP00000011513 KPQGHIE..L......S---......-.........-----....---..........................---
Mpf_ENSMPUP00000005385 N------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000009077 -------..C......TRHC......L.........SNISD....---..........................-PF
Mpf_ENSMPUP00000001767 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000007827 GEDESVT..L......KSCT......R.........RKTDS....-IE..........................KRF
Mpf_ENSMPUP00000000541 --VETVE..L......GSYEk.....C.........QDLRA....LLK..........................RKH
Mpf_ENSMPUP00000001809 RPESSVD..L......RGAA......L.........AHGRH....LSS..........................RRN
Mpf_ENSMPUP00000005803 --DKMFS..L......GSLK......F.........YLGVKkkm.KPP..........................TSW
Mpf_ENSMPUP00000013182 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000005315 NIQEVFD..L......SDYEk.....C.........EELRK....SKSrskk......................NHS
Mpf_ENSMPUP00000014585 --KAVIS..I......KDLN......A.........TFETE....KIG..........................NPH
Mpf_ENSMPUP00000015166 KLHGSID..V......RLS-......-.........--VMS....INK..........................KAQ
Mpf_ENSMPUP00000002409 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000005807 --KYMLP..L......DNLK......I.........RDVEK....GFMs.........................NKH
Mpf_ENSMPUP00000013796 CFKGELP..L......STIH......V.........NLEEK....-EK..........................QIR
Mpf_ENSMPUP00000017782 --KAIMK..I......EHLN......A.........TFQPA....KIG..........................HPH
Mpf_ENSMPUP00000019464 --LSLVV..L......EGCT......V.........ELAEA....PVS..........................EEF
Mpf_ENSMPUP00000012725 -------..-......A---......-.........-----....---..........................---
Mpf_ENSMPUP00000010996 ALVVSIN..K......ETRI......R.........AMDKD....TKK..........................KIH
Mpf_ENSMPUP00000007938 --EREWP..L......EGSK......V.........YLGIRkkf.KPP..........................TPW
Mpf_ENSMPUP00000009654 RVLIQFN..IrdikigQECH......D.........VQPPE....GRS..........................RDG
Mpf_ENSMPUP00000005385 TPAHQMN..L......RGCE......V.........TPDVN....ISG..........................QKF
Mpf_ENSMPUP00000006310 EPVEKLN..L......RGCE......V.........VPDVN....VAG..........................RKF
Mpf_ENSMPUP00000007963 --LRIIN..L......NFCEqvdag.L.........TFNKK....ELQ..........................DSF
Mpf_ENSMPUP00000002310 --GKEID..L......LRTT......V.........KVPGK....RPP..........................RAT
Mpf_ENSMPUP00000000486 ALYATYQ..L......SHFQ......S.........ISVLG....NLE..........................AR-
Mpf_ENSMPUP00000007805 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010246 -------..-......----......-.........-----....I--..........................---
Mpf_ENSMPUP00000004460 --RGCPK..V......TEISnvk...C.........VTRLP....KET..........................KRQ
Mpf_ENSMPUP00000014791 QFIASVA..L......HRLL......V.........EDIPD....SKY..........................IKN
Mpf_ENSMPUP00000003154 KVHGSID..Vgl....SVMS......I.........K----....--K..........................KAR
Mpf_ENSMPUP00000005214 ACRALYP..M......AQCQ......L.........HRVFG....HSGgp........................CGG
Mpf_ENSMPUP00000003932 --RRVIT..L......YQCF......S.........VSQRA....DAK..........................YRH
Mpf_ENSMPUP00000008710 --GKEID..L......LRTT......V.........KVPGK....RLP..........................RAT
Mpf_ENSMPUP00000005632 -------..-......----......-.........-----....--Gsgkqnkdl..................YEL
Mpf_ENSMPUP00000002828 DCKWYIP..L......TDLS......F.........QTVDE....SEA..........................APS
Mpf_ENSMPUP00000017859 -----LY..L......TATH......V.........IFVEN....APD..........................TRK
Mpf_ENSMPUP00000013754 TPGKKVS..V......VGWM......V.........Q-LPD....DPE..........................HPD
Mpf_ENSMPUP00000004548 AKQGPLD..Lt.....LKYC......V.........RRKTE....SID..........................KRF
Mpf_ENSMPUP00000000646 ILH----..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000004473 --PRTIP..L......AGCTvs....V.........LDPVE....RPD..........................SRH
Mpf_ENSMPUP00000000402 ELVCFLQ..L......DHVN......V.........YYGQD....YRNkykap.....................TDH
Mpf_ENSMPUP00000007412 MVQDYAQ..V......DHIR......V.........QKMEP....SDPgllggggtrsss..............VPH
Mpf_ENSMPUP00000004935 -------..I......IDVT......I.........KQASQe...GSN..........................ESR
Mpf_ENSMPUP00000011513 --LGQIK..L......WEAK......V.........EEVDR....SCDsdedyeasgrslls............THY
Mpf_ENSMPUP00000001759 GSPEMFK..L......KSCI......-.........RRKTD....SID..........................KRF
Mpf_ENSMPUP00000008353 --VETCS..L......LRCE......S.........VGPAH....SDG..........................R--
Mpf_ENSMPUP00000012083 QFKNVNI..Y......YGIQ......C.........KMRYK....-AP..........................TDY
Mpf_ENSMPUP00000006956 GDGEVFF..L......KECT......K.........R-HTD....SID..........................RRF
Mpf_ENSMPUP00000014860 HLQYIAD..V......NESN......V.........YVVTQ....GRKlygmp.....................TDF
Mpf_ENSMPUP00000009647 SFRQSFP..L......VEMH......M.........QLFQN....-SY..........................YQF
Mpf_ENSMPUP00000005803 --ITIIP..M......NVAN......V.........KQVDR....--T..........................VKQ
Mpf_ENSMPUP00000005109 TSNKNVS..V......VGWM......-.........VMMAD....DPE..........................HPD
Mpf_ENSMPUP00000006149 --RCYHK..V......TELNnvk...N.........VARLP....KST..........................KKH
Mpf_ENSMPUP00000001981 --GKEMD..L......LRTT......V.........KVPGK....RPP..........................RAI
Mpf_ENSMPUP00000017916 TFCKSVG..L......LGMQ......F.........HLFEN....-EY..........................YSH
Mpf_ENSMPUP00000003318 KIKNKIK..L......SDMWtasc..V.........DEVGEg...NTN..........................ALK
Mpf_ENSMPUP00000017175 SFRQSFS..L......YGMQ......V.........LLFEN....-QY..........................YPN
Mpf_ENSMPUP00000016038 --IRAID..L......SECA......V.........WRHVG....-PGfprkefq...................NNF
Mpf_ENSMPUP00000016192 AVFVHAR..M......AELQ......V.........KDLSR....KLQgv........................PGH
Mpf_ENSMPUP00000015325 TKNGVIS..L......IDCT......L.........LEDPE....NTEedakganqdi................DHL
Mpf_ENSMPUP00000000660 QFFSEFG..N......SDIY......V.........SLAGK....--Kkhgaptn...................YGF
Mpf_ENSMPUP00000005493 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000009754 --EKEWP..V......RSLK......V.........YLGVKkkl.RPP..........................TCW
Mpf_ENSMPUP00000013796 AFQGLLP..L......MELS......V.........CPLEG....--S..........................REH
Mpf_ENSMPUP00000010667 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013126 VLPDNYS..L......NHLHew....V.........SSLLP....SPPaps.......................CRN
Mpf_ENSMPUP00000018046 --RHLQL..L......GGLEess...V.........FSLIA....GKKqysap.....................TDY
Mpf_ENSMPUP00000006359 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000015086 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000008387 KTGGVLS..L......IECT......L.........IEEPD....ASDddskgsgqvf................GHL
Mpf_ENSMPUP00000015207 -------..-......----......M.........IDTVE....-SR..........................DMF
Mpf_ENSMPUP00000004217 TYLGKVP..T......TGMQ......F.........LSGCT....EKP..........................---
Mpf_ENSMPUP00000015689 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000015159 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000018833 -------..-......----......-.........----P....---..........................---
Mpf_ENSMPUP00000007866 FTIAINK..E......TRVR......A.........GEPD-....--Qaag.......................RPL
Mpf_ENSMPUP00000007938 --ICFIE..L......QGCS......V.........R----....-ET..........................KSR
Mpf_ENSMPUP00000010694 --LRLIP..L......LHSR......F.........SQYVP....GTDls........................RQN
Mpf_ENSMPUP00000013131 -FKESLV..N......VPLQ......L.........IESVE....CRD..........................-IF
Mpf_ENSMPUP00000000312 --HHVFP..L......ATLW......A.........EPLSE....EAG..........................GVN
Mpf_ENSMPUP00000019132 --PKELS..F......ARIK......A.........VECVE....STG..........................RHI
Mpf_ENSMPUP00000015959 -------..-......----......-.........-----....--E..........................EPH
Mpf_ENSMPUP00000012612 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000007938 SLIQPQD..V......VCLG......V.........SPPPT....DPGdldr......................FPF
Mpf_ENSMPUP00000007989 QVLDYAH..R......SLVQ......A.........QQVPD....-PS..........................GPP
Mpf_ENSMPUP00000016156 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000013721 KILTSLD..Q......YLEL......V.........GNSLP....GTSsksgtapilkcp..............TQF
Mpf_ENSMPUP00000005447 KPPPALE..C......RRCH......V.........KCHRD....HLDkkedlisp..................CKV
Mpf_ENSMPUP00000015768 --LGSTT..L......TGYT......V.........LTSQR....-EY..........................L-H
Mpf_ENSMPUP00000004215 --RRVIR..L......SDCLr.....V.........AEASG....EASspr.......................DTS
Mpf_ENSMPUP00000010108 RLRSLVL..T......SLCS......V.........TGPER....RPK..........................-ET
Mpf_ENSMPUP00000002188 -------..-......----......-.........-----....--D..........................NLY
Mpf_ENSMPUP00000013446 MVLDIDK..L......FHVR......-.........-----....---..........................--P
Mpf_ENSMPUP00000012407 ALMQALD..L......RDPQ......FsatpvlasdVIHAQ....SRD..........................LPC
Mpf_ENSMPUP00000017043 --FVLLV..D......KEFK......I.........KVGKK....ETE..........................TKY
Mpf_ENSMPUP00000007898 --RNPLY..L......QSVK......L.........QEGSS....-ED..........................LKF
Mpf_ENSMPUP00000017064 KHIHLMP..L......SQIKk.....V.........LDIRE....TED..........................CHN
Mpf_ENSMPUP00000009754 --ITFID..M......SVGN......V.........KEADR....---..........................--R
Mpf_ENSMPUP00000016461 --YLHVF..L......NEVT......V.........LVPVL....-NE..........................TKH
Mpf_ENSMPUP00000008230 LDCKVIR..L......AECVsv....V.........PVSVE....SPPep........................GAA
Mpf_ENSMPUP00000001993 -------..-......----......V.........EVGIH....GQEkmqs......................VQK
Mpf_ENSMPUP00000014500 -CRGTIN..Lat....ANIT......V.........EDSCN....---..........................---
Mpf_ENSMPUP00000002405 -------..-......----......-.........-----....---..........................QEF
Mpf_ENSMPUP00000002933 EFELCLP..D......GDVS......I.........HGAVG....ASElantakad..................VPY
Mpf_ENSMPUP00000007268 -------..-......----......-.........-----....---..........................-DY
Mpf_ENSMPUP00000010983 -------..-......----......-.........-CASD....SPD..........................RPN
Mpf_ENSMPUP00000010498 --KGLRE..R......SSLT......L.........EDICG....LEPglpyeg....................LAH
Mpf_ENSMPUP00000018101 MRDGAFS..V......SSVW......L.........SNFIPvr..RKE..........................MPC
Mpf_ENSMPUP00000002033 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010694 RAEKTFS..V......YEIM......C.........KILKD....SDLldr.......................RKH
Mpf_ENSMPUP00000008353 MLSDSHG..I......ETIR......D.........ILPDT....SLG..........................GPS
Mpf_ENSMPUP00000009754 -------..-......----......-.........--SVQ....GDS..........................ENQ
Mpf_ENSMPUP00000015718 VVSQVID..M......RDEE......FsvssvlasdVIHAS....RKD..........................IPC
Mpf_ENSMPUP00000002358 LRDEEFS..V......SSVL......A.........SDVIH....ASRrd........................IPC
Mpf_ENSMPUP00000005077 -------..-......----......-.........-----....---..........................QDF
Mpf_ENSMPUP00000009107 APVATLD..L......RGAQ......C.........ERPGH....QHG..........................RKH
Mpf_ENSMPUP00000016101 VVKWNTA..L......PQVQ......V.........VEVGQ....ESG..........................---
Mpf_ENSMPUP00000011911 -ERRVIR..L......ADCV......S.........VLPAD....GEScpk.......................DTS
Mpf_ENSMPUP00000007938 DMVHLRR..L......QEIS......V.........VSAAD....TPD..........................KKE
Mpf_ENSMPUP00000009676 KLLWKLP..L......EDAD......-.........-----....---..........................---
Mpf_ENSMPUP00000005809 -------..L......TQ--......-.........-----....---..........................---
Mpf_ENSMPUP00000016410 --MHVLP..L......IGGK......V.........EEVKK....-HQ..........................HCL
Mpf_ENSMPUP00000006638 --ITHVV..L......KECH......V.........SVHSQ....DNKsle.......................L--
Mpf_ENSMPUP00000005803 --EDRMY..Lrrl...QELT......I.........STVVQ....NGE..........................KID
Mpf_ENSMPUP00000010983 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000000717 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000002793 LLKWSVP..L......GRVE......V.........VEYGS....SDGa.........................GEN
Mpf_ENSMPUP00000007833 -KMHILP..L......VGGK......V.........EEVKR....-RQ..........................HSL
Mpf_ENSMPUP00000002271 -------..-......----......-.........-----....---..........................---
Mpf_ENSMPUP00000010974 -------..-......----......-.........-----....---..........................-KH
Mpf_ENSMPUP00000010755 --FVQLF..D......PGFE......V.........RVGKR....STE..........................ARY
Mpf_ENSMPUP00000013112 -------..-......----......-.........-----....---..........................---


                                                                                                    
                                                                                                    
d1dbha2                .............................................................................
Mpf_ENSMPUP00000000236 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000006133 .............................................................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 .............................................................................
Mpf_ENSMPUP00000012215 .............................................................................
Mpf_ENSMPUP00000016175 .............................................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 .............................................................................
Mpf_ENSMPUP00000018612 .............................................................................
Mpf_ENSMPUP00000018966 .............................................................................
Mpf_ENSMPUP00000004660 .............................................................................
Mpf_ENSMPUP00000002149 .............................................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 .............................................................................
Mpf_ENSMPUP00000011363 .............................................................................
Mpf_ENSMPUP00000015445 .............................................................................
Mpf_ENSMPUP00000015195 .............................................................................
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 .............................................................................
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000000642 .............................................................................
Mpf_ENSMPUP00000015373 .............................................................................
Mpf_ENSMPUP00000003213 .............................................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 .............................................................................
Mpf_ENSMPUP00000003212 .............................................................................
Mpf_ENSMPUP00000001158 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 .............................................................................
Mpf_ENSMPUP00000003768 .............................................................................
Mpf_ENSMPUP00000008012 .............................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 .............................................................................
Mpf_ENSMPUP00000017573 .............................................................................
Mpf_ENSMPUP00000012859 .............................................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013200 .............................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 .............................................................................
Mpf_ENSMPUP00000002913 .............................................................................
Mpf_ENSMPUP00000003504 .............................................................................
Mpf_ENSMPUP00000004361 .............................................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 .............................................................................
Mpf_ENSMPUP00000006376 .............................................................................
Mpf_ENSMPUP00000014536 .............................................................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 .............................................................................
Mpf_ENSMPUP00000006727 kdgkllweqelynnfvynsprg.......................................................
Mpf_ENSMPUP00000000961 .............................................................................
Mpf_ENSMPUP00000004942 .............................................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 .............................................................................
Mpf_ENSMPUP00000010395 .............................................................................
Mpf_ENSMPUP00000015361 .............................................................................
Mpf_ENSMPUP00000001991 .............................................................................
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 .............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 .............................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 r............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 .............................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 .............................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 .............................................................................
Mpf_ENSMPUP00000010571 .............................................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 .............................................................................
Mpf_ENSMPUP00000007327 .............................................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 .............................................................................
Mpf_ENSMPUP00000012096 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 .............................................................................
Mpf_ENSMPUP00000016865 .............................................................................
Mpf_ENSMPUP00000000090 .............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013402 .............................................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 .............................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 .............................................................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 .............................................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 ngladqiceds..................................................................
Mpf_ENSMPUP00000014021 .............................................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 .............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 .............................................................................
Mpf_ENSMPUP00000018773 .............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 .............................................................................
Mpf_ENSMPUP00000015036 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 .............................................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 .............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 .............................................................................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 sfsvvtespnpal................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000016592 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 .............................................................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 .............................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 .............................................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 .............................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 vhpfpdheledmkmkisalkseiqkekankgqsraierlkkkmfenefllllnspti....................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 .............................................................................
Mpf_ENSMPUP00000001767 .............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 sacapisspktnglskdmsslhispnsgnvtsasgsqmasgislgsfgsrpdgmqqrsysvssadqwseatviansa
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 patapgtspranglaserstsqlgggtgapysasnpawagprpeglhqrscsvssadqwsdalppasgpaevlsssp
Mpf_ENSMPUP00000005632 .............................................................................
Mpf_ENSMPUP00000002828 iplvldeeldamkikisqikndiqrekrankgskaierlkkklseqesllllmspsm....................
Mpf_ENSMPUP00000017859 .............................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 safgpsasinglvkdmstvqmgegpeattptpspspspsslqpppdqtskhllkpdrnlaralstdctpsgdlspls
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 .............................................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 .............................................................................
Mpf_ENSMPUP00000015768 lldtlcpvssgehtqeesdpllempvnf.................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 vtqtdvyradakeiprifqilyanegeskkeqefpvepvgeksnyichkghefiptlyhfptnceacmkplwhmfkp
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 mfkclpde.....................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 rcppvhppeslavvanakpnqvyvgpgqlyqdlqnllhdlnvvgqisqlvgslrgnyqnlnqsvahdwtsglqrlil
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                                                                                    
                                                                                                    
d1dbha2                ...............................................................AFEI..........
Mpf_ENSMPUP00000000236 ...............................................................DFEI..........
Mpf_ENSMPUP00000001054 ...............................................................EIVH..........
Mpf_ENSMPUP00000001986 ...............................................................VWEL..........
Mpf_ENSMPUP00000006133 ...............................................................----..........
Mpf_ENSMPUP00000009494 ...............................................................----..........
Mpf_ENSMPUP00000004093 ...............................................................----..........
Mpf_ENSMPUP00000012215 ...............................................................----..........
Mpf_ENSMPUP00000016175 ...............................................................VIR-..........
Mpf_ENSMPUP00000009909 ...............................................................----..........
Mpf_ENSMPUP00000010977 ...............................................................--DL..........
Mpf_ENSMPUP00000016638 ...............................................................----..........
Mpf_ENSMPUP00000018612 ...............................................................----..........
Mpf_ENSMPUP00000018966 ...............................................................----..........
Mpf_ENSMPUP00000004660 ...............................................................CFEI..........
Mpf_ENSMPUP00000002149 ...............................................................PFQV..........
Mpf_ENSMPUP00000018066 ...............................................................FFRR..........
Mpf_ENSMPUP00000017958 ...............................................................----..........
Mpf_ENSMPUP00000011450 ...............................................................----..........
Mpf_ENSMPUP00000016402 ...............................................................----..........
Mpf_ENSMPUP00000004951 ...............................................................VYRI..........
Mpf_ENSMPUP00000011363 ...............................................................TFAY..........
Mpf_ENSMPUP00000015445 ...............................................................----..........
Mpf_ENSMPUP00000015195 ...............................................................CFEL..........
Mpf_ENSMPUP00000011751 ...............................................................AFRL..........
Mpf_ENSMPUP00000009831 ...............................................................AFKL..........
Mpf_ENSMPUP00000004111 ...............................................................----..........
Mpf_ENSMPUP00000005349 ...............................................................PFQV..........
Mpf_ENSMPUP00000006137 ...............................................................FFRR..........
Mpf_ENSMPUP00000009095 ...............................................................MFQV..........
Mpf_ENSMPUP00000005832 ...............................................................SFHQ..........
Mpf_ENSMPUP00000014567 ...............................................................KWQK..........
Mpf_ENSMPUP00000015198 ...............................................................TFFV..........
Mpf_ENSMPUP00000008441 ...............................................................----..........
Mpf_ENSMPUP00000005146 ...............................................................VIKP..........
Mpf_ENSMPUP00000010667 ...............................................................----..........
Mpf_ENSMPUP00000000642 ...............................................................AFKL..........
Mpf_ENSMPUP00000015373 ...............................................................----..........
Mpf_ENSMPUP00000003213 ...............................................................TFAY..........
Mpf_ENSMPUP00000012196 ...............................................................TFIC..........
Mpf_ENSMPUP00000012194 ...............................................................----..........
Mpf_ENSMPUP00000003212 ...............................................................TFAY..........
Mpf_ENSMPUP00000001158 ...............................................................VIKP..........
Mpf_ENSMPUP00000010667 ...............................................................--R-..........
Mpf_ENSMPUP00000013386 ...............................................................PFQV..........
Mpf_ENSMPUP00000016712 ...............................................................----..........
Mpf_ENSMPUP00000003302 ...............................................................VIKP..........
Mpf_ENSMPUP00000003768 ...............................................................----..........
Mpf_ENSMPUP00000008012 ...............................................................----..........
Mpf_ENSMPUP00000002625 ...............................................................PFQI..........
Mpf_ENSMPUP00000010667 ...............................................................----..........
Mpf_ENSMPUP00000006140 ...............................................................SFMG..........
Mpf_ENSMPUP00000015670 ...............................................................----..........
Mpf_ENSMPUP00000008341 ...............................................................----..........
Mpf_ENSMPUP00000017573 ...............................................................----..........
Mpf_ENSMPUP00000012859 ...............................................................----..........
Mpf_ENSMPUP00000012131 ...............................................................MFQV..........
Mpf_ENSMPUP00000000172 ...............................................................----..........
Mpf_ENSMPUP00000013200 ...............................................................EFTI..........
Mpf_ENSMPUP00000003522 ...............................................................FFVI..........
Mpf_ENSMPUP00000011499 ...............................................................----..........
Mpf_ENSMPUP00000011494 ...............................................................MFEI..........
Mpf_ENSMPUP00000012716 ...............................................................LFLI..........
Mpf_ENSMPUP00000002913 ...............................................................TFHQ..........
Mpf_ENSMPUP00000003504 ...............................................................MFCV..........
Mpf_ENSMPUP00000004361 ...............................................................----..........
Mpf_ENSMPUP00000017389 ...............................................................SFES..........
Mpf_ENSMPUP00000015829 ...............................................................TFVL..........
Mpf_ENSMPUP00000003644 ...............................................................----..........
Mpf_ENSMPUP00000006376 ...............................................................----..........
Mpf_ENSMPUP00000014536 ...............................................................NFY-..........
Mpf_ENSMPUP00000011501 ...............................................................GIEI..........
Mpf_ENSMPUP00000017670 ...............................................................----..........
Mpf_ENSMPUP00000006727 ...............................................................YFHT..........
Mpf_ENSMPUP00000000961 ...............................................................----..........
Mpf_ENSMPUP00000004942 ...............................................................NFYI..........
Mpf_ENSMPUP00000002151 ...............................................................----..........
Mpf_ENSMPUP00000014680 ...............................................................VIEH..........
Mpf_ENSMPUP00000005563 ...............................................................VISM..........
Mpf_ENSMPUP00000011333 ...............................................................AFKA..........
Mpf_ENSMPUP00000000969 ...............................................................TFVF..........
Mpf_ENSMPUP00000010395 ...............................................................AFEI..........
Mpf_ENSMPUP00000015361 ...............................................................SFFI..........
Mpf_ENSMPUP00000001991 ...............................................................LWKC..........
Mpf_ENSMPUP00000005637 ...............................................................GFIT..........
Mpf_ENSMPUP00000007307 ...............................................................TFVF..........
Mpf_ENSMPUP00000008193 ...............................................................TFHH..........
Mpf_ENSMPUP00000007177 ...............................................................VLFT..........
Mpf_ENSMPUP00000010360 ...............................................................EIWC..........
Mpf_ENSMPUP00000010611 ...............................................................VFKL..........
Mpf_ENSMPUP00000007161 ...............................................................LIEL..........
Mpf_ENSMPUP00000006134 ...............................................................TFHH..........
Mpf_ENSMPUP00000004983 ...............................................................AFEL..........
Mpf_ENSMPUP00000001920 ...............................................................----..........
Mpf_ENSMPUP00000013542 ...............................................................-I--..........
Mpf_ENSMPUP00000008337 ...............................................................LISA..........
Mpf_ENSMPUP00000013626 ...............................................................QLVL..........
Mpf_ENSMPUP00000001949 ...............................................................AFKI..........
Mpf_ENSMPUP00000017721 ...............................................................YLEI..........
Mpf_ENSMPUP00000001109 ...............................................................QLEI..........
Mpf_ENSMPUP00000001935 ...............................................................GFIT..........
Mpf_ENSMPUP00000006252 ...............................................................----..........
Mpf_ENSMPUP00000005676 ...............................................................AYVA..........
Mpf_ENSMPUP00000005196 ...............................................................CFEI..........
Mpf_ENSMPUP00000012589 ...............................................................ELRV..........
Mpf_ENSMPUP00000010571 ...............................................................----..........
Mpf_ENSMPUP00000011589 ...............................................................TFKVttcwvdeaga
Mpf_ENSMPUP00000005676 ...............................................................----..........
Mpf_ENSMPUP00000002533 ...............................................................VMQV..........
Mpf_ENSMPUP00000004215 ...............................................................----..........
Mpf_ENSMPUP00000013399 ...............................................................SFES..........
Mpf_ENSMPUP00000010530 ...............................................................AFEI..........
Mpf_ENSMPUP00000006089 ...............................................................EIWF..........
Mpf_ENSMPUP00000016498 ...............................................................-F--..........
Mpf_ENSMPUP00000007327 ...............................................................----..........
Mpf_ENSMPUP00000001749 ...............................................................EIWY..........
Mpf_ENSMPUP00000016475 ...............................................................CFEL..........
Mpf_ENSMPUP00000013206 ...............................................................SFKA..........
Mpf_ENSMPUP00000006140 ...............................................................AYVA..........
Mpf_ENSMPUP00000005780 ...............................................................LISA..........
Mpf_ENSMPUP00000001869 ...............................................................TFEI..........
Mpf_ENSMPUP00000012475 ...............................................................CFEL..........
Mpf_ENSMPUP00000008316 ...............................................................FFAL..........
Mpf_ENSMPUP00000001167 ...............................................................----..........
Mpf_ENSMPUP00000008230 ...............................................................SF--..........
Mpf_ENSMPUP00000017717 ...............................................................IFHH..........
Mpf_ENSMPUP00000010272 ...............................................................EIWF..........
Mpf_ENSMPUP00000003964 ...............................................................CFEL..........
Mpf_ENSMPUP00000017478 ...............................................................GWKI..........
Mpf_ENSMPUP00000010168 ...............................................................CFEI..........
Mpf_ENSMPUP00000009546 ...............................................................LFEI..........
Mpf_ENSMPUP00000002870 ...............................................................LFEI..........
Mpf_ENSMPUP00000000151 ...............................................................ELWF..........
Mpf_ENSMPUP00000000216 ...............................................................TFQV..........
Mpf_ENSMPUP00000007012 ...............................................................MFLL..........
Mpf_ENSMPUP00000012096 ...............................................................GFYL..........
Mpf_ENSMPUP00000004281 ...............................................................ALWS..........
Mpf_ENSMPUP00000004460 ...............................................................-L--..........
Mpf_ENSMPUP00000011499 ...............................................................VFKL..........
Mpf_ENSMPUP00000003498 ...............................................................TFTA..........
Mpf_ENSMPUP00000006723 ...............................................................VFKL..........
Mpf_ENSMPUP00000006149 ...............................................................----..........
Mpf_ENSMPUP00000011052 ...............................................................ALTS..........
Mpf_ENSMPUP00000015653 ...............................................................VFQL..........
Mpf_ENSMPUP00000014937 ...............................................................----..........
Mpf_ENSMPUP00000006713 ...............................................................TVTH..........
Mpf_ENSMPUP00000005370 ...............................................................CFEI..........
Mpf_ENSMPUP00000017142 ...............................................................IFHL..........
Mpf_ENSMPUP00000011052 ...............................................................ALWV..........
Mpf_ENSMPUP00000000930 ...............................................................---R..........
Mpf_ENSMPUP00000016865 ...............................................................----..........
Mpf_ENSMPUP00000000090 ...............................................................GFYL..........
Mpf_ENSMPUP00000012035 ...............................................................VFRL..........
Mpf_ENSMPUP00000009068 ...............................................................LFEI..........
Mpf_ENSMPUP00000000172 ...............................................................VFKL..........
Mpf_ENSMPUP00000013402 ...............................................................----..........
Mpf_ENSMPUP00000012726 ...............................................................TFVV..........
Mpf_ENSMPUP00000010329 ...............................................................SVFH..........
Mpf_ENSMPUP00000005886 ...............................................................----..........
Mpf_ENSMPUP00000011911 ...............................................................----..........
Mpf_ENSMPUP00000013895 ...............................................................VFHI..........
Mpf_ENSMPUP00000009754 ...............................................................-FEV..........
Mpf_ENSMPUP00000017452 ...............................................................LISM..........
Mpf_ENSMPUP00000004281 ...............................................................ALMN..........
Mpf_ENSMPUP00000017577 ...............................................................VFKL..........
Mpf_ENSMPUP00000004977 ...............................................................MFLI..........
Mpf_ENSMPUP00000017884 ...............................................................----..........
Mpf_ENSMPUP00000007027 ...............................................................TFQL..........
Mpf_ENSMPUP00000012725 ...............................................................FFDL..........
Mpf_ENSMPUP00000000871 ...............................................................----..........
Mpf_ENSMPUP00000006220 ...............................................................LFEI..........
Mpf_ENSMPUP00000008418 ...............................................................----..........
Mpf_ENSMPUP00000003932 ...............................................................----..........
Mpf_ENSMPUP00000001861 ...............................................................----..........
Mpf_ENSMPUP00000008418 ...............................................................AFVA..........
Mpf_ENSMPUP00000006249 ...............................................................VFEV..........
Mpf_ENSMPUP00000003836 ...............................................................VFNC..........
Mpf_ENSMPUP00000015858 ...............................................................VMQV..........
Mpf_ENSMPUP00000002835 ...............................................................CFSV..........
Mpf_ENSMPUP00000004473 ...............................................................TFII..........
Mpf_ENSMPUP00000000137 ...............................................................MAKA..........
Mpf_ENSMPUP00000001907 ...............................................................ALTS..........
Mpf_ENSMPUP00000014024 ...............................................................SFLV..........
Mpf_ENSMPUP00000001742 ...............................................................SFTI..........
Mpf_ENSMPUP00000000172 ...............................................................CFTI..........
Mpf_ENSMPUP00000005480 ...............................................................SFTV..........
Mpf_ENSMPUP00000018515 ...............................................................GWLI..........
Mpf_ENSMPUP00000009502 ...............................................................CFCL..........
Mpf_ENSMPUP00000013672 ...............................................................----..........
Mpf_ENSMPUP00000011336 ...............................................................TFLV..........
Mpf_ENSMPUP00000001410 ...............................................................AFSV..........
Mpf_ENSMPUP00000003424 ...............................................................VFKL..........
Mpf_ENSMPUP00000007040 ...............................................................----..........
Mpf_ENSMPUP00000019493 ...............................................................MFKL..........
Mpf_ENSMPUP00000018830 ...............................................................RWMI..........
Mpf_ENSMPUP00000003141 ...............................................................----..........
Mpf_ENSMPUP00000010983 ...............................................................GIDI..........
Mpf_ENSMPUP00000010498 ...............................................................----..........
Mpf_ENSMPUP00000012786 ...............................................................VLKL..........
Mpf_ENSMPUP00000014114 ...............................................................CFEV..........
Mpf_ENSMPUP00000007256 ...............................................................----..........
Mpf_ENSMPUP00000005608 ...............................................................RFDI..........
Mpf_ENSMPUP00000002033 ...............................................................FFDV..........
Mpf_ENSMPUP00000016751 ...............................................................GFVL..........
Mpf_ENSMPUP00000016435 ...............................................................GFTI..........
Mpf_ENSMPUP00000001167 ...............................................................LVAL..........
Mpf_ENSMPUP00000001585 ...............................................................KFTL..........
Mpf_ENSMPUP00000002351 ...............................................................EIAH..........
Mpf_ENSMPUP00000011499 ...............................................................CLTL..........
Mpf_ENSMPUP00000005375 ...............................................................----..........
Mpf_ENSMPUP00000015986 ...............................................................----..........
Mpf_ENSMPUP00000004747 ...............................................................CFAF..........
Mpf_ENSMPUP00000009754 ...............................................................TFEV..........
Mpf_ENSMPUP00000002257 ...............................................................AFQT..........
Mpf_ENSMPUP00000006734 ...............................................................SFLL..........
Mpf_ENSMPUP00000003502 ...............................................................IFSY..........
Mpf_ENSMPUP00000011019 ...............................................................----..........
Mpf_ENSMPUP00000003673 ...............................................................CLLL..........
Mpf_ENSMPUP00000000383 ...............................................................ALEI..........
Mpf_ENSMPUP00000008997 ...............................................................VLKL..........
Mpf_ENSMPUP00000010040 ...............................................................CFEV..........
Mpf_ENSMPUP00000007257 ...............................................................VFQL..........
Mpf_ENSMPUP00000016774 ...............................................................VFYL..........
Mpf_ENSMPUP00000001960 ...............................................................KLKI..........
Mpf_ENSMPUP00000007610 ...............................................................CFSI..........
Mpf_ENSMPUP00000017612 ...............................................................GFKV..........
Mpf_ENSMPUP00000007907 ...............................................................AFSI..........
Mpf_ENSMPUP00000014021 ...............................................................----..........
Mpf_ENSMPUP00000008982 ...............................................................KFTI..........
Mpf_ENSMPUP00000005803 ...............................................................-FEV..........
Mpf_ENSMPUP00000002728 ...............................................................CFTI..........
Mpf_ENSMPUP00000007017 ...............................................................LFKV..........
Mpf_ENSMPUP00000003752 ...............................................................-I--..........
Mpf_ENSMPUP00000001306 ...............................................................IFHI..........
Mpf_ENSMPUP00000005338 ...............................................................----..........
Mpf_ENSMPUP00000001689 ...............................................................AFEL..........
Mpf_ENSMPUP00000010415 ...............................................................ELKI..........
Mpf_ENSMPUP00000006220 ...............................................................VFKI..........
Mpf_ENSMPUP00000016350 ...............................................................IFAV..........
Mpf_ENSMPUP00000018773 ...............................................................----..........
Mpf_ENSMPUP00000017599 ...............................................................TFVI..........
Mpf_ENSMPUP00000016349 ...............................................................IFAV..........
Mpf_ENSMPUP00000015036 ...............................................................VFRL..........
Mpf_ENSMPUP00000007938 ...............................................................-FQV..........
Mpf_ENSMPUP00000007257 ...............................................................ELKI..........
Mpf_ENSMPUP00000005203 ...............................................................----..........
Mpf_ENSMPUP00000000650 ...............................................................----..........
Mpf_ENSMPUP00000007937 ...............................................................CFQI..........
Mpf_ENSMPUP00000007017 ...............................................................LIKL..........
Mpf_ENSMPUP00000012780 ...............................................................GIVL..........
Mpf_ENSMPUP00000002522 ...............................................................----..........
Mpf_ENSMPUP00000004905 ...............................................................YFSL..........
Mpf_ENSMPUP00000011326 ...............................................................AFEL..........
Mpf_ENSMPUP00000009449 ...............................................................VFQL..........
Mpf_ENSMPUP00000000014 ...............................................................GFQI..........
Mpf_ENSMPUP00000012737 ...............................................................GFQI..........
Mpf_ENSMPUP00000002136 ...............................................................TFII..........
Mpf_ENSMPUP00000017782 ...............................................................GITI..........
Mpf_ENSMPUP00000013550 ...............................................................CILL..........
Mpf_ENSMPUP00000017362 ...............................................................CFKL..........
Mpf_ENSMPUP00000006996 ...............................................................TFTI..........
Mpf_ENSMPUP00000004785 ...............................................................TFCV..........
Mpf_ENSMPUP00000014164 ...............................................................ELRF..........
Mpf_ENSMPUP00000016592 ...............................................................AFEL..........
Mpf_ENSMPUP00000000486 ...............................................................CFQV..........
Mpf_ENSMPUP00000003712 ...............................................................CFEV..........
Mpf_ENSMPUP00000006850 ...............................................................TFCV..........
Mpf_ENSMPUP00000015574 ...............................................................----..........
Mpf_ENSMPUP00000014962 ...............................................................----..........
Mpf_ENSMPUP00000016814 ...............................................................SFLV..........
Mpf_ENSMPUP00000000139 ...............................................................TFAV..........
Mpf_ENSMPUP00000012020 ...............................................................CFQI..........
Mpf_ENSMPUP00000006069 ...............................................................MVKV..........
Mpf_ENSMPUP00000017142 ...............................................................ALKI..........
Mpf_ENSMPUP00000013991 ...............................................................SFCV..........
Mpf_ENSMPUP00000010353 ...............................................................AF--..........
Mpf_ENSMPUP00000000014 ...............................................................SLCI..........
Mpf_ENSMPUP00000009546 ...............................................................CFVI..........
Mpf_ENSMPUP00000012020 ...............................................................GFVV..........
Mpf_ENSMPUP00000016751 ...............................................................CFQI..........
Mpf_ENSMPUP00000000216 ...............................................................SFKL..........
Mpf_ENSMPUP00000010854 ...............................................................PFKI..........
Mpf_ENSMPUP00000016813 ...............................................................AFFN..........
Mpf_ENSMPUP00000002870 ...............................................................CFVM..........
Mpf_ENSMPUP00000003651 ...............................................................VFQI..........
Mpf_ENSMPUP00000002370 ...............................................................GWKI..........
Mpf_ENSMPUP00000006780 ...............................................................MFFN..........
Mpf_ENSMPUP00000002802 ...............................................................AFEI..........
Mpf_ENSMPUP00000011336 ...............................................................VFKI..........
Mpf_ENSMPUP00000003120 ...............................................................-MEL..........
Mpf_ENSMPUP00000005803 ...............................................................TFEI..........
Mpf_ENSMPUP00000004980 ...............................................................-MDL..........
Mpf_ENSMPUP00000015621 ...............................................................TFII..........
Mpf_ENSMPUP00000003141 ...............................................................----..........
Mpf_ENSMPUP00000013099 ...............................................................CFDL..........
Mpf_ENSMPUP00000010983 ...............................................................NVTV..........
Mpf_ENSMPUP00000004910 ...............................................................CFKL..........
Mpf_ENSMPUP00000016233 ...............................................................----..........
Mpf_ENSMPUP00000002953 ...............................................................----..........
Mpf_ENSMPUP00000011716 ...............................................................MLQI..........
Mpf_ENSMPUP00000007767 ...............................................................TFEL..........
Mpf_ENSMPUP00000014585 ...............................................................GLTI..........
Mpf_ENSMPUP00000014164 ...............................................................AFRI..........
Mpf_ENSMPUP00000005886 ...............................................................----..........
Mpf_ENSMPUP00000013797 ...............................................................AFQI..........
Mpf_ENSMPUP00000004108 ...............................................................TFTV..........
Mpf_ENSMPUP00000009167 ...............................................................CFTI..........
Mpf_ENSMPUP00000016226 ...............................................................AFQV..........
Mpf_ENSMPUP00000014024 ...............................................................VFQL..........
Mpf_ENSMPUP00000008448 ...............................................................----..........
Mpf_ENSMPUP00000010607 ...............................................................----..........
Mpf_ENSMPUP00000015774 ...............................................................CFDL..........
Mpf_ENSMPUP00000008639 ...............................................................CLTI..........
Mpf_ENSMPUP00000012941 ...............................................................VFEL..........
Mpf_ENSMPUP00000016218 ...............................................................IFRV..........
Mpf_ENSMPUP00000007001 ...............................................................LFRL..........
Mpf_ENSMPUP00000001986 ...............................................................VFCL..........
Mpf_ENSMPUP00000010415 ...............................................................TFRL..........
Mpf_ENSMPUP00000003836 ...............................................................VIEL..........
Mpf_ENSMPUP00000007027 ...............................................................TLVI..........
Mpf_ENSMPUP00000002688 ...............................................................LFTL..........
Mpf_ENSMPUP00000001373 ...............................................................SFDL..........
Mpf_ENSMPUP00000013700 ...............................................................PFRI..........
Mpf_ENSMPUP00000016589 ...............................................................----..........
Mpf_ENSMPUP00000015325 ...............................................................YFTV..........
Mpf_ENSMPUP00000001960 ...............................................................SFRI..........
Mpf_ENSMPUP00000006310 ...............................................................----..........
Mpf_ENSMPUP00000016747 ...............................................................FFRV..........
Mpf_ENSMPUP00000013323 ...............................................................CIDL..........
Mpf_ENSMPUP00000007350 ...............................................................AMKI..........
Mpf_ENSMPUP00000017588 ...............................................................CFVI..........
Mpf_ENSMPUP00000007745 ...............................................................AFSI..........
Mpf_ENSMPUP00000006409 ...............................................................TFEI..........
Mpf_ENSMPUP00000015574 ...............................................................LIVL..........
Mpf_ENSMPUP00000008365 ...............................................................VLEL..........
Mpf_ENSMPUP00000001054 ...............................................................VFCL..........
Mpf_ENSMPUP00000017488 ...............................................................AFSI..........
Mpf_ENSMPUP00000005234 ...............................................................VFIL..........
Mpf_ENSMPUP00000013182 ...............................................................CIKL..........
Mpf_ENSMPUP00000011513 ...............................................................----..........
Mpf_ENSMPUP00000005385 ...............................................................----..........
Mpf_ENSMPUP00000009077 ...............................................................IFNM..........
Mpf_ENSMPUP00000001767 ...............................................................----..........
Mpf_ENSMPUP00000007827 ...............................................................CFDV..........
Mpf_ENSMPUP00000000541 ...............................................................RFIL..........
Mpf_ENSMPUP00000001809 ...............................................................VLHI..........
Mpf_ENSMPUP00000005803 ...............................................................GLTA..........
Mpf_ENSMPUP00000013182 ...............................................................----..........
Mpf_ENSMPUP00000005315 ...............................................................KFTL..........
Mpf_ENSMPUP00000014585 ...............................................................GLQI..........
Mpf_ENSMPUP00000015166 ...............................................................RIDL..........
Mpf_ENSMPUP00000002409 ...............................................................----..........
Mpf_ENSMPUP00000005807 ...............................................................VFAI..........
Mpf_ENSMPUP00000013796 ...............................................................SFLI..........
Mpf_ENSMPUP00000017782 ...............................................................GLQV..........
Mpf_ENSMPUP00000019464 ...............................................................AFAI..........
Mpf_ENSMPUP00000012725 ...............................................................----..........
Mpf_ENSMPUP00000010996 ...............................................................NFSV..........
Mpf_ENSMPUP00000007938 ...............................................................GFTL..........
Mpf_ENSMPUP00000009654 ...............................................................LLTV..........
Mpf_ENSMPUP00000005385 ...............................................................NIKL..........
Mpf_ENSMPUP00000006310 ...............................................................GIKL..........
Mpf_ENSMPUP00000007963 ...............................................................VFDI..........
Mpf_ENSMPUP00000002310 issdtglgdsvcsspsissttspkldpppsphanrkkhrrkkstsnfkadglsgtaeeqeenfEFII..........
Mpf_ENSMPUP00000000486 ...............................................................LVDT..........
Mpf_ENSMPUP00000007805 ...............................................................----..........
Mpf_ENSMPUP00000010246 ...............................................................----..........
Mpf_ENSMPUP00000004460 ...............................................................AVAI..........
Mpf_ENSMPUP00000014791 ...............................................................AFIL..........
Mpf_ENSMPUP00000003154 ...............................................................RIDL..........
Mpf_ENSMPUP00000005214 ...............................................................LLSL..........
Mpf_ENSMPUP00000003932 ...............................................................LIAL..........
Mpf_ENSMPUP00000008710 .......................klepppsphsnrkkhrrkkstgtprpdgpssaaeeaeesfEFVV..........
Mpf_ENSMPUP00000005632 ...............................................................AFSI..........
Mpf_ENSMPUP00000002828 ...............................................................AFRV..........
Mpf_ENSMPUP00000017859 ...............................................................ETWI..........
Mpf_ENSMPUP00000013754 ...............................................................IFQL..........
Mpf_ENSMPUP00000004548 ...............................................................CFDI..........
Mpf_ENSMPUP00000000646 ...............................................................----..........
Mpf_ENSMPUP00000004473 ...............................................................VWRL..........
Mpf_ENSMPUP00000000402 ...............................................................CLVL..........
Mpf_ENSMPUP00000007412 ...............................................................PFQV..........
Mpf_ENSMPUP00000004935 ...............................................................IVTI..........
Mpf_ENSMPUP00000011513 ...............................................................TIVI..........
Mpf_ENSMPUP00000001759 ...............................................................CFDI..........
Mpf_ENSMPUP00000008353 ...............................................................-FEL..........
Mpf_ENSMPUP00000012083 ...............................................................CFVL..........
Mpf_ENSMPUP00000006956 ...............................................................CFDV..........
Mpf_ENSMPUP00000014860 ...............................................................GFCI..........
Mpf_ENSMPUP00000009647 ...............................................................GIKL..........
Mpf_ENSMPUP00000005803 ...............................................................SFEI..........
Mpf_ENSMPUP00000005109 ...............................................................LFLL..........
Mpf_ENSMPUP00000006149 ...............................................................AIGI..........
Mpf_ENSMPUP00000001981 ............................repppspmvkkqrrkklttpsktegsagqaeeenfEFLI..........
Mpf_ENSMPUP00000017916 ...............................................................GITL..........
Mpf_ENSMPUP00000003318 ...............................................................SFVL..........
Mpf_ENSMPUP00000017175 ...............................................................GIRL..........
Mpf_ENSMPUP00000016038 ...............................................................VFVV..........
Mpf_ENSMPUP00000016192 ...............................................................VFLL..........
Mpf_ENSMPUP00000015325 ...............................................................DFKI..........
Mpf_ENSMPUP00000000660 ...............................................................CFKP..........
Mpf_ENSMPUP00000005493 ...............................................................----..........
Mpf_ENSMPUP00000009754 ...............................................................GFTV..........
Mpf_ENSMPUP00000013796 ...............................................................AFQI..........
Mpf_ENSMPUP00000010667 ...............................................................----..........
Mpf_ENSMPUP00000013126 ...............................................................V---..........
Mpf_ENSMPUP00000018046 ...............................................................GFCI..........
Mpf_ENSMPUP00000006359 ...............................................................----..........
Mpf_ENSMPUP00000015086 ...............................................................----..........
Mpf_ENSMPUP00000008387 ...............................................................DFKI..........
Mpf_ENSMPUP00000015207 ...............................................................QLHI..........
Mpf_ENSMPUP00000004217 ...............................................................----..........
Mpf_ENSMPUP00000015689 ...............................................................----..........
Mpf_ENSMPUP00000015159 ...............................................................----..........
Mpf_ENSMPUP00000018833 ...............................................................----..........
Mpf_ENSMPUP00000007866 ...............................................................TLSI..........
Mpf_ENSMPUP00000007938 ...............................................................SFDL..........
Mpf_ENSMPUP00000010694 ...............................................................AFQV..........
Mpf_ENSMPUP00000013131 ...............................................................QLHL..........
Mpf_ENSMPUP00000000312 ...............................................................GLKI..........
Mpf_ENSMPUP00000019132 ...............................................................YFTL..........
Mpf_ENSMPUP00000015959 ...............................................................CFQV..........
Mpf_ENSMPUP00000012612 ...............................................................----..........
Mpf_ENSMPUP00000007938 ...............................................................SFEL..........
Mpf_ENSMPUP00000007989 ...............................................................TFRL..........
Mpf_ENSMPUP00000016156 ...............................................................----..........
Mpf_ENSMPUP00000013721 ...............................................................PLIL..........
Mpf_ENSMPUP00000005447 ...............................................................SYDV..........
Mpf_ENSMPUP00000015768 ...............................................................PLFL..........
Mpf_ENSMPUP00000004215 ...............................................................AFFL..........
Mpf_ENSMPUP00000010108 ...............................................................GLWS..........
Mpf_ENSMPUP00000002188 ...............................................................TFVL..........
Mpf_ENSMPUP00000013446 .................................ppalecrrchikchkdhmdkkeeiiapckvYYDI..........
Mpf_ENSMPUP00000012407 ...............................................................IFRV..........
Mpf_ENSMPUP00000017043 ...............................................................GLRI..........
Mpf_ENSMPUP00000007898 ...............................................................CVLY..........
Mpf_ENSMPUP00000017064 ...............................................................AFAL..........
Mpf_ENSMPUP00000009754 ...............................................................SFDL..........
Mpf_ENSMPUP00000016461 ...............................................................SFAL..........
Mpf_ENSMPUP00000008230 ...............................................................AFRL..........
Mpf_ENSMPUP00000001993 ...............................................................VMSI..........
Mpf_ENSMPUP00000014500 ...............................................................-FII..........
Mpf_ENSMPUP00000002405 ...............................................................CFEV..........
Mpf_ENSMPUP00000002933 ...............................................................VLKM..........
Mpf_ENSMPUP00000007268 ...............................................................CFEV..........
Mpf_ENSMPUP00000010983 ...............................................................SFVI..........
Mpf_ENSMPUP00000010498 ...............................................................TLAI..........
Mpf_ENSMPUP00000018101 ...............................................................VFTV..........
Mpf_ENSMPUP00000002033 ...............................................................----..........
Mpf_ENSMPUP00000010694 ...............................................................CFTV..........
Mpf_ENSMPUP00000008353 ...............................................................FFKI..........
Mpf_ENSMPUP00000009754 ...............................................................VLVL..........
Mpf_ENSMPUP00000015718 ...............................................................IFRV..........
Mpf_ENSMPUP00000002358 ...............................................................IFRV..........
Mpf_ENSMPUP00000005077 ...............................................................CFEV..........
Mpf_ENSMPUP00000009107 ...............................................................AFSL..........
Mpf_ENSMPUP00000016101 ...............................................................----..........
Mpf_ENSMPUP00000011911 ...............................................................AFLL..........
Mpf_ENSMPUP00000007938 ...............................................................HLVL..........
Mpf_ENSMPUP00000009676 ...............................................................----..........
Mpf_ENSMPUP00000005809 ...............................................................----..........
Mpf_ENSMPUP00000016410 ...............................................................AFSS..........
Mpf_ENSMPUP00000006638 ...............................................................----..........
Mpf_ENSMPUP00000005803 ...............................................................VLLL..........
Mpf_ENSMPUP00000010983 ...............................................................----..........
Mpf_ENSMPUP00000000717 ...............................................................---I..........
Mpf_ENSMPUP00000002793 ...................................kkeeairaadccriqlqlpgkqdksgrpT---..........
Mpf_ENSMPUP00000007833 ...............................................................AFSS..........
Mpf_ENSMPUP00000002271 ...............................................................----..........
Mpf_ENSMPUP00000010974 ...............................................................VFAI..........
Mpf_ENSMPUP00000010755 ...............................................................GVRI..........
Mpf_ENSMPUP00000013112 ...............................................................----..........


                               100                                                              110 
                                 |                                                                | 
d1dbha2                ..........I.......LKD.......................E.N.......................S.VIFSA
Mpf_ENSMPUP00000000236 ..........E.......TKQ.......................G.T.......................Q.YTFSS
Mpf_ENSMPUP00000001054 ..........Vksese..GRP.......................E.R.......................V.FHLCC
Mpf_ENSMPUP00000001986 ..........I.......HTKseiegrp................E.T.......................V.FQLCC
Mpf_ENSMPUP00000006133 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000009494 ..........-.......--T.......................Q.R.......................I.KVLNA
Mpf_ENSMPUP00000004093 ..........-.......---.......................M.R.......................A.KLFRF
Mpf_ENSMPUP00000012215 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016175 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000009909 ..........-.......---.......................-.-.......................-.---A-
Mpf_ENSMPUP00000010977 ..........F.......IST.......................Q.R.......................I.KVLNA
Mpf_ENSMPUP00000016638 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000018612 ..........-.......---.......................-.-.......................-.-LFRF
Mpf_ENSMPUP00000018966 ..........-.......---.......................-.-.......................-.-LFRF
Mpf_ENSMPUP00000004660 ..........S.......APD.......................K.R.......................I.YQFTA
Mpf_ENSMPUP00000002149 ..........V.......YD-.......................E.G.......................P.LYVFS
Mpf_ENSMPUP00000018066 ..........H.......YP-.......................V.S.......................S.VIFCA
Mpf_ENSMPUP00000017958 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011450 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016402 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004951 ..........I.......SLD.......................-.-.......................-.-----
Mpf_ENSMPUP00000011363 ..........I.......TKD.......................-.-.......................-.-----
Mpf_ENSMPUP00000015445 ..........-.......---.......................N.T.......................V.FGLGF
Mpf_ENSMPUP00000015195 ..........T.......SQD.......................R.R.......................S.YEFTA
Mpf_ENSMPUP00000011751 ..........Lc......GTT.......................G.E.......................S.HLLCA
Mpf_ENSMPUP00000009831 ..........H.......NKEt......................E.E.......................I.HLFFA
Mpf_ENSMPUP00000004111 ..........F.......VST.......................K.R.......................V.KVLTA
Mpf_ENSMPUP00000005349 ..........V.......HD-.......................A.N.......................T.LYIFA
Mpf_ENSMPUP00000006137 ..........H.......YP-.......................V.N.......................S.ITFSS
Mpf_ENSMPUP00000009095 ..........I.......QP-.......................E.R.......................A.LYIQA
Mpf_ENSMPUP00000005832 ..........W.......RDA.......................R.Q.......................V.WGLNF
Mpf_ENSMPUP00000014567 ..........Y.......CKP.......................S.W.......................I.FGFVA
Mpf_ENSMPUP00000015198 ..........H.......TPN.......................-.R.......................T.YYLMD
Mpf_ENSMPUP00000008441 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005146 ..........I.......DKK.......................A.P.......................D.FVFYA
Mpf_ENSMPUP00000010667 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000000642 ..........V.......SKTt......................D.E.......................V.HLFCA
Mpf_ENSMPUP00000015373 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000003213 ..........I.......TKD.......................-.-.......................-.-----
Mpf_ENSMPUP00000012196 ..........K.......DS-.......................-.-.......................-.-----
Mpf_ENSMPUP00000012194 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000003212 ..........I.......TKD.......................-.-.......................-.-----
Mpf_ENSMPUP00000001158 ..........I.......DKK.......................A.P.......................D.FVFYA
Mpf_ENSMPUP00000010667 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013386 ..........V.......HD-.......................N.Y.......................L.LYVFA
Mpf_ENSMPUP00000016712 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000003302 ..........I.......DKK.......................A.P.......................D.FVFYA
Mpf_ENSMPUP00000003768 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008012 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000002625 ..........V.......YKD.......................-.G.......................L.LYVYA
Mpf_ENSMPUP00000010667 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000006140 ..........V.......GKD.......................V.H.......................T.FAFIM
Mpf_ENSMPUP00000015670 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008341 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000017573 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000012859 ..........-.......---.......................-.-.......................F.LNFMA
Mpf_ENSMPUP00000012131 ..........I.......HM-.......................E.K.......................P.LYVQA
Mpf_ENSMPUP00000000172 ..........-.......---.......................Q.D.......................T.LEFLL
Mpf_ENSMPUP00000013200 ..........K.......PLD.......................K.K.......................I.DVFKF
Mpf_ENSMPUP00000003522 ..........C.......TSElgp....................P.Q.......................I.YELVA
Mpf_ENSMPUP00000011499 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011494 ..........L.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000012716 ..........K.......CFD.......................-.K.......................T.FEISA
Mpf_ENSMPUP00000002913 ..........W.......RDA.......................R.Q.......................V.YGLNF
Mpf_ENSMPUP00000003504 ..........K.......TA-.......................T.R.......................T.YEMSA
Mpf_ENSMPUP00000004361 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000017389 ..........G.......RRCqtg....................Q.G.......................I.FAFKC
Mpf_ENSMPUP00000015829 ..........K.......VEN.......................G.A.......................E.YILET
Mpf_ENSMPUP00000003644 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000006376 ..........-.......---.......................-.-.......................F.TYMVA
Mpf_ENSMPUP00000014536 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011501 ..........V.......CKD.......................M.R.......................N.LRLAY
Mpf_ENSMPUP00000017670 ..........-.......---.......................-.-.......................Y.-----
Mpf_ENSMPUP00000006727 ..........F.......AGD.......................T.C.......................Q.VALNF
Mpf_ENSMPUP00000000961 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004942 ..........K.......IRP.......................G.-.......................-.-----
Mpf_ENSMPUP00000002151 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000014680 ..........E.......HP-.......................V.N.......................K.ISFIA
Mpf_ENSMPUP00000005563 ..........S.......DNG.......................A.Q.......................I.YELVA
Mpf_ENSMPUP00000011333 ..........A.......HPN.......................M.R.......................T.YYFCT
Mpf_ENSMPUP00000000969 ..........Rld.....HP-.......................-.-.......................-.-----
Mpf_ENSMPUP00000010395 ..........I.......LKD.......................E.N.......................S.VIFSA
Mpf_ENSMPUP00000015361 ..........K.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000001991 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005637 ..........K.......HP-.......................-.-.......................-.-----
Mpf_ENSMPUP00000007307 ..........R.......LDS.......................-.-.......................-.-----
Mpf_ENSMPUP00000008193 ..........W.......KID.......................D.K.......................K.FGLTF
Mpf_ENSMPUP00000007177 ..........W.......DQE.......................A.Q.......................I.YELVA
Mpf_ENSMPUP00000010360 ..........N.......GR-.......................E.E.......................V.YIVQA
Mpf_ENSMPUP00000010611 ..........R.......LND.......................G.N.......................E.YLFQA
Mpf_ENSMPUP00000007161 ..........H.......SPDs......................R.N.......................T.LILRC
Mpf_ENSMPUP00000006134 ..........W.......KVD.......................N.R.......................K.FGLTF
Mpf_ENSMPUP00000004983 ..........V.......SKD.......................E.N.......................S.IIFAA
Mpf_ENSMPUP00000001920 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013542 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008337 ..........S.......LRG.......................P.E.......................M.YEIYT
Mpf_ENSMPUP00000013626 ..........H.......AGD.......................T.T.......................N.FHFSN
Mpf_ENSMPUP00000001949 ..........S.......HPQ.......................I.K.......................T.FYFAA
Mpf_ENSMPUP00000017721 ..........C.......SADg......................Q.D.......................T.LFLRA
Mpf_ENSMPUP00000001109 ..........H.......SPDa......................K.H.......................T.VILRS
Mpf_ENSMPUP00000001935 ..........K.......HP-.......................-.-.......................-.-----
Mpf_ENSMPUP00000006252 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005676 ..........Rdkl....TQM.......................L.K.......................C.HVFRC
Mpf_ENSMPUP00000005196 ..........V.......TAN.......................V.T.......................Y.F----
Mpf_ENSMPUP00000012589 ..........L.......GKDcn.....................E.T.......................S.FFFEA
Mpf_ENSMPUP00000010571 ..........-.......---.......................-.-.......................-.-YLYV
Mpf_ENSMPUP00000011589 gpthclspqaE.......HAG.......................V.R.......................T.YFFSA
Mpf_ENSMPUP00000005676 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000002533 ..........L.......TQDaagv...................L.H.......................T.TYLQC
Mpf_ENSMPUP00000004215 ..........-.......--D.......................-.-.......................-.-----
Mpf_ENSMPUP00000013399 ..........Grrc....QTG.......................Q.G.......................I.FAFKC
Mpf_ENSMPUP00000010530 ..........S.......GSM.......................I.E.......................R.ILVSC
Mpf_ENSMPUP00000006089 ..........R.......RRKa......................R.D.......................T.FVLQA
Mpf_ENSMPUP00000016498 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000007327 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000001749 ..........A.......GK-.......................E.E.......................V.YIVQA
Mpf_ENSMPUP00000016475 ..........Y.......NPShkgqvikackteadgrvvegn..H.V.......................V.YRISA
Mpf_ENSMPUP00000013206 ..........V.......HTGmraliynssaggsqaeqsg....M.R.......................T.YYFSA
Mpf_ENSMPUP00000006140 ..........R.......DKDtri....................L.K.......................C.HVFRC
Mpf_ENSMPUP00000005780 ..........S.......SAG.......................P.E.......................M.YEIHT
Mpf_ENSMPUP00000001869 ..........T.......GN-.......................I.E.......................R.IVIHC
Mpf_ENSMPUP00000012475 ..........Y.......IPDnkdqvikackteadgrvvegn..H.T.......................V.YRISA
Mpf_ENSMPUP00000008316 ..........Ela.....NK-.......................E.E.......................T.IQFQT
Mpf_ENSMPUP00000001167 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008230 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000017717 ..........W.......SLG.......................D.C.......................K.FGLTF
Mpf_ENSMPUP00000010272 ..........Rrr.....RKS.......................Q.D.......................T.YILQA
Mpf_ENSMPUP00000003964 ..........Y.......IPNnkgqlikackteadgrvvegn..H.M.......................V.YRISA
Mpf_ENSMPUP00000017478 ..........Hn......TAK.......................N.K.......................W.FVCMA
Mpf_ENSMPUP00000010168 ..........I.......TDT.......................-.M.......................V.Y----
Mpf_ENSMPUP00000009546 ..........I.......TS-.......................S.R.......................T.FYIQA
Mpf_ENSMPUP00000002870 ..........V.......TS-.......................S.R.......................T.FYVQA
Mpf_ENSMPUP00000000151 ..........Rr......RRA.......................R.E.......................A.YTLQA
Mpf_ENSMPUP00000000216 ..........S.......GK-.......................E.R.......................T.LELQA
Mpf_ENSMPUP00000007012 ..........Ie......DQG.......................A.Q.......................G.YELFF
Mpf_ENSMPUP00000012096 ..........Ih......LQG.......................K.Q.......................G.FQFFC
Mpf_ENSMPUP00000004281 ..........Grt.....P-Ss......................D.N.......................K.TVLKA
Mpf_ENSMPUP00000004460 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011499 ..........H.......FK-.......................S.H.......................V.YYFRA
Mpf_ENSMPUP00000003498 ..........E.......HPG.......................M.R.......................T.YVLAA
Mpf_ENSMPUP00000006723 ..........R.......LSN.......................G.S.......................E.WLFHG
Mpf_ENSMPUP00000006149 ..........-.......---.......................-.-.......................-.F----
Mpf_ENSMPUP00000011052 ..........R.......TGGv......................V.E.......................T.FILHS
Mpf_ENSMPUP00000015653 ..........T.......HDM.......................Y.K.......................P.FIFAA
Mpf_ENSMPUP00000014937 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000006713 ..........Y.......KHS.......................K.Q.......................Q.YNIQA
Mpf_ENSMPUP00000005370 ..........T.......TAN.......................V.V.......................Y.Y----
Mpf_ENSMPUP00000017142 ..........Y.......HKK.......................T.L.......................F.YSFKA
Mpf_ENSMPUP00000011052 ..........Grtp....TS-.......................D.N.......................K.IVLKA
Mpf_ENSMPUP00000000930 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016865 ..........-.......---.......................-.-.......................-.----A
Mpf_ENSMPUP00000000090 ..........Ih......TQG.......................Q.N.......................G.LEFYC
Mpf_ENSMPUP00000012035 ..........T.......TPD.......................-.C.......................E.CLFQA
Mpf_ENSMPUP00000009068 ..........S.......PGGagerekvpan.............P.E.......................A.LLLMA
Mpf_ENSMPUP00000000172 ..........Q.......FK-.......................S.H.......................V.YFFRA
Mpf_ENSMPUP00000013402 ..........-.......---.......................-.-.......................T.-----
Mpf_ENSMPUP00000012726 ..........K.......VEG.......................P.S.......................E.YVLET
Mpf_ENSMPUP00000010329 ..........Y.......KNP.......................K.L.......................Q.HTVQA
Mpf_ENSMPUP00000005886 ..........-.......---.......................-.V.......................C.YVFQC
Mpf_ENSMPUP00000011911 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013895 ..........S.......HID.......................-.R.......................V.YTLRT
Mpf_ENSMPUP00000009754 ..........I.......TN-.......................N.R.......................T.FAFRA
Mpf_ENSMPUP00000017452 ..........G.......MKD.......................P.E.......................M.VEVHA
Mpf_ENSMPUP00000004281 ..........R.......ET-.......................S.E.......................R.VILQA
Mpf_ENSMPUP00000017577 ..........Q.......TQD.......................G.S.......................E.FLLQA
Mpf_ENSMPUP00000004977 ..........S.......AAP.......................P.E.......................M.YEVHT
Mpf_ENSMPUP00000017884 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000007027 ..........I.......SE-.......................K.K.......................T.YYLTA
Mpf_ENSMPUP00000012725 ..........K.......TS-.......................K.R.......................V.YNFCA
Mpf_ENSMPUP00000000871 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000006220 ..........I.......TAD.......................E.V.......................H.YFLQA
Mpf_ENSMPUP00000008418 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000003932 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000001861 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008418 ..........G.......DKDscm....................L.K.......................C.HVFRC
Mpf_ENSMPUP00000006249 ..........I.......PASwdqsrtg................Q.D.......................S.YVLMA
Mpf_ENSMPUP00000003836 ..........Tp......QSG.......................N.R.......................T.FCFCA
Mpf_ENSMPUP00000015858 ..........I.......YEDdagk...................A.Q.......................T.MYLQC
Mpf_ENSMPUP00000002835 ..........V.......FKDq......................R.N.......................T.LDLIA
Mpf_ENSMPUP00000004473 ..........T.......GR-.......................R.R.......................C.LELQT
Mpf_ENSMPUP00000000137 ..........L.......YKK.......................K.K.......................R.FFFSK
Mpf_ENSMPUP00000001907 ..........R.......GPEgg.....................I.Q.......................R.YVLQS
Mpf_ENSMPUP00000014024 ..........S.......GK-.......................Q.R.......................T.LELQA
Mpf_ENSMPUP00000001742 ..........I.......TP-.......................F.R.......................R.LMLCA
Mpf_ENSMPUP00000000172 ..........C.......AA-.......................Q.K.......................T.VVVAA
Mpf_ENSMPUP00000005480 ..........I.......TP-.......................C.R.......................K.LILCA
Mpf_ENSMPUP00000018515 ..........K.......TP-.......................T.K.......................S.FAVYA
Mpf_ENSMPUP00000009502 ..........V.......FP-.......................F.R.......................T.FYLCA
Mpf_ENSMPUP00000013672 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011336 ..........S.......GK-.......................Q.R.......................S.LELQA
Mpf_ENSMPUP00000001410 ..........Iy......GEN.......................Y.E.......................S.LDLVA
Mpf_ENSMPUP00000003424 ..........G.......LQD.......................G.K.......................E.YLFQA
Mpf_ENSMPUP00000007040 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000019493 ..........L.......MFP.......................-.E.......................S.RIFQA
Mpf_ENSMPUP00000018830 ..........K.......TA-.......................R.K.......................S.FVVSA
Mpf_ENSMPUP00000003141 ..........-.......---.......................Y.I.......................C.YVFQC
Mpf_ENSMPUP00000010983 ..........I.......MAD.......................-.R.......................T.FHLIA
Mpf_ENSMPUP00000010498 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000012786 ..........K.......TAD.......................W.R.......................V.LLFQA
Mpf_ENSMPUP00000014114 ..........V.......SP-.......................T.K.......................S.CMLQA
Mpf_ENSMPUP00000007256 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005608 ..........S.......VND.......................-.S.......................V.WYLRA
Mpf_ENSMPUP00000002033 ..........K.......TT-.......................R.R.......................V.YNFCA
Mpf_ENSMPUP00000016751 ..........R.......TSG.......................G.R.......................S.-----
Mpf_ENSMPUP00000016435 ..........V.......FHGr......................R.S.......................N.LDLVA
Mpf_ENSMPUP00000001167 ..........Y.......TRD.......................-.E.......................H.FAIAA
Mpf_ENSMPUP00000001585 ..........V.......LP-.......................K.E.......................E.VQLKT
Mpf_ENSMPUP00000002351 ..........R.......NGP.......................-.E.......................K.YILQA
Mpf_ENSMPUP00000011499 ..........R.......GQ-.......................R.Q.......................S.VVVAA
Mpf_ENSMPUP00000005375 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000015986 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004747 ..........T.......ESShgsee..................F.Q.......................I.HVFSC
Mpf_ENSMPUP00000009754 ..........Y.......TEG.......................E.R.......................L.YLFGL
Mpf_ENSMPUP00000002257 ..........D.......NSK.......................V.C.......................Q.YLLHL
Mpf_ENSMPUP00000006734 ..........Iylnef..HSA.......................V.G.......................A.YTFQA
Mpf_ENSMPUP00000003502 ..........I.......ARD.......................G.A.......................S.NIFR-
Mpf_ENSMPUP00000011019 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000003673 ..........K.......IRG.......................G.K.......................Q.FVLQC
Mpf_ENSMPUP00000000383 ..........F.......HVD.......................Q.S.......................N.YFLNF
Mpf_ENSMPUP00000008997 ..........K.......TAD.......................W.R.......................V.FLFQA
Mpf_ENSMPUP00000010040 ..........V.......SP-.......................S.K.......................S.CLLQA
Mpf_ENSMPUP00000007257 ..........L.......HKN.......................M.L.......................F.YVFKA
Mpf_ENSMPUP00000016774 ..........R.......TAD.......................W.R.......................V.FLFQA
Mpf_ENSMPUP00000001960 ..........T.......PMN.......................A.D.......................V.IVLGL
Mpf_ENSMPUP00000007610 ..........Y.......HGSh......................R.E.......................S.LDLVS
Mpf_ENSMPUP00000017612 ..........Sdl.....TIP.......................K.H.......................R.HLLQA
Mpf_ENSMPUP00000007907 ..........Lh......GEN.......................Y.E.......................S.LDLVA
Mpf_ENSMPUP00000014021 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008982 ..........Ts......SIT.......................G.K.......................K.HTFVT
Mpf_ENSMPUP00000005803 ..........V.......TT-.......................Q.R.......................T.FVFRV
Mpf_ENSMPUP00000002728 ..........Y.......HGNh......................M.E.......................S.LDLIT
Mpf_ENSMPUP00000007017 ..........I.......TKD.......................D.T.......................H.YYIQA
Mpf_ENSMPUP00000003752 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000001306 ..........S.......HID.......................-.R.......................V.YTLRA
Mpf_ENSMPUP00000005338 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000001689 ..........K.......MLD.......................K.Y.......................S.HYLAA
Mpf_ENSMPUP00000010415 ..........T.......QQG.......................T.D.......................P.LVLAV
Mpf_ENSMPUP00000006220 ..........T.......TTK.......................Q.Q.......................D.HFFQA
Mpf_ENSMPUP00000016350 ..........C.......TK-.......................H.R.......................G.VLLQA
Mpf_ENSMPUP00000018773 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000017599 ..........Rclq....WTT.......................V.I.......................E.RTFHV
Mpf_ENSMPUP00000016349 ..........C.......TK-.......................H.R.......................G.VLLQA
Mpf_ENSMPUP00000015036 ..........T.......TAD.......................F.C.......................E.YLFQA
Mpf_ENSMPUP00000007938 ..........I.......TG-.......................Q.R.......................V.FVFRT
Mpf_ENSMPUP00000007257 ..........E.......SV-.......................E.R.......................S.FILSA
Mpf_ENSMPUP00000005203 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000000650 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000007937 ..........Vvq.....HFSee.....................H.Y.......................I.FYFAG
Mpf_ENSMPUP00000007017 ..........K.......TRT.......................S.T.......................E.YFLEA
Mpf_ENSMPUP00000012780 ..........T.......SG-.......................A.R.......................T.YHLKA
Mpf_ENSMPUP00000002522 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004905 ..........V.......LR-.......................N.Q.......................E.IKFKA
Mpf_ENSMPUP00000011326 ..........K.......MQD.......................K.S.......................S.YLLAA
Mpf_ENSMPUP00000009449 ..........R.......TAD.......................W.R.......................L.YLFQA
Mpf_ENSMPUP00000000014 ..........H.......TK-.......................E.G.......................E.FTLSA
Mpf_ENSMPUP00000012737 ..........H.......TKD.......................-.A.......................V.YTLSA
Mpf_ENSMPUP00000002136 ..........Rclq....WTT.......................V.I.......................E.RTFHV
Mpf_ENSMPUP00000017782 ..........V.......TP-.......................E.R.......................R.FLLAC
Mpf_ENSMPUP00000013550 ..........R.......IKG.......................G.K.......................Q.FVLQC
Mpf_ENSMPUP00000017362 ..........F.......HPL.......................E.QsiwavkgpkgeavgsitqplpssY.LIIRA
Mpf_ENSMPUP00000006996 ..........T.......VD-.......................Q.K.......................T.FHFQA
Mpf_ENSMPUP00000004785 ..........K.......THD.......................-.R.......................L.YYMVA
Mpf_ENSMPUP00000014164 ..........S.......QGA.......................T.E.......................V.LVLAL
Mpf_ENSMPUP00000016592 ..........K.......MND.......................L.T.......................Y.FVLAA
Mpf_ENSMPUP00000000486 ..........I.......FP-.......................Q.D.......................V.LRLRA
Mpf_ENSMPUP00000003712 ..........V.......SP-.......................T.K.......................S.CMLQA
Mpf_ENSMPUP00000006850 ..........K.......TY-.......................E.R.......................L.FYMVA
Mpf_ENSMPUP00000015574 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000014962 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016814 ..........I.......HLTefdcv..................S.S.......................A.LIVQC
Mpf_ENSMPUP00000000139 ..........C.......TE-.......................H.R.......................G.ILLQA
Mpf_ENSMPUP00000012020 ..........T.......TPN.......................G.K.......................SgIILQA
Mpf_ENSMPUP00000006069 ..........Y.......LQD.......................V.K.......................V.LTLLL
Mpf_ENSMPUP00000017142 ..........E.......TS-.......................Q.S.......................C.LTLSA
Mpf_ENSMPUP00000013991 ..........I.......TP-.......................Q.R.......................K.VTLAA
Mpf_ENSMPUP00000010353 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000000014 ..........L.......TP-.......................E.K.......................E.HFIRA
Mpf_ENSMPUP00000009546 ..........N.......AL-.......................S.Q.......................R.YFLQA
Mpf_ENSMPUP00000012020 ..........R.......TPEstggea.................L.S.......................T.YVFES
Mpf_ENSMPUP00000016751 ..........T.......SFDg......................K.K.......................S.SILQA
Mpf_ENSMPUP00000000216 ..........T.......QS-.......................K.S.......................V.HSFAA
Mpf_ENSMPUP00000010854 ..........Vhi.....SKK.......................H.R.......................T.WFFSA
Mpf_ENSMPUP00000016813 ..........A.......VKE.......................G.D.......................T.VIFAS
Mpf_ENSMPUP00000002870 ..........N.......AG-.......................M.R.......................K.YFLQA
Mpf_ENSMPUP00000003651 ..........T.......TVS.......................G.N.......................E.FLLQS
Mpf_ENSMPUP00000002370 ..........Hn......TAK.......................N.K.......................W.FVCMA
Mpf_ENSMPUP00000006780 ..........A.......VKE.......................G.D.......................T.VIFAS
Mpf_ENSMPUP00000002802 ..........F.......TD-.......................N.K.......................T.YVFKA
Mpf_ENSMPUP00000011336 ..........T.......QS-.......................H.L.......................S.WYFSP
Mpf_ENSMPUP00000003120 ..........I.......IPG.......................E.Q.......................H.FYMKA
Mpf_ENSMPUP00000005803 ..........Y.......LPS.......................E.R.......................A.FLFGA
Mpf_ENSMPUP00000004980 ..........I.......IPG.......................E.Q.......................Y.FYLKA
Mpf_ENSMPUP00000015621 ..........Rclq....WTT.......................V.I.......................E.RTFHV
Mpf_ENSMPUP00000003141 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013099 ..........I.......SHD.......................-.R.......................T.YHFQA
Mpf_ENSMPUP00000010983 ..........Y.......GR-.......................K.H.......................C.YRLYT
Mpf_ENSMPUP00000004910 ..........F.......HPLdqsvwavkgpkgesvgsitqplpS.S.......................Y.LIFRA
Mpf_ENSMPUP00000016233 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000002953 ..........F.......LTN.......................G.R.......................-.-----
Mpf_ENSMPUP00000011716 ..........V.......CRD.......................G.K.......................T.ISLCA
Mpf_ENSMPUP00000007767 ..........Itv.....R-Pqreddretlvsqcrdtlc.....V.T.......................K.NWLSA
Mpf_ENSMPUP00000014585 ..........V.......TP-.......................E.R.......................R.FLFTC
Mpf_ENSMPUP00000014164 ..........L.......RNR.......................Q.E.......................V.AILEA
Mpf_ENSMPUP00000005886 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013797 ..........T.......GPL.......................P.A.......................P.LHVLC
Mpf_ENSMPUP00000004108 ..........N.......AAS.......................G.E.......................Q.YKLRA
Mpf_ENSMPUP00000009167 ..........F.......YGTqfv....................L.S.......................T.LSLAA
Mpf_ENSMPUP00000016226 ..........I.......LAD.......................R.P.......................C.LELSA
Mpf_ENSMPUP00000014024 ..........Q.......QS-.......................G.Q.......................L.YTFKA
Mpf_ENSMPUP00000008448 ..........I.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000010607 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000015774 ..........V.......TH-.......................N.R.......................T.YHFQA
Mpf_ENSMPUP00000008639 ..........A.......FKGr......................R.K.......................N.LDLAA
Mpf_ENSMPUP00000012941 ..........K.......TRQ.......................G.T.......................E.LLIQS
Mpf_ENSMPUP00000016218 ..........R.......FQDpsp....................G.Q.......................S.HTLQA
Mpf_ENSMPUP00000007001 ..........Fllhna..QGT.......................Q.A.......................E.FLFST
Mpf_ENSMPUP00000001986 ..........S.......NSF.......................G.D.......................V.YLFQA
Mpf_ENSMPUP00000010415 ..........L.......RNG.......................Q.E.......................V.AVLEA
Mpf_ENSMPUP00000003836 ..........E.......PPSee.....................F.K.......................T.FYFCA
Mpf_ENSMPUP00000007027 ..........H.......PPE.......................H.S.......................P.TYLLI
Mpf_ENSMPUP00000002688 ..........Tilsn...HASe......................K.V.......................E.MLLGA
Mpf_ENSMPUP00000001373 ..........I.......SH-.......................N.R.......................T.YHFQA
Mpf_ENSMPUP00000013700 ..........H.......NRN.......................G.K.......................S.YLFLL
Mpf_ENSMPUP00000016589 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000015325 ..........Nfs.....HEN.......................Q.K.......................A.LELRT
Mpf_ENSMPUP00000001960 ..........L.......HRG.......................E.E.......................V.AKLEA
Mpf_ENSMPUP00000006310 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016747 ..........S.......FKNgsq....................S.Q.......................T.HSLQA
Mpf_ENSMPUP00000013323 ..........D.......TE-.......................E.H.......................I.YHLKV
Mpf_ENSMPUP00000007350 ..........S.......HQDf......................H.G.......................N.ILLAA
Mpf_ENSMPUP00000017588 ..........L.......YGMefr....................L.K.......................T.LSLQA
Mpf_ENSMPUP00000007745 ..........L.......YDS.......................N.C.......................Q.LNFIA
Mpf_ENSMPUP00000006409 ..........K.......TP-.......................S.R.......................V.ITLKA
Mpf_ENSMPUP00000015574 ..........Y.......TRD.......................-.R.......................S.LGVAA
Mpf_ENSMPUP00000008365 ..........R.......SRD.......................G.S.......................E.YLIQH
Mpf_ENSMPUP00000001054 ..........S.......NSL.......................G.D.......................A.FLFQT
Mpf_ENSMPUP00000017488 ..........L.......YDP.......................D.E.......................T.LNFIA
Mpf_ENSMPUP00000005234 ..........Rllen...A-Ddr.....................E.A.......................T.YMLKA
Mpf_ENSMPUP00000013182 ..........L.......VPSpeg....................M.S.......................E.VYLRC
Mpf_ENSMPUP00000011513 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005385 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000009077 ..........C.......SKD.......................R.-.......................-.-----
Mpf_ENSMPUP00000001767 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000007827 ..........E.......AVDr......................P.G.......................V.ITMQA
Mpf_ENSMPUP00000000541 ..........Q.......RSPgnk....................V.S.......................D.IKFQA
Mpf_ENSMPUP00000001809 ..........R.......TVP.......................G.H.......................E.FLLQS
Mpf_ENSMPUP00000005803 ..........Y.......SE-.......................K.H.......................H.WHICC
Mpf_ENSMPUP00000013182 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005315 ..........A.......HSKqpgnt..................A.P.......................N.LIFLA
Mpf_ENSMPUP00000014585 ..........T.......YRRegh....................V.R.......................N.LFVYH
Mpf_ENSMPUP00000015166 ..........D.......TED.......................-.N.......................I.YHLKI
Mpf_ENSMPUP00000002409 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005807 ..........F.......NT-.......................-.-.......................-.-----
Mpf_ENSMPUP00000013796 ..........E.......GPL.......................I.N.......................T.IRVLC
Mpf_ENSMPUP00000017782 ..........Tylk....DNS.......................T.R.......................N.IFVYH
Mpf_ENSMPUP00000019464 ..........Cfd.....APG.......................V.R.......................P.HLLAA
Mpf_ENSMPUP00000012725 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000010996 ..........Inpva...G-Q.......................A.V.......................T.HIFVA
Mpf_ENSMPUP00000007938 ..........I.......LE-.......................K.M.......................Q.LYLSC
Mpf_ENSMPUP00000009654 ..........N.......LRE.......................G.S.......................R.LHLCA
Mpf_ENSMPUP00000005385 ..........Lipv....AEG.......................M.N.......................E.IWLRC
Mpf_ENSMPUP00000006310 ..........Lipv....ADG.......................M.N.......................E.VYLRC
Mpf_ENSMPUP00000007963 ..........K.......TS-.......................E.R.......................T.FYLVA
Mpf_ENSMPUP00000002310 ..........V.......SLT.......................G.Q.......................T.WHFEA
Mpf_ENSMPUP00000000486 ..........V.......LYD.......................N.T.......................Q.LQLKA
Mpf_ENSMPUP00000007805 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000010246 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004460 ..........I.......FTD.......................D.S.......................A.RTFTC
Mpf_ENSMPUP00000014791 ..........H.......GP-.......................K.C.......................E.WICAT
Mpf_ENSMPUP00000003154 ..........D.......TE-.......................E.H.......................I.YHLKV
Mpf_ENSMPUP00000005214 ..........S.......FP-.......................H.E.......................K.LLLMC
Mpf_ENSMPUP00000003932 ..........F.......TQD.......................-.E.......................Y.FAMVA
Mpf_ENSMPUP00000008710 ..........V.......SLT.......................G.Q.......................T.WHFEA
Mpf_ENSMPUP00000005632 ..........Sydh....GEA.......................E.A.......................Y.LNFIA
Mpf_ENSMPUP00000002828 ..........H.......NRN.......................G.K.......................S.YTFLI
Mpf_ENSMPUP00000017859 ..........L.......H--.......................-.-.......................-.-----
Mpf_ENSMPUP00000013754 ..........N.......NPDk......................G.N.......................V.YKFQT
Mpf_ENSMPUP00000004548 ..........E.......TNE.......................RpG.......................T.ITLQA
Mpf_ENSMPUP00000000646 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000004473 ..........Q.......QA-.......................Q.Q.......................T.LYLST
Mpf_ENSMPUP00000000402 ..........K.......HPQiqkks..................Q.Y.......................I.KYLCC
Mpf_ENSMPUP00000007412 ..........Tll.....HNSegl....................Q.E.......................K.ILLSS
Mpf_ENSMPUP00000004935 ..........H.......KQD.......................G.K.......................N.LEIEL
Mpf_ENSMPUP00000011513 ..........H.......PKD.......................Q.G.......................P.TYLLI
Mpf_ENSMPUP00000001759 ..........Ev......VER.......................H.G.......................I.ITLQA
Mpf_ENSMPUP00000008353 ..........V.......FS-.......................G.R.......................K.LALRA
Mpf_ENSMPUP00000012083 ..........K.......HPQiqkes..................Q.Y.......................I.KYLCC
Mpf_ENSMPUP00000006956 ..........E.......AADrp.....................G.A.......................A.LTMQA
Mpf_ENSMPUP00000014860 ..........K.......PNKlrngh..................K.G.......................L.RVFCS
Mpf_ENSMPUP00000009647 ..........Lsa.....VPGger....................K.V.......................L.IIFNA
Mpf_ENSMPUP00000005803 ..........I.......TP-.......................Y.R.......................S.FSFTA
Mpf_ENSMPUP00000005109 ..........Td......SEK.......................G.N.......................S.YKFQA
Mpf_ENSMPUP00000006149 ..........Y.......FND.......................D.T.......................S.KTFAC
Mpf_ENSMPUP00000001981 ..........V.......SST.......................G.Q.......................T.WHFEA
Mpf_ENSMPUP00000017916 ..........V.......TPLsgsek..................K.Q.......................V.LHFCA
Mpf_ENSMPUP00000003318 ..........G.......WP-.......................T.V.......................N.FVATF
Mpf_ENSMPUP00000017175 ..........Tsavp...GADi......................K.V.......................L.INFNA
Mpf_ENSMPUP00000016038 ..........K.......TT-.......................S.R.......................T.FYLVA
Mpf_ENSMPUP00000016192 ..........Qll.....HGPha.....................K.H.......................Q.FLLRA
Mpf_ENSMPUP00000015325 ..........Gvepk...DSP.......................S.F.......................T.VILVA
Mpf_ENSMPUP00000000660 ..........Nka.....GGP.......................R.D.......................L.KMLCA
Mpf_ENSMPUP00000005493 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000009754 ..........V.......HETekhe...................K.Q.......................Q.WYLCC
Mpf_ENSMPUP00000013796 ..........T.......G--.......................-.-.......................-.-----
Mpf_ENSMPUP00000010667 ..........-.......---.......................-.K.......................L.FRFDA
Mpf_ENSMPUP00000013126 ..........-.......YKD.......................Y.R.......................Q.LELAC
Mpf_ENSMPUP00000018046 ..........Kpnkvr..NET.......................K.E.......................L.RLLCA
Mpf_ENSMPUP00000006359 ..........-.......---.......................I.S.......................H.LNLVA
Mpf_ENSMPUP00000015086 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000008387 ..........Vve.....PPDsa.....................P.F.......................T.VVLLA
Mpf_ENSMPUP00000015207 ..........A.......CKD.......................S.K.......................V.VRCHF
Mpf_ENSMPUP00000004217 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000015689 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000015159 ..........-.......--D.......................-.-.......................-.-----
Mpf_ENSMPUP00000018833 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000007866 ..........Snry....GED.......................E.V.......................T.HTLQT
Mpf_ENSMPUP00000007938 ..........L.......TP-.......................H.R.......................C.FSFTA
Mpf_ENSMPUP00000010694 ..........Ia......VDG.......................V.C.......................S.GIIQC
Mpf_ENSMPUP00000013131 ..........T.......CKD.......................C.K.......................V.IRCQF
Mpf_ENSMPUP00000000312 ..........T.......TP-.......................E.E.......................Q.FTLVS
Mpf_ENSMPUP00000019132 ..........V.......TEG.......................G.G.......................E.IDFRC
Mpf_ENSMPUP00000015959 ..........T.......WT-.......................G.G.......................S.RCFSC
Mpf_ENSMPUP00000012612 ..........-.......GK-.......................H.E.......................S.YRISA
Mpf_ENSMPUP00000007938 ..........I.......LTG.......................G.R.......................I.QHFGT
Mpf_ENSMPUP00000007989 ..........Sllsn...HQGr......................P.T.......................H.RLLQA
Mpf_ENSMPUP00000016156 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000013721 ..........W.......HPS.......................A.R.......................H.YYFCM
Mpf_ENSMPUP00000005447 ..........T.......S--.......................A.R.......................D.MLLLA
Mpf_ENSMPUP00000015768 ..........Q.......HPF.......................R.R.......................H.LCFSA
Mpf_ENSMPUP00000004215 ..........E.......TK-.......................E.R.......................Q.YQLAA
Mpf_ENSMPUP00000010108 ..........V.......TVSgr.....................K.H.......................S.VRLCS
Mpf_ENSMPUP00000002188 ..........K.......VKD.......................R.T.......................D.IIFEV
Mpf_ENSMPUP00000013446 ..........S.......T--.......................A.K.......................N.LLLLA
Mpf_ENSMPUP00000012407 ..........T.......ASQltvppa.................V.C.......................T.VLLLA
Mpf_ENSMPUP00000017043 ..........D.......NL-.......................S.R.......................T.LILKC
Mpf_ENSMPUP00000007898 ..........La......EKA.......................E.C.......................L.FTLEA
Mpf_ENSMPUP00000017064 ..........L.......VRPptera..................N.V.......................L.LSFQM
Mpf_ENSMPUP00000009754 ..........T.......TP-.......................Y.R.......................I.FSFSA
Mpf_ENSMPUP00000016461 ..........Y.......TPErtrq...................R.W.......................P.VRLAA
Mpf_ENSMPUP00000008230 ..........D.......TA-.......................Q.R.......................S.H-LLA
Mpf_ENSMPUP00000001993 ..........R.......TT-.......................N.R.......................E.YFLIG
Mpf_ENSMPUP00000014500 ..........S.......NGG.......................A.Q.......................T.YHLKA
Mpf_ENSMPUP00000002405 ..........T.......TS-.......................S.G.......................T.KCFAC
Mpf_ENSMPUP00000002933 ..........EshphttcWP-.......................G.R.......................T.LYLLA
Mpf_ENSMPUP00000007268 ..........T.......TS-.......................S.G.......................S.KCFSC
Mpf_ENSMPUP00000010983 ..........I.......TA-.......................N.R.......................V.LHCNA
Mpf_ENSMPUP00000010498 ..........L.......CL-.......................S.Q.......................A.VMLGF
Mpf_ENSMPUP00000018101 ..........Tasqlsa.PRN.......................R.Y.......................S.VPILA
Mpf_ENSMPUP00000002033 ..........-.......---.......................-.-.......................-.---A-
Mpf_ENSMPUP00000010694 ..........Q.......SES.......................G.E.......................D.LYFSV
Mpf_ENSMPUP00000008353 ..........I.......TA-.......................K.A.......................V.LKLQA
Mpf_ENSMPUP00000009754 ..........V.......ER-.......................R.R.......................T.LYIQG
Mpf_ENSMPUP00000015718 ..........Tasqlsa.SDS.......................R.C.......................S.VLMLA
Mpf_ENSMPUP00000002358 ..........Tasllg..TPSk......................T.S.......................S.LLILT
Mpf_ENSMPUP00000005077 ..........T.......YL-.......................S.G.......................S.KCFSC
Mpf_ENSMPUP00000009107 ..........R.......LSS.......................R.V.......................E.TPWAA
Mpf_ENSMPUP00000016101 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000011911 ..........T.......TT-.......................E.R.......................S.HLLAA
Mpf_ENSMPUP00000007938 ..........V.......ET-.......................G.R.......................T.LYLQG
Mpf_ENSMPUP00000009676 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005809 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000016410 ..........S.......GPQ.......................S.Q.......................T.YYICF
Mpf_ENSMPUP00000006638 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000005803 ..........V.......EK-.......................G.R.......................T.LYIHG
Mpf_ENSMPUP00000010983 ..........-.......---.......................-.-.......................-.-----
Mpf_ENSMPUP00000000717 ..........N.......KQD.......................N.K.......................K.MELKL
Mpf_ENSMPUP00000002793 ..........-.......---.......................F.F.......................T.AVFNT
Mpf_ENSMPUP00000007833 ..........A.......GAQ.......................A.Q.......................T.YHVSF
Mpf_ENSMPUP00000002271 ..........-.......--N.......................H.E.......................S.YLLMA
Mpf_ENSMPUP00000010974 ..........FnteqrnvYKD.......................L.R.......................Q.IELAC
Mpf_ENSMPUP00000010755 ..........D.......TS-.......................H.R.......................S.LILKC
Mpf_ENSMPUP00000013112 ..........-.......--Dasnke..................Y.S.......................L.WVYQC


                              120       130                                                         
                                |         |                                                         
d1dbha2                KSAEE.KNNWMAALISLQYRS--tl....................................................
Mpf_ENSMPUP00000000236 IEREE.Y----------------gklfdfvnakklnikn......................................
Mpf_ENSMPUP00000001054 SSPES.RKDFLKAVHSILR----dkhrrq................................................
Mpf_ENSMPUP00000001986 SDSES.KTNIVKVIRSILRE---nfrrh.................................................
Mpf_ENSMPUP00000006133 -----.-----------------qiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvist
Mpf_ENSMPUP00000009494 DSQET.M----------------mdhplrtisyiadignivvlmarrrlprsnsqenveashpsqdgkrqykmvchv
Mpf_ENSMPUP00000004093 ASEND.LPEWK------------ergtgdvkllkhkekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvw
Mpf_ENSMPUP00000012215 -----.-----------------sgmnikltistcsltlmnidnqqiianhhmqsisfasggdpdttdyvayvakdp
Mpf_ENSMPUP00000016175 -----.-----------------iedgngrrafigigfvdrgdafdfnvalqdhfkwvkq.................
Mpf_ENSMPUP00000009909 -----.-----------------sggdtdmtdyvayvakdpinqrachileccggvaqsvistvgqafelrfkqyl.
Mpf_ENSMPUP00000010977 DTQET.M----------------mdhalrtisyiadignivvlmarrrmprsasqdciettpgaqegkkqykmichv
Mpf_ENSMPUP00000016638 -----.-----------------tvtdssryfviriqdgtgrsafigigftdrgdafdfnvslqdhfkwvkq.....
Mpf_ENSMPUP00000018612 ASENN.LPEWK------------eqgtgdvkllkhtekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvw
Mpf_ENSMPUP00000018966 ASENN.LPEWK------------eqgtgdvkllkhtekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvw
Mpf_ENSMPUP00000004660 ASPKD.AEEWVQQLNFV------lq....................................................
Mpf_ENSMPUP00000002149 PTEEL.RKRWIHQLKNVIR----ynsdlvqkyhpcfwidgqylccsqtaknamgcqil...................
Mpf_ENSMPUP00000018066 LDPQD.RK---------------witdgpcsrvfgfvarkqgsatdnvchlfaehdpeqpasaivnfvskvmi....
Mpf_ENSMPUP00000017958 -----.-----------------rnarlsiygiwfydkeecqriaelmknltqye......................
Mpf_ENSMPUP00000011450 -----.-----------------vmhscnydsilalvckeptqnkpdlhlfqcdeikanlisediesaisds.....
Mpf_ENSMPUP00000016402 --PQE.R----------------kwmkteggvpaklfgfvarkqgsttdnachlfaeldpnqpasaivnfvsknkck
Mpf_ENSMPUP00000004951 -----.-----------------gskaiinstitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqe
Mpf_ENSMPUP00000011363 -----.-----------------lksnhhychvftafdvnlayeiiltlgqafevayqlal................
Mpf_ENSMPUP00000015445 SSEQQ.LTKFAEKF---------qevkeaarlardksqekietssnhsqvs..........................
Mpf_ENSMPUP00000015195 ANPAE.ARDWVDQIS--------fl....................................................
Mpf_ENSMPUP00000011751 RKSEQ.KQRWLKAFAK-------ereqvrldqetgfsitelqrkqamlna...........................
Mpf_ENSMPUP00000009831 KKLEE.KIRWLRAFRE-------erkmvqedekigfeisenqkrqaam.............................
Mpf_ENSMPUP00000004111 DSQEA.MM---------------dhalqtisyiadigsvlvlmarrrlarrpasqapshklykmlchvfhsedaqli
Mpf_ENSMPUP00000005349 PSAQS.RDRWVKKLKEEIKNN--nnimikyhpkfwadgsyqccrqteklapgceky.....................
Mpf_ENSMPUP00000006137 TDPQD.RR---------------wanpdgttskifgfvakkpgspwenvchlfaeldpdqpa...............
Mpf_ENSMPUP00000009095 NNCVE.AKAWIDILTKVSQ----snqkrlavyhpsaylnghwlccrassdtapgcspct..................
Mpf_ENSMPUP00000005832 GSKED.AAQFAA-----------amasaleale............................................
Mpf_ENSMPUP00000014567 KSQTE.-----------------sqenvchlfaeydpvqpasqvislvrtllq........................
Mpf_ENSMPUP00000015198 PSG-N.AHKWCKKIQEV------wrhryqshpd............................................
Mpf_ENSMPUP00000008441 -----.-----------------glaqdvigsigqafelrfkqylq...............................
Mpf_ENSMPUP00000005146 P----.-----------------rlrinkrilqlcmgnhelymrrrkpdtievqqmkaqareekhqkqlerqqlete
Mpf_ENSMPUP00000010667 -----.-----------------vrivmrrdqvlklcanhritpdmtlqnmkgtervwvwtacdfadgerkvehlav
Mpf_ENSMPUP00000000642 RKQED.KVRWLQACEDE------rrrvredremgmeisenqkklamln.............................
Mpf_ENSMPUP00000015373 -----.-----------------nvyriisiggakaiinstvtpnmtftktsqkfgqwadsrantvyglgfaseqhl
Mpf_ENSMPUP00000003213 -----.-----------------lqtshhychvfstvdvnltyeiiltlgqafevayqlal................
Mpf_ENSMPUP00000012196 -----.-----------------esnkhlcyvfdsekcaeeitltigqafdlayrkfl...................
Mpf_ENSMPUP00000012194 -----.-----------------iggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlp
Mpf_ENSMPUP00000003212 -----.-----------------lqtshhychvfstvdvnltyeiiltlgqafevayqlal................
Mpf_ENSMPUP00000001158 P----.-----------------rlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqmerallene
Mpf_ENSMPUP00000010667 -----.-----------------ilmrrdqvfkvcanhvitktmelkplnvsnnalvwtasdyadgeakveqlavrf
Mpf_ENSMPUP00000013386 PDRES.RQRWVLALKEETRN---nnslvpmyhpnfwmdgrwrccaqqeklavgcaqy....................
Mpf_ENSMPUP00000016712 -----.-----------------rnaslsiysiwfydkndchriaklmadvveee......................
Mpf_ENSMPUP00000003302 P----.-----------------rlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqleraqlene
Mpf_ENSMPUP00000003768 -----.-----------------ivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmavkdtgerlshavg
Mpf_ENSMPUP00000008012 -----.-----------------gaivrcdavlppgrsrsllllvcqeperthpdvhffqglrlgaelirediqgal
Mpf_ENSMPUP00000002625 SNEES.RSQWLKALQKEIRG---nphllikyhsgffvdgkflccqqsckaapgctl.....................
Mpf_ENSMPUP00000010667 -----.-----------------evngklrmlmrreqvlkvcanhwitttmnlkplsgsdrawmwlasdfsdgdakl
Mpf_ENSMPUP00000006140 DTGNQ.-----------------rfechvfwcepnagnvseavqaacmlryqk........................
Mpf_ENSMPUP00000015670 -----.-----------------vsiyrisyctadkmhdkvfayiaqsqhnenlechaflctkrkvaqavtltvaqa
Mpf_ENSMPUP00000008341 -----.-----------------pksqklrdvfnmdfpdnnfllktltvvsgpdmvdltfhnfvsykenvgkswaed
Mpf_ENSMPUP00000017573 -----.-----------------apdrnldkafsyicrdgttrrwichcflalkdsgerlshavgcafaaclerkqr
Mpf_ENSMPUP00000012859 VQDDT.AKVWTEEL---------fklamnilaqn...........................................
Mpf_ENSMPUP00000012131 NNCVE.ANEWIDVLCRV------srcnqnrlsfyhpsaylngnwlccletsenalgckpct................
Mpf_ENSMPUP00000000172 GSRDE.CKN--------------fwkicveyhtffrlldqpkakakavffsrgssfrysgrtqkqlvdyvrdsgvkr
Mpf_ENSMPUP00000013200 NSSKL.-----------------rvnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqmerqrlarekq
Mpf_ENSMPUP00000003522 LTSSD.KNTWMELLEEAV-----r.....................................................
Mpf_ENSMPUP00000011499 --R--.-----------------dfcksfwkicvehhaffrlfeepkpkpkpvlfsrgssfrfsgrtqkqvldyvke
Mpf_ENSMPUP00000011494 -----.-----------------tryafplahslpifafln....................................
Mpf_ENSMPUP00000012716 SDKKK.KQEWIQAIHST------i.....................................................
Mpf_ENSMPUP00000002913 ASKEE.ATTFSNAML--------falnimnsqeggpstqrqvqngpspeemdiqrrqv...................
Mpf_ENSMPUP00000003504 SDTRQ.RQEWTAAIQTAI-----rl....................................................
Mpf_ENSMPUP00000004361 -----.-----------------caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlnsqe
Mpf_ENSMPUP00000017389 ARAEE.L----------------fnmlqeimqnnsinvveepvvernnhqtelevprtpr.................
Mpf_ENSMPUP00000015829 IDSLQ.KHSWVADIQGCV-----dpgdse................................................
Mpf_ENSMPUP00000003644 -----.-----------------lldietkeeldsyrldsiqamdtalntcsynsilsitvqesglpatstllfqcq
Mpf_ENSMPUP00000006376 ENPEV.TKQWVEGLRSIIHN---frann.................................................
Mpf_ENSMPUP00000014536 -----.-----------------ikvrpaeleqfestigfklpnhraakrlwkvcvehhtfyrlvspeqppkakflt
Mpf_ENSMPUP00000011501 KQEEQ.-----------------sklgifenlnklafplsngqilfafsyk..........................
Mpf_ENSMPUP00000017670 -----.-----------------eqfestigfklpnhrsakrlwkvciehhtffrlvspepppkgflvmgskfrysg
Mpf_ENSMPUP00000006727 ANEEE.AKKFRKAVTDL------lgrr..................................................
Mpf_ENSMPUP00000000961 -----.-----------------fiqlrkevhesretllgfnmvnyracknlwkacvehhtffrldrplppqknffa
Mpf_ENSMPUP00000004942 -----.-----------------efeqfestigfklpnhraakrlwkvcvehhtffrlllpeappkkfltlgskfry
Mpf_ENSMPUP00000002151 -----.-----------------masrdackafwktcveyhaffrlseepkskpktllcskgssfrysgrtqrqlle
Mpf_ENSMPUP00000014680 RDV--.-----------------tdnrafgyvcggegqhqffaiktgqqaeplvidlkdlfqviynvkkkeeekkk.
Mpf_ENSMPUP00000005563 QTVSE.KTVWQDLICR-------m.....................................................
Mpf_ENSMPUP00000011333 DTGKE.MELWMKAML--------d.....................................................
Mpf_ENSMPUP00000000969 -----.-----------------kackhlwkcavehhaffrlrgpvqksshrsgfirlgsrfrysgkteyqttktnk
Mpf_ENSMPUP00000010395 KSAEE.KNNWMAALISLQYRS--tlermldvtmlqeekeeqmrlpsad.............................
Mpf_ENSMPUP00000015361 -----.-----------------irpgeqeqyestigfklpsyraakklwkvcvehhtffrltstdtlpkskflalg
Mpf_ENSMPUP00000001991 -----.-----------------gvenqafykyakssqiktvssskiffkgsrfrysgkvakevveasskiqreppe
Mpf_ENSMPUP00000005637 -----.-----------------adhrfachvfvseestkalaesvgrafqqfykqfv...................
Mpf_ENSMPUP00000007307 -----.-----------------artckhlwkcavehhsffrlrtpgnsksnrsdfirlgsrfrfsgrteyqathgs
Mpf_ENSMPUP00000008193 QSPAD.ARAFDRGIRRAI-----edisq.................................................
Mpf_ENSMPUP00000007177 QTVSE.RKNWCSLITE-------ta....................................................
Mpf_ENSMPUP00000010360 PTPEV.KAAWVSEIRKVLTS---qlqacreasqhr..........................................
Mpf_ENSMPUP00000010611 KDDEE.MNTWIQAISSAISS---dk....................................................
Mpf_ENSMPUP00000007161 KDTAT.AHSWFVAIHT-------nim...................................................
Mpf_ENSMPUP00000006134 QSPA-.-----------------darafdrgvrkaiedlie....................................
Mpf_ENSMPUP00000004983 KSAEE.KNNWMAALISLHYR---stldrmldsvllkeeneqplrlpspd............................
Mpf_ENSMPUP00000001920 -----.K----------------drkgmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirp..
Mpf_ENSMPUP00000013542 -----.-----------------rlyglqtgrllweqelysqlvystptpffhtfagdacqaglnfadegeaqvfra
Mpf_ENSMPUP00000008337 SSKEE.RNTWMAHIRRAVE----sc....................................................
Mpf_ENSMPUP00000013626 ESTAV.K----------------erdavkdllqqllpkfkrkan.................................
Mpf_ENSMPUP00000001949 ENAQE.MSVWLNKLGF-------av....................................................
Mpf_ENSMPUP00000017721 KDEAS.AKSWAAAIQAQ------vn....................................................
Mpf_ENSMPUP00000001109 KDSAT.AQAWFSAIHS-------nvs...................................................
Mpf_ENSMPUP00000001935 -----.-----------------llsrfachvfvsqesmrpvaqsvgrafleyyqqhl...................
Mpf_ENSMPUP00000006252 -----.-----------------seksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrs.........
Mpf_ENSMPUP00000005676 E----.-----------------apakniatslheicskimae..................................
Mpf_ENSMPUP00000005196 -----.-----------------vgetpggapggpsgqgaeaargwetairqalm......................
Mpf_ENSMPUP00000012589 RSKT-.-----------------ackhlwkcsvehhtffrmpenesnslsrklskfgsmsykhrysgrtalqmsrdl
Mpf_ENSMPUP00000010571 SQKEE.K----------------kiiltyfaptpeackhlwkcgienqafyklekssqvrtvsssnlffkgsrfrys
Mpf_ENSMPUP00000011589 ESSEE.QEAWIQAMGEA------ar....................................................
Mpf_ENSMPUP00000005676 -----.-----------------rvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry
Mpf_ENSMPUP00000002533 KNVNE.LNQWLSALRKAS-----apnpdklaschpgafrssrwtcclqaersaagcsrth.................
Mpf_ENSMPUP00000004215 -----.-----------------kvtfsfeagrrcisgegnfefetrqgneifsaleeaisaqknsthpgppsqpat
Mpf_ENSMPUP00000013399 SRAEE.IFNLLQDL---------mqcnsinvmeepvivtrnshpaelglp...........................
Mpf_ENSMPUP00000010530 SNQQD.LHEWVDHLQKQ------tk....................................................
Mpf_ENSMPUP00000006089 ASLAT.KQAWTADISRLLWRQ--aihn..................................................
Mpf_ENSMPUP00000016498 -----.-----------------esgrmcdtgeglftfqtregemiyqkvhsatlaiaeqherlmlemeqkarlqts
Mpf_ENSMPUP00000007327 -----.-----------------vafnmlnyrscknlwkscvehhtffqakkllpqeknvlaqywtmgsrnpkksvn
Mpf_ENSMPUP00000001749 PNVDV.KMTWLKEIRSILLK---qqell.................................................
Mpf_ENSMPUP00000016475 PSPEE.KEEWMKSIRASISR---dpfy..................................................
Mpf_ENSMPUP00000013206 DTQED.MNAWVRAMNQAA-----q.....................................................
Mpf_ENSMPUP00000006140 DTPA-.-----------------kaiatslheicskimae.....................................
Mpf_ENSMPUP00000005780 NSKEE.RNNWMRRIQQAVE----sc....................................................
Mpf_ENSMPUP00000001869 NSSQD.FQEWLEQLCRLI-----......................................................
Mpf_ENSMPUP00000012475 PTPEE.KEEWIKCIKAAI-----......................................................
Mpf_ENSMPUP00000008316 EDMET.-----------------akyvwrlcvarhkfyrlnqcslqtqtvtvnpirrrsssrvslpkpqpyvmpppp
Mpf_ENSMPUP00000001167 -----.-----------------vvlqlmnirrcghsenfffievgrsavtgpgefwmqvddsvvaqnmhetileam
Mpf_ENSMPUP00000008230 -----.-----------------eagrrcpsgpgtftfqtaqgndifqavetaihrqkv..................
Mpf_ENSMPUP00000017717 QSPAE.ADEFQKSLLAA------laal..................................................
Mpf_ENSMPUP00000010272 SSAEV.KSAWTHVIGQILWRQ--alr...................................................
Mpf_ENSMPUP00000003964 PTQEE.KEEWIKSIQAA------v.....................................................
Mpf_ENSMPUP00000017478 KTAEE.KQKWLDAIIR-------ereq..................................................
Mpf_ENSMPUP00000010168 -----.-----------------fvgenngdsshnpvlaatgvgvdvaqswekairqalm.................
Mpf_ENSMPUP00000009546 DSPED.MHSWIKEIGAAV-----q.....................................................
Mpf_ENSMPUP00000002870 DSPEE.MHSWIKAVSGAI-----vaq...................................................
Mpf_ENSMPUP00000000151 ASPEI.KLKWTSSIAQLLWRQ--aahn..................................................
Mpf_ENSMPUP00000000216 SSEQD.KEEWIKALQDTID----afhqrhetfrnaiakdndmqsevstaelgkrap.....................
Mpf_ENSMPUP00000007012 KTREL.KKKWMEQFEMAISNI--ypenatanghdfqmfsfeettscracqmllrgtfyq..................
Mpf_ENSMPUP00000012096 KTEDM.KRKWMEQFEMAMSNIK-pdkananhhsfqmytfdkttnckacrmflrgtfyq...................
Mpf_ENSMPUP00000004281 SNIET.KQEWIKNIREVIQE---riihl.................................................
Mpf_ENSMPUP00000004460 -----.-----------------rrygrdatrftfeagrmcdageglytfqtqegeqiyqrvhsatlaiaeqhkrvl
Mpf_ENSMPUP00000011499 ESEYT.FERWMEVIRSA------t.....................................................
Mpf_ENSMPUP00000003498 DTLED.LRGWLRALGRA------s.....................................................
Mpf_ENSMPUP00000006723 KDEEE.MLSWLQGVSTAINE---sq....................................................
Mpf_ENSMPUP00000006149 -----.-----------------tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeqherllqsvkns....
Mpf_ENSMPUP00000011052 SSPSV.RQTWIHEINQILENQ--rnfl..................................................
Mpf_ENSMPUP00000015653 DTLED.LSMWVRHLITCI-----s.....................................................
Mpf_ENSMPUP00000014937 -----.-----------------lwaqmeiqranhknlritatdledysikvfliqasakdtgclyaaihhrllalr
Mpf_ENSMPUP00000006713 KTAEE.KRSWTHHIKRLILE---nhhtt.................................................
Mpf_ENSMPUP00000005370 -----.-----------------vgenvvnpsspppnssvltsgvgadvarmwemaiqhalm...............
Mpf_ENSMPUP00000017142 EDNNS.AQRWIKAMEDA------s.....................................................
Mpf_ENSMPUP00000011052 SSIEN.KQDWIKHIREVIQE---......................................................
Mpf_ENSMPUP00000000930 -----.-----------------rtfghsgiavhtwyacpaliksiwamaisqhqfyldrkqskskihaarslseia
Mpf_ENSMPUP00000016865 -----.-----------------npsliksiwvmaisqhqfyldrkqskakipsarslddiamdltetgtprvskmv
Mpf_ENSMPUP00000000090 KTKDL.KKKWLEQFEMALSNI--rpdyadsnfhefkmhtfnrvtsckvcqmllrgtfyq..................
Mpf_ENSMPUP00000012035 EDRDD.MLAWIKTIQES------stlneedtgvtnrdlisrr...................................
Mpf_ENSMPUP00000009068 SSQRD.MEDWVQAIRRVIW----aplgggifgqrledtvhherkygprlapllveqcvdfirerglteeg.......
Mpf_ENSMPUP00000000172 ESKYT.FGRWMEVIERA------......................................................
Mpf_ENSMPUP00000013402 -----.-----------------alfhtddienakyisrlfatrhkfykqnkicteqsnspppirrqptwsrsslpr
Mpf_ENSMPUP00000012726 ADALH.VKAWVSDIQECLS----pgpcp.................................................
Mpf_ENSMPUP00000010329 KSQQD.KRLWVLHLKRLILE---nhaakipakakqailemdaihyp...............................
Mpf_ENSMPUP00000005886 TNEAL.V----------------deimltlkqaftvaavq.....................................
Mpf_ENSMPUP00000011911 -----.-----------------pyrflrkfgsdkdvfsfeagrrcdsgeglfafssprapdlcravaaaiarqrer
Mpf_ENSMPUP00000013895 DNINE.RTAWVQKIKAA------seqyidtekkk...........................................
Mpf_ENSMPUP00000009754 ESDAE.RKEWMQALQQAV-----a.....................................................
Mpf_ENSMPUP00000017452 SSKEE.RNSWIHIIQDTI-----n.....................................................
Mpf_ENSMPUP00000004281 ANADI.QQAWVQDINQVL-----etqrdfl...............................................
Mpf_ENSMPUP00000017577 KDEEE.MNGWLEAV---------aasvg.................................................
Mpf_ENSMPUP00000004977 ASRDD.RSTWIRVIQQSV-----r.....................................................
Mpf_ENSMPUP00000017884 -----.-----------------eqaagigksakivvhlhpappnkepgpfqssknsyiklsfkehgqiefyrrlse
Mpf_ENSMPUP00000007027 DSPGL.LEEWIRALQSLL-----kv....................................................
Mpf_ENSMPUP00000012725 QDGQS.AQQWMDRIQSCI-----......................................................
Mpf_ENSMPUP00000000871 -----.-----------------gqavlqlgiegapqslsiktsslaeaenmadlvdgycrlqgehkgsliihp...
Mpf_ENSMPUP00000006220 ATPKE.RTEWIKAIQV-------asr...................................................
Mpf_ENSMPUP00000008418 ----D.QDSWVPAMLS-------vsdslmtahriqaeagaeeeplwqcpvrlvtfigvgrdphtfgliadlgrqsfq
Mpf_ENSMPUP00000003932 -----.-----------------llsirrcghseqyfflevgrstvigpgelwmqvddcvvaqnmhelflekmral.
Mpf_ENSMPUP00000001861 -----.-----------------mfseiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvg...
Mpf_ENSMPUP00000008418 D----.-----------------vpakaiasalhglcaqilservgvn.............................
Mpf_ENSMPUP00000006249 SSQAE.MEEWVKFLKRV------a.....................................................
Mpf_ENSMPUP00000003836 TSNQE.MKRWLQAMDKA------a.....................................................
Mpf_ENSMPUP00000015858 KCVNE.LNQWLSALRKV------sisnpgllgsyhpgvfrgdkwscchqkdksdlgcdkt.................
Mpf_ENSMPUP00000002835 PSPAE.AQHWVQGLRKI------i.....................................................
Mpf_ENSMPUP00000004473 RTEEE.KKEWIQVIEATIERH--kqn...................................................
Mpf_ENSMPUP00000000137 VHFKD.MNRWLNRINML------t.....................................................
Mpf_ENSMPUP00000001907 ADPAV.SQAWIKQVAQIL-----esqrdfl...............................................
Mpf_ENSMPUP00000014024 RSQEE.MISWIQACQAAIDQ---iekrnetfkaavqgpegdtqeqeqlqseelglrapqwvrdkmvtmcmrcr....
Mpf_ENSMPUP00000001742 ENRKE.MEDWMSSLKSVQTR---epyevaqfnvehfsgmhnwyacsharpt..........................
Mpf_ENSMPUP00000000172 STRLE.KEKWICDLNTAID----aak...................................................
Mpf_ENSMPUP00000005480 DNRKE.MEEWIAALKTVQNR---ehfeptqysmdhfsgmhnwyacsharpt..........................
Mpf_ENSMPUP00000018515 ATATE.KSEWMNHINKCVT----d.....................................................
Mpf_ENSMPUP00000009502 KTGVE.ADEWIKIL---------r.....................................................
Mpf_ENSMPUP00000013672 -----.-----------------mmpfylmkdceikqpvfganyikgtvkaeagggwegaasykltftaggaiefgq
Mpf_ENSMPUP00000011336 RTEEE.KKDWVQAINSTLL----kheqt.................................................
Mpf_ENSMPUP00000001410 NTADV.ANIWVTGLR--------yli...................................................
Mpf_ENSMPUP00000003424 KDEE-.-----------------t.....................................................
Mpf_ENSMPUP00000007040 -----.-----------------kilayteglhgkwlfteirsifsrryllqntaleifmanrvavmfnfpdpatvk
Mpf_ENSMPUP00000019493 ENAKI.KREWLEVLEET------kralsek...............................................
Mpf_ENSMPUP00000018830 ASATE.RQEWISHIEECVRR---q.....................................................
Mpf_ENSMPUP00000003141 ASESL.V----------------devmltlrqafstaa.......................................
Mpf_ENSMPUP00000010983 ESPED.ASQWFSVLSQ-------v.....................................................
Mpf_ENSMPUP00000010498 -----.-----------------gavpngfifeggtrcgywagvfflssaegeqisflfdcivrgisptkgpfglrp
Mpf_ENSMPUP00000012786 QSPEE.MQGWINKINCV------aavfsappfpaaigsqkkfsrpllp.............................
Mpf_ENSMPUP00000014114 DSEKL.RQAWVRAVQASIA----sayr..................................................
Mpf_ENSMPUP00000007256 -----.-----------------ditdhrafgyvcgkegnhrfvaiktaqaaepvildlrdlfqliyelkqreelek
Mpf_ENSMPUP00000005608 QDPDH.RQQWIDAIEQ-------h.....................................................
Mpf_ENSMPUP00000002033 QDVPS.AQQWVDQIQSC------l.....................................................
Mpf_ENSMPUP00000016751 -----.-----------------esnlssvcyifesnnegekicdsvglakqialhaeldrr...............
Mpf_ENSMPUP00000016435 NSAEE.AKIWMQGLQ--------llv...................................................
Mpf_ENSMPUP00000001167 DNEAE.QDSWYQALLQ-------......................................................
Mpf_ENSMPUP00000001585 RNPTT.GKSWTAL----------crlvfklsvpqhvsllpgqvirlrevlererkrr....................
Mpf_ENSMPUP00000002351 ASKEI.RDCWFSEISKLLMEQ--qns...................................................
Mpf_ENSMPUP00000011499 SSRSE.MEKWVEDIQMAID----la....................................................
Mpf_ENSMPUP00000005375 -----.-----------------svvllfkmistraasglyraitethafyrcdtvtsavmmqysrdlkghlaslfl
Mpf_ENSMPUP00000015986 -----.-----------------evllmahalrrilystwcpadcqfafmarnpqspanklfchlfvgnqpgevqil
Mpf_ENSMPUP00000004747 -----.-----------------eikeavsrilysfctafkrssrqvtdv...........................
Mpf_ENSMPUP00000009754 ESAEL.AREWVKCIAKA------......................................................
Mpf_ENSMPUP00000002257 CSSQH.K----------------fqlqmrarqsnqdaq.......................................
Mpf_ENSMPUP00000006734 SGQAL.CRGWVDAIYNAQN----q.....................................................
Mpf_ENSMPUP00000003502 -----.-----------------cnvfkskkksqamrivrtvgqafevchklsl.......................
Mpf_ENSMPUP00000011019 -----.-----------------pltcieqivtvndhkrkqkvlgpnqklkfnpteliiyckdfrivrfrfdesgpe
Mpf_ENSMPUP00000003673 DSDPE.LVQWKKELRDAYRE---aqqlvqrvpkm...........................................
Mpf_ENSMPUP00000000383 KKE--.-----------------vrnkvysrllsl..........................................
Mpf_ENSMPUP00000008997 PSKEE.MLSWILRIN--------lvaaifsapsfpaavssmkkfcrpllp...........................
Mpf_ENSMPUP00000010040 DSERL.LHRWVSAVQSSIA----sa....................................................
Mpf_ENSMPUP00000007257 DDAHS.AQKWIEAFQE-------......................................................
Mpf_ENSMPUP00000016774 PSLEQ.MQSWVTRIN--------vvaamf................................................
Mpf_ENSMPUP00000001960 QSRDQ.AEQWLRVIQEV------s.....................................................
Mpf_ENSMPUP00000007610 PSGDE.ARTWVTGLR--------ylm...................................................
Mpf_ENSMPUP00000017612 KNQEE.KRLWIHCLQRLFFE---nhpas.................................................
Mpf_ENSMPUP00000007907 NSADV.ANIWVSGLR--------ylv...................................................
Mpf_ENSMPUP00000014021 -----.-----------------gtpesdcfafteshynaelfrihvfrceiqeavsrilysfatafrrsak.....
Mpf_ENSMPUP00000008982 DSAKT.-----------------ckyllrlcsaqhgfnaqmsslpvaav............................
Mpf_ENSMPUP00000005803 EKEEE.RNDWISILLNA------l.....................................................
Mpf_ENSMPUP00000002728 SNPEE.ARTWITGLK--------ylm...................................................
Mpf_ENSMPUP00000007017 SSKAE.RAEWIEAIKK-------......................................................
Mpf_ENSMPUP00000003752 -----.-----------------qlfrenqgvarvetsimdakplvllmewpeatnfacliagycrllldsrkmvfs
Mpf_ENSMPUP00000001306 ESINE.R----------------......................................................
Mpf_ENSMPUP00000005338 -----.-----------------qewsltnikrwaaspksftldfgdyqdgyysvqttegeqiaqliagyidii...
Mpf_ENSMPUP00000001689 ETEQE.MEEWLLTLKKIIQ----intdslvqekk...........................................
Mpf_ENSMPUP00000010415 QSKEQ.AEQWLKVIR--------d.....................................................
Mpf_ENSMPUP00000006220 AFLEE.RDAWVRDIKKAIK----c.....................................................
Mpf_ENSMPUP00000016350 LNDKD.MNDWLYAF---------n.....................................................
Mpf_ENSMPUP00000018773 -----.-----------------ekaqamalllyqtsanalaefkrlkrrd..........................
Mpf_ENSMPUP00000017599 DSPDE.REEWMRAIQMVAN----slkq..................................................
Mpf_ENSMPUP00000016349 LNDKD.MNDWLYAF---------n.....................................................
Mpf_ENSMPUP00000015036 EDRDD.MLGWIRAIRE-------nsraegedpgcanqalis....................................
Mpf_ENSMPUP00000007938 ESEAQ.RDTWCSTLQSCLR----e.....................................................
Mpf_ENSMPUP00000007257 SSATE.RDEWLEAISRSIEE---ya....................................................
Mpf_ENSMPUP00000005203 -----.-----------------iyytgcpmrsrhllqllsnshrlymnlqpvlrhirkleeneekkqyresyisds
Mpf_ENSMPUP00000000650 -----.-----------------plttvkrwaaspksftldfgeyqesyysvqttegeqisqliagyidii......
Mpf_ENSMPUP00000007937 ETPEQ.AEDWMKGLQ--------afc...................................................
Mpf_ENSMPUP00000007017 CSREE.RDAWAFEITGAI-----hagqpgkvqqlhilknsfklpphislhrivdkm.....................
Mpf_ENSMPUP00000012780 SSEVE.RQQWITALELAKA----kavrmmsshsddsgddd.....................................
Mpf_ENSMPUP00000002522 -----.-----------------dsfvrvelhvldvkpitllmessdamnlacltagyyrllvdsrrsifnm.....
Mpf_ENSMPUP00000004905 ESLES.REMWKGFILT-------vvelrvpsnltllpghlymmaealakeearr.......................
Mpf_ENSMPUP00000011326 DSEAE.MEEWITILNKIL-----qlnfeaamqekrn.........................................
Mpf_ENSMPUP00000009449 PTAKE.MSSWIVRINLA------aathsappfpaavgsqrrfvrpilp.............................
Mpf_ENSMPUP00000000014 MTSGI.RRNWIQTIMKHV-----hptsa.................................................
Mpf_ENSMPUP00000012737 MTSGI.RRNWIEALRKTV-----rpt...................................................
Mpf_ENSMPUP00000002136 ETPEE.REEWTTAIQTVAD----glkrq.................................................
Mpf_ENSMPUP00000017782 ETEME.QRAWVEAFRKVVDR---pmlpqeya..............................................
Mpf_ENSMPUP00000013550 ESDPE.FVQWKKELTETFTE---aqrllrrap.............................................
Mpf_ENSMPUP00000017362 TSESD.GRCWMDALELA------lk....................................................
Mpf_ENSMPUP00000006996 RDADE.REKWIHALEETILRH--tlql..................................................
Mpf_ENSMPUP00000004785 PSAEA.MRIWMDVI---------v.....................................................
Mpf_ENSMPUP00000014164 QSREQ.AEEWLKVIRE-------vs....................................................
Mpf_ENSMPUP00000016592 ETESD.MDEWIHTLNRIL-----q.....................................................
Mpf_ENSMPUP00000000486 ETRQR.AEEWMEALKTAA-----nvarsteqnlqvtlrskpkdqmgghelr..........................
Mpf_ENSMPUP00000003712 DSEKL.RQAWIKAVQTSIA----tayr..................................................
Mpf_ENSMPUP00000006850 PSPEA.MRIWMDVIVTA------ad....................................................
Mpf_ENSMPUP00000015574 -----.-----------------pppalrlsllsvrrcghadsffflelgrsaptgpgelwlqapdalvaqsihetv
Mpf_ENSMPUP00000014962 -----.-----------------revhlrrfnlrrsalelffidqanyflnfpckvrnqvyslllrlr.........
Mpf_ENSMPUP00000016814 PSATD.RAQWLEK----------tqqa..................................................
Mpf_ENSMPUP00000000139 NSDKD.MHDWLYAF---------n.....................................................
Mpf_ENSMPUP00000012020 ESRKE.NEEWICAINN-------i.....................................................
Mpf_ENSMPUP00000006069 ESNSA.-----------------kdlacliagyyrlfvdpdtpiflwp.............................
Mpf_ENSMPUP00000017142 SSCAE.RDEWHSCLSRAL-----p.....................................................
Mpf_ENSMPUP00000013991 PNRKD.MEEWINVIKTVQQG---eirkipaaennpfltgmhywysshss............................
Mpf_ENSMPUP00000010353 -----.-----------------qkgirnkvyqrfl.........................................
Mpf_ENSMPUP00000000014 ETKEI.ISGWLEML---------mvyprtnkqnqkkkrkvepptpqepgpakvavtss...................
Mpf_ENSMPUP00000009546 NDQKD.LKDWVEALNQA------skitv.................................................
Mpf_ENSMPUP00000012020 NSEGE.K----------------icyainlgk.............................................
Mpf_ENSMPUP00000016751 ESKKD.HEEWICTINN-------i.....................................................
Mpf_ENSMPUP00000000216 DSEEL.KQKWLKII---------fla...................................................
Mpf_ENSMPUP00000010854 SSEDE.RKSWMALLRKE------i.....................................................
Mpf_ENSMPUP00000016813 DDEQD.RILWVQAMYRAT-----gqshkpvpptqvqk........................................
Mpf_ENSMPUP00000002870 NDQQD.LVEWVNVLNKAIK----itvp..................................................
Mpf_ENSMPUP00000003651 DIDFI.ILDWFHAIKNAIDR---lpkdpsg...............................................
Mpf_ENSMPUP00000002370 KTPEE.KHEWFEAILK-------erer..................................................
Mpf_ENSMPUP00000006780 DDEQD.RVLWVQAMYRAT-----gqsykpipviqtqkl.......................................
Mpf_ENSMPUP00000002802 KDEKN.AEEWLQCINVA------va....................................................
Mpf_ENSMPUP00000011336 ETEEL.QRRWMAVLGRA------......................................................
Mpf_ENSMPUP00000003120 VNAAE.RQRWLVALG--------ss....................................................
Mpf_ENSMPUP00000005803 ETSQA.QRKWTEAIAK-------hfvpfvaenlteadydligqlyykdchaldqwrkgwfsm...............
Mpf_ENSMPUP00000004980 RSVAE.RQRWLVALGSA------ka....................................................
Mpf_ENSMPUP00000015621 DTPEE.REEWTEAIQAVAD----rlqrq.................................................
Mpf_ENSMPUP00000003141 -----.-----------------tyfaylikaqpddpesqmachvfratdpnqvpdvissirqlskaamked.....
Mpf_ENSMPUP00000013099 EDEQE.CQIWMSVLQNSK-----eealnnafkgddn.........................................
Mpf_ENSMPUP00000010983 KLLNE.ATRWSSAIQNV------tdtkapidtptqqli.......................................
Mpf_ENSMPUP00000004910 ASESD.GRCWLDALELA------lr....................................................
Mpf_ENSMPUP00000016233 -----.-----------------tvndsmcsfmmpfdlmsnctveqpvftpnfikgiiqaapdggwegqatfklafr
Mpf_ENSMPUP00000002953 -----.-----------------tlllafdntkvrddvyhsil..................................
Mpf_ENSMPUP00000011716 ESTDD.CLAWKFTLQDSRT----ntgy..................................................
Mpf_ENSMPUP00000007767 DTKEE.RDLWMQKLNQI------lv....................................................
Mpf_ENSMPUP00000014585 PSEKE.QREWLESFQDVL-----s.....................................................
Mpf_ENSMPUP00000014164 NCSED.MGRWLGLL---------......................................................
Mpf_ENSMPUP00000005886 -----.-----------------nshdpsyfaclikdhtasqqsicyvfkaddqtkvpeiissirqagkiarqe...
Mpf_ENSMPUP00000013797 PSQAE.LGHWLYHLEKQI-----alv...................................................
Mpf_ENSMPUP00000004108 TDAKE.RQHWVSRLQIC------tqhhteaigknnpplksrs...................................
Mpf_ENSMPUP00000009167 DSKED.ASKWLSGL---------kilh..................................................
Mpf_ENSMPUP00000016226 DSEAD.MADWMQHLCQA------v.....................................................
Mpf_ENSMPUP00000014024 ETEEL.RDRWVKAMERA------a.....................................................
Mpf_ENSMPUP00000008448 -----.-----------------snwssgntyfhitignlvrgskllcetslgykmddlltsyisqm..........
Mpf_ENSMPUP00000010607 -----.-----------------lfglvtmqsgddgslahedegalrtschvfmvdpdlfshkihqgiarrfgfect
Mpf_ENSMPUP00000015774 EDEHE.CEAWVSVLQNSKD----eal...................................................
Mpf_ENSMPUP00000008639 ATAEE.AQRWVRGL---------ak....................................................
Mpf_ENSMPUP00000012941 DNDTV.INDWFKVLSSTISNQT-etdeaieeeip...........................................
Mpf_ENSMPUP00000016218 NDVFH.KQQWFNCIRAAI-----......................................................
Mpf_ENSMPUP00000007001 ETQSE.KLRWISALA--------mpreeldllecydspqvqclraykpr............................
Mpf_ENSMPUP00000001986 SSQTD.LENWVTAIHSA------casl..................................................
Mpf_ENSMPUP00000010415 SSSED.MGRWIGIL---------la....................................................
Mpf_ENSMPUP00000003836 ENKTE.NQRWIMALKASIK----k.....................................................
Mpf_ENSMPUP00000007027 GTKHE.KDTWLYHLTV-------aaggssatvgta..........................................
Mpf_ENSMPUP00000002688 ETQSE.RARWITALGH-------ss....................................................
Mpf_ENSMPUP00000001373 EDEQD.YVAWISVLTNS------keealtmafrgeqstg......................................
Mpf_ENSMPUP00000013700 SSDYE.RSEWREAIQKLQK----k.....................................................
Mpf_ENSMPUP00000016589 -----.-----------------llttypftkisswssgstyfhmalgslargsrllcetslgykmddlltsyvqq.
Mpf_ENSMPUP00000015325 EDAKD.CDEWVAAIAHA------s.....................................................
Mpf_ENSMPUP00000001960 KSSEE.MGHWLGLLL--------se....................................................
Mpf_ENSMPUP00000006310 -----.-----------------qwnvnweirqvaiefdqnvsiaftclsadckivheyiggyifls..........
Mpf_ENSMPUP00000016747 NDTFN.KQQWLNCIRQA------......................................................
Mpf_ENSMPUP00000013323 KSEEI.FDEWVSKLRH-------h.....................................................
Mpf_ENSMPUP00000007350 ESEFE.QTQWLEMLQE-------sgkvtwknaql...........................................
Mpf_ENSMPUP00000017588 TSEDE.VNMWVKGLT--------wlm...................................................
Mpf_ENSMPUP00000007745 PDKHE.YCIWTDGLN--------all...................................................
Mpf_ENSMPUP00000006409 ATKQV.MLYWLQQLQT-------krwefhss..............................................
Mpf_ENSMPUP00000015574 ACEAE.QQAWYSALL--------e.....................................................
Mpf_ENSMPUP00000008365 DSEAI.ISTWHKAIGEGIQE---lsadlppeeeses.........................................
Mpf_ENSMPUP00000001054 TSQTE.LENWITAIHSA------caaavarhhhkedtlrllkseikkleqkidmdekmk..................
Mpf_ENSMPUP00000017488 PNKYE.YCIWIDGLS--------all...................................................
Mpf_ENSMPUP00000005234 TSQSE.MKRWMTSL---------apnrrt................................................
Mpf_ENSMPUP00000013182 QDEKQ.YAHWMA-----------gcrlas................................................
Mpf_ENSMPUP00000011513 -----.-----------------ascgilrgdnk...........................................
Mpf_ENSMPUP00000005385 -----.-----------------vnweikmvtvefadevrlsfictevdckvvhefiggyifls.............
Mpf_ENSMPUP00000009077 -----.-----------------ssdhyscqshsygdlrelrqarfllqdialelffqngyskflvfhnndrnmvfk
Mpf_ENSMPUP00000001767 -----.-----------------krfvgplgtiiikckdfriiqldipgmeeclniassiealstldsitlmypffy
Mpf_ENSMPUP00000007827 LSEED.RRLWMEAM---------d.....................................................
Mpf_ENSMPUP00000000541 TSGEE.KESWIKALNE-------gi....................................................
Mpf_ENSMPUP00000001809 DQEIE.WRAWHRALRAVIE----rldrenplel............................................
Mpf_ENSMPUP00000005803 DSLQT.QMEWMAN----------vfiaqhendirppagkerkrsitknpkigglplipiqh................
Mpf_ENSMPUP00000013182 -----.-----------------nmrqwnvnwdirqvaiefdehinvafscvsascrivheyiggyifls.......
Mpf_ENSMPUP00000005315 VSPEE.KESWISALNSAITRA--knrildevtvee..........................................
Mpf_ENSMPUP00000014585 ESGKE.IVDWFNALRA-------a.....................................................
Mpf_ENSMPUP00000015166 KSQDL.FQSWVAQLR--------ahrltmpr..............................................
Mpf_ENSMPUP00000002409 -----.-----------------npntayqkqqdtlivwseaenydlalsfqekagcdeiwekicqvq.........
Mpf_ENSMPUP00000005807 -----.-----------------eqr...................................................
Mpf_ENSMPUP00000013796 ASYED.YSHWLLCLQT-------is....................................................
Mpf_ENSMPUP00000017782 EDGKE.IVDWFNALRAA------r.....................................................
Mpf_ENSMPUP00000019464 DGPAA.QEAWVKALSRAS-----fsymrlvvreles.........................................
Mpf_ENSMPUP00000012725 -----.-----------------sitkekkitmqnqlqqnmqeglqitsasfqlikvafdeevspevveifkkqlmk
Mpf_ENSMPUP00000010996 DNRED.LQKWMEAFWQH------ffdlsqwkhcceelmkieimsprkppl...........................
Mpf_ENSMPUP00000007938 TNEDE.MWDWTTSI---------l.....................................................
Mpf_ENSMPUP00000009654 ETKDD.AIAWKTALLEA------nstp..................................................
Mpf_ENSMPUP00000005385 DNEKQ.YAHWMAACR--------lask..................................................
Mpf_ENSMPUP00000006310 DHENQ.YAQWMAAC---------ilask.................................................
Mpf_ENSMPUP00000007963 ETEED.MNKWVQSICQI------cgfnqaeestdslrnlssss..................................
Mpf_ENSMPUP00000002310 TTYEE.RDAWVQAIESQI-----laslqscess............................................
Mpf_ENSMPUP00000000486 ESPWE.ALDWGQKLWEVV-----haavpgyvgr............................................
Mpf_ENSMPUP00000007805 -----.-----------------eskinpntayqkqqdtlivwseaenydlalsfqekagcdeiwekicqvq.....
Mpf_ENSMPUP00000010246 -----.-----------------ykrrhglmplglevfcteddlcsdiylkfyepqdrddlyfyi............
Mpf_ENSMPUP00000004460 DSELE.AEEWYKTL---------sv....................................................
Mpf_ENSMPUP00000014791 EVEDD.KFLWLSVLQSAIKS---sm....................................................
Mpf_ENSMPUP00000003154 KSQDW.FDAWVSKLRH-------hrlyrqnei.............................................
Mpf_ENSMPUP00000005214 TDQEE.LLHWHHSLTLAISS---qk....................................................
Mpf_ENSMPUP00000003932 ENESE.QESWYLLLSR-------l.....................................................
Mpf_ENSMPUP00000008710 STAEE.RELWVQSVQAQ------ilaslqgcrsa...........................................
Mpf_ENSMPUP00000005632 PSKRE.FHLWTDGLS--------all...................................................
Mpf_ENSMPUP00000002828 SSDYE.RAEWRENIREQQKK---c.....................................................
Mpf_ENSMPUP00000017859 -----.-----------------sqistiekqattatgcpllircknfqllqliipqerdchdvyislirlarpvky
Mpf_ENSMPUP00000013754 GSRFH.AILWHKHLDDAC-----ksnrpqvp..............................................
Mpf_ENSMPUP00000004548 LSEAN.RRLWMEAM---------d.....................................................
Mpf_ENSMPUP00000000646 -----.-----------------hhialveklalttsgcplviqcknfrivhfivprerdchdiynsllqlskqaky
Mpf_ENSMPUP00000004473 PSADL.RQQWLEALSAA------a.....................................................
Mpf_ENSMPUP00000000402 DDMRT.LHQWVNGIR--------iakygkql..............................................
Mpf_ENSMPUP00000007412 DSASD.RARWITAL---------t.....................................................
Mpf_ENSMPUP00000004935 SSLKE.ALSFVSLI---------dgyyrltadahhylcke.....................................
Mpf_ENSMPUP00000011513 GSKHE.KDTWLYHLT--------vaagsnn...............................................
Mpf_ENSMPUP00000001759 FSEAN.RKLWLEAM---------d.....................................................
Mpf_ENSMPUP00000008353 SSQDE.AEDWLDRVREALQKC--rpqqedewvniqyp........................................
Mpf_ENSMPUP00000012083 DDART.LNQWVMGI---------riaky.................................................
Mpf_ENSMPUP00000006956 FSEEE.RKQWLEAL---------g.....................................................
Mpf_ENSMPUP00000014860 EDEQS.RGCWLAAFR--------lfkygaqly.............................................
Mpf_ENSMPUP00000009647 PSLQD.RLRFTSDLRESIAE---vqemek................................................
Mpf_ENSMPUP00000005803 ESEKE.KQEWIEAVQQSIAE---tlsdy.................................................
Mpf_ENSMPUP00000005109 GNRMN.AMLWFKHLSAACQ----snkqqvp...............................................
Mpf_ENSMPUP00000006149 ESDLE.ADEWCKVLQM-------e.....................................................
Mpf_ENSMPUP00000001981 ASFEE.RDAWVQAIESQI-----laslqcce..............................................
Mpf_ENSMPUP00000017916 LGSDE.MQKFVEDLKESIA----e.....................................................
Mpf_ENSMPUP00000003318 SSPEQ.KDKWLSLLQRYI-----......................................................
Mpf_ENSMPUP00000017175 PNPQD.RKKFTDDLRESIAE---vqemek................................................
Mpf_ENSMPUP00000016038 KTEVE.MLVWVYSISQV------cnlgql................................................
Mpf_ENSMPUP00000016192 RTESE.KQRWISALC--------ps....................................................
Mpf_ENSMPUP00000015325 SSRQE.KAAWTSDISQCVDN---i.....................................................
Mpf_ENSMPUP00000000660 EEEQS.RTCWVTAIRL-------lkyg..................................................
Mpf_ENSMPUP00000005493 -----.-----------------avsglsrvqllrpgsplkfipeeilihgrdfrllrvafeagglepqafqvtmai
Mpf_ENSMPUP00000009754 ETQME.LREWFATFLFV------qhdglvwpsepsrvsraapevrlgsvsliplrgsenem................
Mpf_ENSMPUP00000013796 -----.-----------------vwgawtvgrgypepaggqwsrmvpagpahspplppgplpaplhvlcpsqaelgh
Mpf_ENSMPUP00000010667 ESK--.-----------------ewkergiapasf..........................................
Mpf_ENSMPUP00000013126 ETQEE.VDSWKASFLRA------gvyp..................................................
Mpf_ENSMPUP00000018046 EDEQG.RTCWMTACRL-------lkygmll...............................................
Mpf_ENSMPUP00000006359 FQEEV.AKEWTNEVFSLAT----nllaqn................................................
Mpf_ENSMPUP00000015086 -----.-----------------fglrytkeeevkrivsgiihhtqvpkllkrlflfsy..................
Mpf_ENSMPUP00000008387 PSRQE.KAAWMSDISQCVDN---i.....................................................
Mpf_ENSMPUP00000015207 STFKQ.CQEWLSRLSRATA----rpakpedlfafay.........................................
Mpf_ENSMPUP00000004217 -----.-----------------vielwkkhtlaredvfpanalleirpfqvwlhhldhkgeatvhmdtfqvariay
Mpf_ENSMPUP00000015689 -----.-----------------lsfvalvdgyfrlisdsrhffcke..............................
Mpf_ENSMPUP00000015159 -----.-----------------sgtitlrckdlrvlqldiegveatldiarsiealsslesvitsfpffyr.....
Mpf_ENSMPUP00000018833 -----.-----------------yqkqqetliiwsegenhgvalsfqdtegchkiweeichiq..............
Mpf_ENSMPUP00000007866 ESRGA.LHSWMEALWQL------ffdmsqwkqccdeimkietpapr...............................
Mpf_ENSMPUP00000007938 ESGGA.RQSWAAALQEAVTE---tlsdyevaekiwsn........................................
Mpf_ENSMPUP00000010694 LSAED.CVDWLQAIAT-------nis...................................................
Mpf_ENSMPUP00000013131 STFEQ.CQEWLKRLNNAIR----ppakiedlfsfay.........................................
Mpf_ENSMPUP00000000312 STPQE.KTKWLRAISQAVDQ---alrgtsd...............................................
Mpf_ENSMPUP00000019132 -----.-----------------p.....................................................
Mpf_ENSMPUP00000015959 RSAAE.RDRWIEDLRRHF-----qpsqdnlereetwlsvwvhe..................................
Mpf_ENSMPUP00000012612 SSAEE.RDQWIEAIRASITR---vpfy..................................................
Mpf_ENSMPUP00000007938 DGADS.LEAWTSA----------vg....................................................
Mpf_ENSMPUP00000007989 SSLSD.MQRWLGAF---------......................................................
Mpf_ENSMPUP00000016156 -----.-----------------nefkekgvgtlhlkptatqktqllvradtnlalla...................
Mpf_ENSMPUP00000013721 MTEAE.QDKWQAVLQDCIRH---cn....................................................
Mpf_ENSMPUP00000005447 CSQDE.QKKWVTHLVKK------ipknp.................................................
Mpf_ENSMPUP00000015768 ATGEA.QRAWRLALQG-------gi....................................................
Mpf_ENSMPUP00000004215 P-ASE.RSDWIQAIC--------......................................................
Mpf_ENSMPUP00000010108 PRQAE.AERWGLALREV------i.....................................................
Mpf_ENSMPUP00000002188 GDEQQ.LNSWMAELREC------tgq...................................................
Mpf_ENSMPUP00000013446 NSTEE.QQKWVSRLVK-------kipk..................................................
Mpf_ENSMPUP00000012407 ESEAE.RERWLQVLGELQ-----rllldtrprp............................................
Mpf_ENSMPUP00000017043 NSYRH.ARWWGGAIEEFI-----q.....................................................
Mpf_ENSMPUP00000007898 HSQEQ.KK---------------......................................................
Mpf_ENSMPUP00000017064 TSEELpKENWLKMLCRHVA----n.....................................................
Mpf_ENSMPUP00000009754 ESELE.KEQWLEAMQGAIAE---alstse................................................
Mpf_ENSMPUP00000016461 ATEQD.MNDWLALLN--------lsccesrr..............................................
Mpf_ENSMPUP00000008230 ADAPS.SAAWVQTLCR-------nafpkgswalap..........................................
Mpf_ENSMPUP00000001993 QDREK.IKDWVSFV---------ssfclgget.............................................
Mpf_ENSMPUP00000014500 SSEVE.RQRWVTALELAKAK---avkml.................................................
Mpf_ENSMPUP00000002405 RSAAE.RDKWIENLQRAVK----pnkdnsrrvdnvl.........................................
Mpf_ENSMPUP00000002933 PSFPD.KQRWVTALESVVA----g.....................................................
Mpf_ENSMPUP00000007268 RSAAE.RDKWMENLRRAVH----pnkdnsrrv.............................................
Mpf_ENSMPUP00000010983 DTPEE.MHHWITLLQR-------sk....................................................
Mpf_ENSMPUP00000010498 ESREA.MCAWDTRIRYAL-----gevhrfhvav............................................
Mpf_ENSMPUP00000018101 DSENE.KWEWVRVLRDL------hktl..................................................
Mpf_ENSMPUP00000002033 -----.-----------------altkekrisvqtpvdqllqdglqlrsctfqllkmafdeevgsdsaelfrkqlhk
Mpf_ENSMPUP00000010694 ELESD.LAQWERAFQTA------t.....................................................
Mpf_ENSMPUP00000008353 GSAEE.AALWRDLVRKVLA----syletae...............................................
Mpf_ENSMPUP00000009754 ERRLD.FTGWLGAIQKAAA----ssgdtlseqqlgdsdipvivyrcvdyitqcgltsegiy................
Mpf_ENSMPUP00000015718 ESENE.RNKWVGVLSEL------hki...................................................
Mpf_ENSMPUP00000002358 ENENE.KRKWVGILEGL------q.....................................................
Mpf_ENSMPUP00000005077 NSASE.RDKWMENLRRTVQ----pnkdncrraen...........................................
Mpf_ENSMPUP00000009107 PSE--.-----------------gqaesripalssaaaqslslehp...............................
Mpf_ENSMPUP00000016101 -----.-----------------sydkdnvliqhagakkasavgqaqnkvyfgpprlfqelqdlqkdlavveqitfl
Mpf_ENSMPUP00000011911 Q---H.RQEWMGPICQLA-----fqgtgesss.............................................
Mpf_ENSMPUP00000007938 EGRLD.FSAWNTAIEGAA-----ggggtalqeqqms.........................................
Mpf_ENSMPUP00000009676 -----.-----------------iv....................................................
Mpf_ENSMPUP00000005809 -----.-----------------avctvkstdsclffikcfddtihg..............................
Mpf_ENSMPUP00000016410 DTFTE.YLRWLRQVSKVAS----qrissv................................................
Mpf_ENSMPUP00000006638 -----.-----------------tlpsramalslvslvdgyfrltadsshylcre......................
Mpf_ENSMPUP00000005803 HSKLD.FTVWHTAIEKA------agtdgn................................................
Mpf_ENSMPUP00000010983 -----.-----------------e.....................................................
Mpf_ENSMPUP00000000717 SSHEE.ALSFVSLI---------dgyfrltadahhylct......................................
Mpf_ENSMPUP00000002793 FTPAI.KESWLNSLQMA------klaleeenhmgwfcv.......................................
Mpf_ENSMPUP00000007833 ETLAE.CQRWQ------------rq....................................................
Mpf_ENSMPUP00000002271 STQND.MEDWVKSIRRVIWG---pfgggifg..............................................
Mpf_ENSMPUP00000010974 DSQED.VDSWKASFLRA------gvy...................................................
Mpf_ENSMPUP00000010755 GSYRQ.ARWWGQEITEL------aq....................................................
Mpf_ENSMPUP00000013112 SSLEQ.AQA--------------ickvlstafds...........................................


                                                                                                    
                                                                                                    
d1dbha2                .............................................................................
Mpf_ENSMPUP00000000236 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000006133 igqafelrfkqylr...............................................................
Mpf_ENSMPUP00000009494 fesedaqliaqsigqafsvayqeflr...................................................
Mpf_ENSMPUP00000004093 nthadfadecpkpellairflnaenaqkfktkfeecrkeieerek................................
Mpf_ENSMPUP00000012215 vnqrachilecrsgmaqdvistigqafelrfkqylk.........................................
Mpf_ENSMPUP00000016175 .............................................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 fesedaqliaqsigqafsvayqeflr...................................................
Mpf_ENSMPUP00000016638 .............................................................................
Mpf_ENSMPUP00000018612 nthadfadecpkpellairflnaenaqkfktkfeecrkeieerek................................
Mpf_ENSMPUP00000018966 nthadfadecpkpellairflnaenaqkfktkfeecrkeieerek................................
Mpf_ENSMPUP00000004660 .............................................................................
Mpf_ENSMPUP00000002149 .............................................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 fkeaarlakeksqekmeltstpsqesaggdlqsplt.........................................
Mpf_ENSMPUP00000011363 .............................................................................
Mpf_ENSMPUP00000015445 .............................................................................
Mpf_ENSMPUP00000015195 .............................................................................
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 aqaigqafsvaysqfl.............................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 .............................................................................
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 kkrretverekeqmmrek...........................................................
Mpf_ENSMPUP00000010667 rfklqdvadsfkkifdeak..........................................................
Mpf_ENSMPUP00000000642 .............................................................................
Mpf_ENSMPUP00000015373 tqfaekfqevkeaarlareksqdggeltspalglaahqvppspl.................................
Mpf_ENSMPUP00000003213 .............................................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 lfafeyk......................................................................
Mpf_ENSMPUP00000003212 .............................................................................
Mpf_ENSMPUP00000001158 kkkremaekekeki...............................................................
Mpf_ENSMPUP00000010667 ktkemadcfkkkfeecqqnllk.......................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 kkkreiaekeker................................................................
Mpf_ENSMPUP00000003768 cafaaclerkq..................................................................
Mpf_ENSMPUP00000008012 hdy..........................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 eqlaakfktpelaeefkqkfeecq.....................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 fkvafefwqmskeek..............................................................
Mpf_ENSMPUP00000008341 vlalvkhpltan.................................................................
Mpf_ENSMPUP00000017573 reke.........................................................................
Mpf_ENSMPUP00000012859 .............................................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 vpyerrhsk....................................................................
Mpf_ENSMPUP00000013200 mreeaertrdel.................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 gghkkvqferkhsk...............................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 .............................................................................
Mpf_ENSMPUP00000002913 .............................................................................
Mpf_ENSMPUP00000003504 .............................................................................
Mpf_ENSMPUP00000004361 taq..........................................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 evgaeqlrtglqralee............................................................
Mpf_ENSMPUP00000006376 .............................................................................
Mpf_ENSMPUP00000014536 lgskfrysgrtqaqtrqastlidrpaphfertsskr.........................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 rtqaqtrqasalidrpapfferssskr..................................................
Mpf_ENSMPUP00000006727 .............................................................................
Mpf_ENSMPUP00000000961 hyftlgskfrycgrtevqsvqygkekankdrvfarspsk......................................
Mpf_ENSMPUP00000004942 sgrtqaqtrrasalidrpapyferssskr................................................
Mpf_ENSMPUP00000002151 ygkkgrltslpferkh.............................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 prrstsferrpsk................................................................
Mpf_ENSMPUP00000010395 .............................................................................
Mpf_ENSMPUP00000015361 skfrysgrtqaqtrqasalidrpaphfertaskr...........................................
Mpf_ENSMPUP00000001991 vhrtsmtq.....................................................................
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 r............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 .............................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 .............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 .............................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 lvqekiqkr....................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 siqlprpdqnvarsrsk............................................................
Mpf_ENSMPUP00000010571 grvakevmessakikreppeih.......................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 qk...........................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 vpavlprpespys................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 ltepmtlsksislp...............................................................
Mpf_ENSMPUP00000007327 nqyckkviggmvwnpalrrslsve.....................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 qrhynghytepytssq.............................................................
Mpf_ENSMPUP00000001167 ram..........................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 .............................................................................
Mpf_ENSMPUP00000012096 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 lem..........................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 idltetgtlktsklanmgskgkiis....................................................
Mpf_ENSMPUP00000016865 tleaksqfimasn................................................................
Mpf_ENSMPUP00000000090 .............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013402 qqpyilppmhvqcgehysethtsqd....................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000011911 lpelagprpcplpratslp..........................................................
Mpf_ENSMPUP00000013895 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 emtqrrw......................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 caafwcqphagglseavqaacmvqyqk..................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 rm...........................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 kvvnylprv....................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 vlpdps.......................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 k............................................................................
Mpf_ENSMPUP00000005608 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 nenin........................................................................
Mpf_ENSMPUP00000015986 hlllcrsfqlay.................................................................
Mpf_ENSMPUP00000004747 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 sakkvclaiahysqptdlqllfafey...................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 .............................................................................
Mpf_ENSMPUP00000014021 .............................................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 r............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 .............................................................................
Mpf_ENSMPUP00000018773 .............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 .............................................................................
Mpf_ENSMPUP00000015036 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 ldldvdqlekrsrasgss...........................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 .............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 .............................................................................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000016592 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 laamkrl......................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 .............................................................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 kggaiefaqmm..................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 adpdtngc.....................................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 .............................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 .............................................................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 sfcsfq.......................................................................
Mpf_ENSMPUP00000001767 r............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 frypqsifttfafaa..............................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 .............................................................................
Mpf_ENSMPUP00000005632 .............................................................................
Mpf_ENSMPUP00000002828 .............................................................................
Mpf_ENSMPUP00000017859 eelycfsf.....................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 edlyafsy.....................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 .............................................................................
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 vraraqssqaqqya...............................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 wlyhlekqialv.................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 .............................................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 ctadhnvspnifawvyreinddlsyqmdchaveceskleakklahammeafkktfhsmk..................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 .............................................................................
Mpf_ENSMPUP00000015768 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 .............................................................................
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 .............................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 lryppdirgtfafs...............................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 istlhgtyqnlnmtvaqdwclalqrlmrvkeeeihsankcrlrlllpgkpdksgrpisfmvvfitpnplskiswvnr
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 .............................................................................
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                          
                                          
d1dbha2                ...................
Mpf_ENSMPUP00000000236 ...................
Mpf_ENSMPUP00000001054 ...................
Mpf_ENSMPUP00000001986 ...................
Mpf_ENSMPUP00000006133 ...................
Mpf_ENSMPUP00000009494 ...................
Mpf_ENSMPUP00000004093 ...................
Mpf_ENSMPUP00000012215 ...................
Mpf_ENSMPUP00000016175 ...................
Mpf_ENSMPUP00000009909 ...................
Mpf_ENSMPUP00000010977 ...................
Mpf_ENSMPUP00000016638 ...................
Mpf_ENSMPUP00000018612 ...................
Mpf_ENSMPUP00000018966 ...................
Mpf_ENSMPUP00000004660 ...................
Mpf_ENSMPUP00000002149 ...................
Mpf_ENSMPUP00000018066 ...................
Mpf_ENSMPUP00000017958 ...................
Mpf_ENSMPUP00000011450 ...................
Mpf_ENSMPUP00000016402 ...................
Mpf_ENSMPUP00000004951 ...................
Mpf_ENSMPUP00000011363 ...................
Mpf_ENSMPUP00000015445 ...................
Mpf_ENSMPUP00000015195 ...................
Mpf_ENSMPUP00000011751 ...................
Mpf_ENSMPUP00000009831 ...................
Mpf_ENSMPUP00000004111 ...................
Mpf_ENSMPUP00000005349 ...................
Mpf_ENSMPUP00000006137 ...................
Mpf_ENSMPUP00000009095 ...................
Mpf_ENSMPUP00000005832 ...................
Mpf_ENSMPUP00000014567 ...................
Mpf_ENSMPUP00000015198 ...................
Mpf_ENSMPUP00000008441 ...................
Mpf_ENSMPUP00000005146 ...................
Mpf_ENSMPUP00000010667 ...................
Mpf_ENSMPUP00000000642 ...................
Mpf_ENSMPUP00000015373 ...................
Mpf_ENSMPUP00000003213 ...................
Mpf_ENSMPUP00000012196 ...................
Mpf_ENSMPUP00000012194 ...................
Mpf_ENSMPUP00000003212 ...................
Mpf_ENSMPUP00000001158 ...................
Mpf_ENSMPUP00000010667 ...................
Mpf_ENSMPUP00000013386 ...................
Mpf_ENSMPUP00000016712 ...................
Mpf_ENSMPUP00000003302 ...................
Mpf_ENSMPUP00000003768 ...................
Mpf_ENSMPUP00000008012 ...................
Mpf_ENSMPUP00000002625 ...................
Mpf_ENSMPUP00000010667 ...................
Mpf_ENSMPUP00000006140 ...................
Mpf_ENSMPUP00000015670 ...................
Mpf_ENSMPUP00000008341 ...................
Mpf_ENSMPUP00000017573 ...................
Mpf_ENSMPUP00000012859 ...................
Mpf_ENSMPUP00000012131 ...................
Mpf_ENSMPUP00000000172 ...................
Mpf_ENSMPUP00000013200 ...................
Mpf_ENSMPUP00000003522 ...................
Mpf_ENSMPUP00000011499 ...................
Mpf_ENSMPUP00000011494 ...................
Mpf_ENSMPUP00000012716 ...................
Mpf_ENSMPUP00000002913 ...................
Mpf_ENSMPUP00000003504 ...................
Mpf_ENSMPUP00000004361 ...................
Mpf_ENSMPUP00000017389 ...................
Mpf_ENSMPUP00000015829 ...................
Mpf_ENSMPUP00000003644 ...................
Mpf_ENSMPUP00000006376 ...................
Mpf_ENSMPUP00000014536 ...................
Mpf_ENSMPUP00000011501 ...................
Mpf_ENSMPUP00000017670 ...................
Mpf_ENSMPUP00000006727 ...................
Mpf_ENSMPUP00000000961 ...................
Mpf_ENSMPUP00000004942 ...................
Mpf_ENSMPUP00000002151 ...................
Mpf_ENSMPUP00000014680 ...................
Mpf_ENSMPUP00000005563 ...................
Mpf_ENSMPUP00000011333 ...................
Mpf_ENSMPUP00000000969 ...................
Mpf_ENSMPUP00000010395 ...................
Mpf_ENSMPUP00000015361 ...................
Mpf_ENSMPUP00000001991 ...................
Mpf_ENSMPUP00000005637 ...................
Mpf_ENSMPUP00000007307 ...................
Mpf_ENSMPUP00000008193 ...................
Mpf_ENSMPUP00000007177 ...................
Mpf_ENSMPUP00000010360 ...................
Mpf_ENSMPUP00000010611 ...................
Mpf_ENSMPUP00000007161 ...................
Mpf_ENSMPUP00000006134 ...................
Mpf_ENSMPUP00000004983 ...................
Mpf_ENSMPUP00000001920 ...................
Mpf_ENSMPUP00000013542 ...................
Mpf_ENSMPUP00000008337 ...................
Mpf_ENSMPUP00000013626 ...................
Mpf_ENSMPUP00000001949 ...................
Mpf_ENSMPUP00000017721 ...................
Mpf_ENSMPUP00000001109 ...................
Mpf_ENSMPUP00000001935 ...................
Mpf_ENSMPUP00000006252 ...................
Mpf_ENSMPUP00000005676 ...................
Mpf_ENSMPUP00000005196 ...................
Mpf_ENSMPUP00000012589 ...................
Mpf_ENSMPUP00000010571 ...................
Mpf_ENSMPUP00000011589 ...................
Mpf_ENSMPUP00000005676 ...................
Mpf_ENSMPUP00000002533 ...................
Mpf_ENSMPUP00000004215 ...................
Mpf_ENSMPUP00000013399 ...................
Mpf_ENSMPUP00000010530 ...................
Mpf_ENSMPUP00000006089 ...................
Mpf_ENSMPUP00000016498 ...................
Mpf_ENSMPUP00000007327 ...................
Mpf_ENSMPUP00000001749 ...................
Mpf_ENSMPUP00000016475 ...................
Mpf_ENSMPUP00000013206 ...................
Mpf_ENSMPUP00000006140 ...................
Mpf_ENSMPUP00000005780 ...................
Mpf_ENSMPUP00000001869 ...................
Mpf_ENSMPUP00000012475 ...................
Mpf_ENSMPUP00000008316 ...................
Mpf_ENSMPUP00000001167 ...................
Mpf_ENSMPUP00000008230 ...................
Mpf_ENSMPUP00000017717 ...................
Mpf_ENSMPUP00000010272 ...................
Mpf_ENSMPUP00000003964 ...................
Mpf_ENSMPUP00000017478 ...................
Mpf_ENSMPUP00000010168 ...................
Mpf_ENSMPUP00000009546 ...................
Mpf_ENSMPUP00000002870 ...................
Mpf_ENSMPUP00000000151 ...................
Mpf_ENSMPUP00000000216 ...................
Mpf_ENSMPUP00000007012 ...................
Mpf_ENSMPUP00000012096 ...................
Mpf_ENSMPUP00000004281 ...................
Mpf_ENSMPUP00000004460 ...................
Mpf_ENSMPUP00000011499 ...................
Mpf_ENSMPUP00000003498 ...................
Mpf_ENSMPUP00000006723 ...................
Mpf_ENSMPUP00000006149 ...................
Mpf_ENSMPUP00000011052 ...................
Mpf_ENSMPUP00000015653 ...................
Mpf_ENSMPUP00000014937 ...................
Mpf_ENSMPUP00000006713 ...................
Mpf_ENSMPUP00000005370 ...................
Mpf_ENSMPUP00000017142 ...................
Mpf_ENSMPUP00000011052 ...................
Mpf_ENSMPUP00000000930 ...................
Mpf_ENSMPUP00000016865 ...................
Mpf_ENSMPUP00000000090 ...................
Mpf_ENSMPUP00000012035 ...................
Mpf_ENSMPUP00000009068 ...................
Mpf_ENSMPUP00000000172 ...................
Mpf_ENSMPUP00000013402 ...................
Mpf_ENSMPUP00000012726 ...................
Mpf_ENSMPUP00000010329 ...................
Mpf_ENSMPUP00000005886 ...................
Mpf_ENSMPUP00000011911 ...................
Mpf_ENSMPUP00000013895 ...................
Mpf_ENSMPUP00000009754 ...................
Mpf_ENSMPUP00000017452 ...................
Mpf_ENSMPUP00000004281 ...................
Mpf_ENSMPUP00000017577 ...................
Mpf_ENSMPUP00000004977 ...................
Mpf_ENSMPUP00000017884 ...................
Mpf_ENSMPUP00000007027 ...................
Mpf_ENSMPUP00000012725 ...................
Mpf_ENSMPUP00000000871 ...................
Mpf_ENSMPUP00000006220 ...................
Mpf_ENSMPUP00000008418 ...................
Mpf_ENSMPUP00000003932 ...................
Mpf_ENSMPUP00000001861 ...................
Mpf_ENSMPUP00000008418 ...................
Mpf_ENSMPUP00000006249 ...................
Mpf_ENSMPUP00000003836 ...................
Mpf_ENSMPUP00000015858 ...................
Mpf_ENSMPUP00000002835 ...................
Mpf_ENSMPUP00000004473 ...................
Mpf_ENSMPUP00000000137 ...................
Mpf_ENSMPUP00000001907 ...................
Mpf_ENSMPUP00000014024 ...................
Mpf_ENSMPUP00000001742 ...................
Mpf_ENSMPUP00000000172 ...................
Mpf_ENSMPUP00000005480 ...................
Mpf_ENSMPUP00000018515 ...................
Mpf_ENSMPUP00000009502 ...................
Mpf_ENSMPUP00000013672 ...................
Mpf_ENSMPUP00000011336 ...................
Mpf_ENSMPUP00000001410 ...................
Mpf_ENSMPUP00000003424 ...................
Mpf_ENSMPUP00000007040 ...................
Mpf_ENSMPUP00000019493 ...................
Mpf_ENSMPUP00000018830 ...................
Mpf_ENSMPUP00000003141 ...................
Mpf_ENSMPUP00000010983 ...................
Mpf_ENSMPUP00000010498 ...................
Mpf_ENSMPUP00000012786 ...................
Mpf_ENSMPUP00000014114 ...................
Mpf_ENSMPUP00000007256 ...................
Mpf_ENSMPUP00000005608 ...................
Mpf_ENSMPUP00000002033 ...................
Mpf_ENSMPUP00000016751 ...................
Mpf_ENSMPUP00000016435 ...................
Mpf_ENSMPUP00000001167 ...................
Mpf_ENSMPUP00000001585 ...................
Mpf_ENSMPUP00000002351 ...................
Mpf_ENSMPUP00000011499 ...................
Mpf_ENSMPUP00000005375 ...................
Mpf_ENSMPUP00000015986 ...................
Mpf_ENSMPUP00000004747 ...................
Mpf_ENSMPUP00000009754 ...................
Mpf_ENSMPUP00000002257 ...................
Mpf_ENSMPUP00000006734 ...................
Mpf_ENSMPUP00000003502 ...................
Mpf_ENSMPUP00000011019 ...................
Mpf_ENSMPUP00000003673 ...................
Mpf_ENSMPUP00000000383 ...................
Mpf_ENSMPUP00000008997 ...................
Mpf_ENSMPUP00000010040 ...................
Mpf_ENSMPUP00000007257 ...................
Mpf_ENSMPUP00000016774 ...................
Mpf_ENSMPUP00000001960 ...................
Mpf_ENSMPUP00000007610 ...................
Mpf_ENSMPUP00000017612 ...................
Mpf_ENSMPUP00000007907 ...................
Mpf_ENSMPUP00000014021 ...................
Mpf_ENSMPUP00000008982 ...................
Mpf_ENSMPUP00000005803 ...................
Mpf_ENSMPUP00000002728 ...................
Mpf_ENSMPUP00000007017 ...................
Mpf_ENSMPUP00000003752 ...................
Mpf_ENSMPUP00000001306 ...................
Mpf_ENSMPUP00000005338 ...................
Mpf_ENSMPUP00000001689 ...................
Mpf_ENSMPUP00000010415 ...................
Mpf_ENSMPUP00000006220 ...................
Mpf_ENSMPUP00000016350 ...................
Mpf_ENSMPUP00000018773 ...................
Mpf_ENSMPUP00000017599 ...................
Mpf_ENSMPUP00000016349 ...................
Mpf_ENSMPUP00000015036 ...................
Mpf_ENSMPUP00000007938 ...................
Mpf_ENSMPUP00000007257 ...................
Mpf_ENSMPUP00000005203 ...................
Mpf_ENSMPUP00000000650 ...................
Mpf_ENSMPUP00000007937 ...................
Mpf_ENSMPUP00000007017 ...................
Mpf_ENSMPUP00000012780 ...................
Mpf_ENSMPUP00000002522 ...................
Mpf_ENSMPUP00000004905 ...................
Mpf_ENSMPUP00000011326 ...................
Mpf_ENSMPUP00000009449 ...................
Mpf_ENSMPUP00000000014 ...................
Mpf_ENSMPUP00000012737 ...................
Mpf_ENSMPUP00000002136 ...................
Mpf_ENSMPUP00000017782 ...................
Mpf_ENSMPUP00000013550 ...................
Mpf_ENSMPUP00000017362 ...................
Mpf_ENSMPUP00000006996 ...................
Mpf_ENSMPUP00000004785 ...................
Mpf_ENSMPUP00000014164 ...................
Mpf_ENSMPUP00000016592 ...................
Mpf_ENSMPUP00000000486 ...................
Mpf_ENSMPUP00000003712 ...................
Mpf_ENSMPUP00000006850 ...................
Mpf_ENSMPUP00000015574 ...................
Mpf_ENSMPUP00000014962 ...................
Mpf_ENSMPUP00000016814 ...................
Mpf_ENSMPUP00000000139 ...................
Mpf_ENSMPUP00000012020 ...................
Mpf_ENSMPUP00000006069 ...................
Mpf_ENSMPUP00000017142 ...................
Mpf_ENSMPUP00000013991 ...................
Mpf_ENSMPUP00000010353 ...................
Mpf_ENSMPUP00000000014 ...................
Mpf_ENSMPUP00000009546 ...................
Mpf_ENSMPUP00000012020 ...................
Mpf_ENSMPUP00000016751 ...................
Mpf_ENSMPUP00000000216 ...................
Mpf_ENSMPUP00000010854 ...................
Mpf_ENSMPUP00000016813 ...................
Mpf_ENSMPUP00000002870 ...................
Mpf_ENSMPUP00000003651 ...................
Mpf_ENSMPUP00000002370 ...................
Mpf_ENSMPUP00000006780 ...................
Mpf_ENSMPUP00000002802 ...................
Mpf_ENSMPUP00000011336 ...................
Mpf_ENSMPUP00000003120 ...................
Mpf_ENSMPUP00000005803 ...................
Mpf_ENSMPUP00000004980 ...................
Mpf_ENSMPUP00000015621 ...................
Mpf_ENSMPUP00000003141 ...................
Mpf_ENSMPUP00000013099 ...................
Mpf_ENSMPUP00000010983 ...................
Mpf_ENSMPUP00000004910 ...................
Mpf_ENSMPUP00000016233 ...................
Mpf_ENSMPUP00000002953 ...................
Mpf_ENSMPUP00000011716 ...................
Mpf_ENSMPUP00000007767 ...................
Mpf_ENSMPUP00000014585 ...................
Mpf_ENSMPUP00000014164 ...................
Mpf_ENSMPUP00000005886 ...................
Mpf_ENSMPUP00000013797 ...................
Mpf_ENSMPUP00000004108 ...................
Mpf_ENSMPUP00000009167 ...................
Mpf_ENSMPUP00000016226 ...................
Mpf_ENSMPUP00000014024 ...................
Mpf_ENSMPUP00000008448 ...................
Mpf_ENSMPUP00000010607 ...................
Mpf_ENSMPUP00000015774 ...................
Mpf_ENSMPUP00000008639 ...................
Mpf_ENSMPUP00000012941 ...................
Mpf_ENSMPUP00000016218 ...................
Mpf_ENSMPUP00000007001 ...................
Mpf_ENSMPUP00000001986 ...................
Mpf_ENSMPUP00000010415 ...................
Mpf_ENSMPUP00000003836 ...................
Mpf_ENSMPUP00000007027 ...................
Mpf_ENSMPUP00000002688 ...................
Mpf_ENSMPUP00000001373 ...................
Mpf_ENSMPUP00000013700 ...................
Mpf_ENSMPUP00000016589 ...................
Mpf_ENSMPUP00000015325 ...................
Mpf_ENSMPUP00000001960 ...................
Mpf_ENSMPUP00000006310 ...................
Mpf_ENSMPUP00000016747 ...................
Mpf_ENSMPUP00000013323 ...................
Mpf_ENSMPUP00000007350 ...................
Mpf_ENSMPUP00000017588 ...................
Mpf_ENSMPUP00000007745 ...................
Mpf_ENSMPUP00000006409 ...................
Mpf_ENSMPUP00000015574 ...................
Mpf_ENSMPUP00000008365 ...................
Mpf_ENSMPUP00000001054 ...................
Mpf_ENSMPUP00000017488 ...................
Mpf_ENSMPUP00000005234 ...................
Mpf_ENSMPUP00000013182 ...................
Mpf_ENSMPUP00000011513 ...................
Mpf_ENSMPUP00000005385 ...................
Mpf_ENSMPUP00000009077 ...................
Mpf_ENSMPUP00000001767 ...................
Mpf_ENSMPUP00000007827 ...................
Mpf_ENSMPUP00000000541 ...................
Mpf_ENSMPUP00000001809 ...................
Mpf_ENSMPUP00000005803 ...................
Mpf_ENSMPUP00000013182 ...................
Mpf_ENSMPUP00000005315 ...................
Mpf_ENSMPUP00000014585 ...................
Mpf_ENSMPUP00000015166 ...................
Mpf_ENSMPUP00000002409 ...................
Mpf_ENSMPUP00000005807 ...................
Mpf_ENSMPUP00000013796 ...................
Mpf_ENSMPUP00000017782 ...................
Mpf_ENSMPUP00000019464 ...................
Mpf_ENSMPUP00000012725 ...................
Mpf_ENSMPUP00000010996 ...................
Mpf_ENSMPUP00000007938 ...................
Mpf_ENSMPUP00000009654 ...................
Mpf_ENSMPUP00000005385 ...................
Mpf_ENSMPUP00000006310 ...................
Mpf_ENSMPUP00000007963 ...................
Mpf_ENSMPUP00000002310 ...................
Mpf_ENSMPUP00000000486 ...................
Mpf_ENSMPUP00000007805 ...................
Mpf_ENSMPUP00000010246 ...................
Mpf_ENSMPUP00000004460 ...................
Mpf_ENSMPUP00000014791 ...................
Mpf_ENSMPUP00000003154 ...................
Mpf_ENSMPUP00000005214 ...................
Mpf_ENSMPUP00000003932 ...................
Mpf_ENSMPUP00000008710 ...................
Mpf_ENSMPUP00000005632 ...................
Mpf_ENSMPUP00000002828 ...................
Mpf_ENSMPUP00000017859 ...................
Mpf_ENSMPUP00000013754 ...................
Mpf_ENSMPUP00000004548 ...................
Mpf_ENSMPUP00000000646 ...................
Mpf_ENSMPUP00000004473 ...................
Mpf_ENSMPUP00000000402 ...................
Mpf_ENSMPUP00000007412 ...................
Mpf_ENSMPUP00000004935 ...................
Mpf_ENSMPUP00000011513 ...................
Mpf_ENSMPUP00000001759 ...................
Mpf_ENSMPUP00000008353 ...................
Mpf_ENSMPUP00000012083 ...................
Mpf_ENSMPUP00000006956 ...................
Mpf_ENSMPUP00000014860 ...................
Mpf_ENSMPUP00000009647 ...................
Mpf_ENSMPUP00000005803 ...................
Mpf_ENSMPUP00000005109 ...................
Mpf_ENSMPUP00000006149 ...................
Mpf_ENSMPUP00000001981 ...................
Mpf_ENSMPUP00000017916 ...................
Mpf_ENSMPUP00000003318 ...................
Mpf_ENSMPUP00000017175 ...................
Mpf_ENSMPUP00000016038 ...................
Mpf_ENSMPUP00000016192 ...................
Mpf_ENSMPUP00000015325 ...................
Mpf_ENSMPUP00000000660 ...................
Mpf_ENSMPUP00000005493 ...................
Mpf_ENSMPUP00000009754 ...................
Mpf_ENSMPUP00000013796 ...................
Mpf_ENSMPUP00000010667 ...................
Mpf_ENSMPUP00000013126 ...................
Mpf_ENSMPUP00000018046 ...................
Mpf_ENSMPUP00000006359 ...................
Mpf_ENSMPUP00000015086 ...................
Mpf_ENSMPUP00000008387 ...................
Mpf_ENSMPUP00000015207 ...................
Mpf_ENSMPUP00000004217 ...................
Mpf_ENSMPUP00000015689 ...................
Mpf_ENSMPUP00000015159 ...................
Mpf_ENSMPUP00000018833 ...................
Mpf_ENSMPUP00000007866 ...................
Mpf_ENSMPUP00000007938 ...................
Mpf_ENSMPUP00000010694 ...................
Mpf_ENSMPUP00000013131 ...................
Mpf_ENSMPUP00000000312 ...................
Mpf_ENSMPUP00000019132 ...................
Mpf_ENSMPUP00000015959 ...................
Mpf_ENSMPUP00000012612 ...................
Mpf_ENSMPUP00000007938 ...................
Mpf_ENSMPUP00000007989 ...................
Mpf_ENSMPUP00000016156 ...................
Mpf_ENSMPUP00000013721 ...................
Mpf_ENSMPUP00000005447 ...................
Mpf_ENSMPUP00000015768 ...................
Mpf_ENSMPUP00000004215 ...................
Mpf_ENSMPUP00000010108 ...................
Mpf_ENSMPUP00000002188 ...................
Mpf_ENSMPUP00000013446 ...................
Mpf_ENSMPUP00000012407 ...................
Mpf_ENSMPUP00000017043 ...................
Mpf_ENSMPUP00000007898 ...................
Mpf_ENSMPUP00000017064 ...................
Mpf_ENSMPUP00000009754 ...................
Mpf_ENSMPUP00000016461 ...................
Mpf_ENSMPUP00000008230 ...................
Mpf_ENSMPUP00000001993 ...................
Mpf_ENSMPUP00000014500 ...................
Mpf_ENSMPUP00000002405 ...................
Mpf_ENSMPUP00000002933 ...................
Mpf_ENSMPUP00000007268 ...................
Mpf_ENSMPUP00000010983 ...................
Mpf_ENSMPUP00000010498 ...................
Mpf_ENSMPUP00000018101 ...................
Mpf_ENSMPUP00000002033 ...................
Mpf_ENSMPUP00000010694 ...................
Mpf_ENSMPUP00000008353 ...................
Mpf_ENSMPUP00000009754 ...................
Mpf_ENSMPUP00000015718 ...................
Mpf_ENSMPUP00000002358 ...................
Mpf_ENSMPUP00000005077 ...................
Mpf_ENSMPUP00000009107 ...................
Mpf_ENSMPUP00000016101 lhlakiglreenqpgwlcp
Mpf_ENSMPUP00000011911 ...................
Mpf_ENSMPUP00000007938 ...................
Mpf_ENSMPUP00000009676 ...................
Mpf_ENSMPUP00000005809 ...................
Mpf_ENSMPUP00000016410 ...................
Mpf_ENSMPUP00000006638 ...................
Mpf_ENSMPUP00000005803 ...................
Mpf_ENSMPUP00000010983 ...................
Mpf_ENSMPUP00000000717 ...................
Mpf_ENSMPUP00000002793 ...................
Mpf_ENSMPUP00000007833 ...................
Mpf_ENSMPUP00000002271 ...................
Mpf_ENSMPUP00000010974 ...................
Mpf_ENSMPUP00000010755 ...................
Mpf_ENSMPUP00000013112 ...................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0036336 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Synechococcus elongatus PCC 7942
NoYes   Rivularia sp. PCC 7116
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Enterococcus sp. 7L76
NoYes   Weissella koreensis KACC 15510
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria innocua Clip11262
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Geobacillus sp. JF8
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Pelobacter propionicus DSM 2379
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Mesorhizobium sp. BNC1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Photobacterium profundum SS9
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Pyrococcus yayanosii CH1
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechococcus elongatus PCC 6301
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. CBDB1
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus parasanguinis FW213
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus thermophilus MN-ZLW-002
NoYes   Streptococcus thermophilus JIM 8232
NoYes   Streptococcus thermophilus ND03
NoYes   Streptococcus thermophilus CNRZ1066
NoYes   Streptococcus thermophilus LMG 18311
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis TL13
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis D12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Streptococcus salivarius CCHSS3
NoYes   Streptococcus salivarius JIM8777
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Variovorax paradoxus B4
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Acinetobacter junii SH205
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Pyrococcus sp. NA2
NoYes   Natronobacterium gregoryi SP2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]