SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

PH domain-like alignments

These alignments are sequences aligned to the 0049397 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1shca_                gs...........................................................................
Mpf_ENSMPUP00000000236 atgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtry
Mpf_ENSMPUP00000001054 efgavfdqliaeqtgekkevadlsmgdlllhttviwpnppaslgkwkkepelaafvfktavvlvykdgskqkkklvg
Mpf_ENSMPUP00000001986 dygtvfdqlvaeqsgtekevtelsmgellmhsavswlnpflslgkarkdleltvfvfkravilvykencklkkklps
Mpf_ENSMPUP00000006133 ql...........................................................................
Mpf_ENSMPUP00000009494 e............................................................................
Mpf_ENSMPUP00000004093 nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhkekgtirllmrrdktlk.
Mpf_ENSMPUP00000012215 pda..........................................................................
Mpf_ENSMPUP00000016175 egeyesvlcvkpevhvyrippratnrgyraaewqldqpswsgrlritakgqva........................
Mpf_ENSMPUP00000009909 fad..........................................................................
Mpf_ENSMPUP00000010977 e............................................................................
Mpf_ENSMPUP00000016638 eleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikledkvsgelfa..........
Mpf_ENSMPUP00000018612 nhdpqfepiaslpeqeiktleddeeelfkmraklfrfasennlpewkeqgtgdvkllkhtekgtirllmrrdktlki
Mpf_ENSMPUP00000018966 nhdpqfepiaslpeqeiktleddeeelfkmraklfrfasennlpewkeqgtgdvkllkhtekgtirllmrrdktlki
Mpf_ENSMPUP00000004660 peeirnlladvetfvadtlrgenlskkakekreslikkikdvksiylqdfqdkgdtedgeeyddpfagppdtvslas
Mpf_ENSMPUP00000002149 vilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidvekitcvetvvpeknppperqip
Mpf_ENSMPUP00000018066 nsa..........................................................................
Mpf_ENSMPUP00000017958 islaalqrhdpyinrivdvasqvalytfghranewektdvegtlfvytrsaspkhgfiimnrl..............
Mpf_ENSMPUP00000011450 disqyrvehlttf................................................................
Mpf_ENSMPUP00000016402 nstt.........................................................................
Mpf_ENSMPUP00000004951 mgeqpifstrahvfqidpntkknwvptskhavtvsyf........................................
Mpf_ENSMPUP00000011363 dw...........................................................................
Mpf_ENSMPUP00000015445 eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtr.....................................
Mpf_ENSMPUP00000015195 peeirwlmedaeeflgeglrnenlsatardhrdhilrgfqqvktryywdsqpqggdqaesylgqdssddnqsgthgp
Mpf_ENSMPUP00000011751 nidkiaqwqssiedwegedilvrsseliysgeltrvtqpqaksqqrmfflfdhqliyckkdllrrdvlyykgrvdmd
Mpf_ENSMPUP00000009831 nidkiaqwqasvldwegedildrsseliytgemawiyqpygrnqqrvfflfdhqmvlckkdlirrdilyykgridmd
Mpf_ENSMPUP00000004111 e............................................................................
Mpf_ENSMPUP00000005349 tileeilikrsqqkkktsplnykerlfvltksmltyyegrpekkyrkgfidvakikcveivkndeg...........
Mpf_ENSMPUP00000006137 taad.........................................................................
Mpf_ENSMPUP00000009095 llkegfmikraqgrkrfgmknfkkrwfrltnheftyqrskgdqplcsipienilaverleeesfkmkn.........
Mpf_ENSMPUP00000005832 msetvicsswatvmlyddsnkrwlpagtgpqafsrvqiyhnptansf..............................
Mpf_ENSMPUP00000014567 dsrasclkksa..................................................................
Mpf_ENSMPUP00000015198 lrahpffesitwenlqhqtppkltaylpamseddedcygnydnllsqfgcmqvsssssshslstadaglphtagsni
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 emyginyfeik..................................................................
Mpf_ENSMPUP00000010667 fepvvplpdlvevssgeeneqvvfshraklyrydkdvgqwkergigdikilqnydnkqvrivmrrd...........
Mpf_ENSMPUP00000000642 idkiarwqvsivgwegldildrsselihsgeltkvtrhgksqqrtfflfdhqlvsckkdllrrdvlyyrgrtdmddv
Mpf_ENSMPUP00000015373 reqpifstrahvfqidpatkrnwipagkhaltvsyfydatrn...................................
Mpf_ENSMPUP00000003213 eqrea........................................................................
Mpf_ENSMPUP00000012196 fns..........................................................................
Mpf_ENSMPUP00000012194 eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvisr.................
Mpf_ENSMPUP00000003212 eqrea........................................................................
Mpf_ENSMPUP00000001158 emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisf.........................
Mpf_ENSMPUP00000010667 nedihfepivslpevevksgeedeeilfkeraklyrwdrevsqwkergigdikilwhtmknyyrilmrrdqvfkvc.
Mpf_ENSMPUP00000013386 lleeqlikksqqkrrtspsnfkvrffvltktslayfenrqgkkrtlkgsielsrikcve..................
Mpf_ENSMPUP00000016712 mslaalkqhdpyitsiadltgqvalytfcpkanqwektdiegtlfvyrrsaspyhgftivnr...............
Mpf_ENSMPUP00000003302 emygvnyfeik..................................................................
Mpf_ENSMPUP00000003768 lr...........................................................................
Mpf_ENSMPUP00000008012 dvsqylvnhlv..................................................................
Mpf_ENSMPUP00000002625 sileelllkrsqqkkkmspsnykerlfvltktnlsyyeydkmkrgsrkgsieikkircvekvnle............
Mpf_ENSMPUP00000010667 hfepvvqmpekvelvtgeedekvlysqrvklfrfdaeisqwkerglgnlkilkn.......................
Mpf_ENSMPUP00000006140 lqv..........................................................................
Mpf_ENSMPUP00000015670 k............................................................................
Mpf_ENSMPUP00000008341 pkvkaylsqgerfikwddetti.......................................................
Mpf_ENSMPUP00000017573 pea..........................................................................
Mpf_ENSMPUP00000012859 tvvetlrrgskfikwdeeas.........................................................
Mpf_ENSMPUP00000012131 hlkegemykraqgrtrigkknfkkrwfcltsreltyhkqpgskdaiytipvknilavekleessf............
Mpf_ENSMPUP00000000172 emygirfhtasdr................................................................
Mpf_ENSMPUP00000013200 emygvnyfair..................................................................
Mpf_ENSMPUP00000003522 lerasnplaaefksldltarrmvhegplswriskdksldlhvllledllvllqrqdeklllkchsktaagssds...
Mpf_ENSMPUP00000011499 emygirlhpakdr................................................................
Mpf_ENSMPUP00000011494 vprlpgetritdkeviyicpfngpikgrvy...............................................
Mpf_ENSMPUP00000012716 dafkiwvifnflsedkypliivpeeieyllkklteamgggwqqeqfehykinfddskdglsvwelieligngqfskg
Mpf_ENSMPUP00000002913 geqsicqarasvmvyddtskkwvpikpgqqgfsriniyhntasntfrvvgvklqdqqv...................
Mpf_ENSMPUP00000003504 hfrddddgpvssqgympylnkyildkveegafvkehfdelcwtltakknyrvdsngnsmlsnedafrlwclfnflse
Mpf_ENSMPUP00000004361 seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrk..........................
Mpf_ENSMPUP00000017389 dkdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygydsnlfsfesgrrcqtgqg
Mpf_ENSMPUP00000015829 rlrlsrtlaakvelvdiqregalrfmvaddaaagsggtaqwqkcrlllrravagerfrleffvppkasrpkvsipls
Mpf_ENSMPUP00000003644 clqhrvehlmtcklg..............................................................
Mpf_ENSMPUP00000006376 evpsflqegavfdryeeesfvfepnclfkvdefgffltwrsegkegqvlecslinsirlgatpkdpkil........
Mpf_ENSMPUP00000014536 mygvdlhhakdsegvdiklgvcanglliykdrlrinrfawpkilkisykrsnfyikvrpaeleqfestigfklpnhr
Mpf_ENSMPUP00000011501 etplfpgesikatvkdvmyicpfmgavsgtltvtdfkmyfknverdpnfvldvplgvisr.................
Mpf_ENSMPUP00000017670 mygvdlhhakdsegidimlgvcanglliyrdrlrinrfawpkilkisykrsnfyikirpgeyeqfestigfklpnhr
Mpf_ENSMPUP00000006727 lftflgkkcvtmssavvqlyaadrncmwskkcsgvaclvkdnpqrsy..............................
Mpf_ENSMPUP00000000961 elygvefhyardqsnneimigvmsggiliyknrvrmnifpwlkivkisfkckqffiqlrkevhesretllgfnmvny
Mpf_ENSMPUP00000004942 mygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgefeqfestigfklpnhr
Mpf_ENSMPUP00000002151 dmygirphpasdgegtqihlavahmgvlvlrgntkintfnwakirkls.............................
Mpf_ENSMPUP00000014680 ektdeyllarfk.................................................................
Mpf_ENSMPUP00000005563 klseypnveelrnldltkrkmihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskil..........
Mpf_ENSMPUP00000011333 ineasnynmtsdyaahpmspigrtsraskkvhnfgkrsnsikrnpnapvvrrgwlykqdstgm..............
Mpf_ENSMPUP00000000969 emygvdmhvvkardgndyslgltptgvlvfegetkiglffwpkitrldfkknkltlvvvedddqgkeqehtfv....
Mpf_ENSMPUP00000010395 aikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekf
Mpf_ENSMPUP00000015361 mygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeqeqyest.........
Mpf_ENSMPUP00000001991 etygvdphpckdstgtttflgftaagfvvfqgnkrihlikwpdvcklkfegktfyvigiqkekkamlafhtstpaac
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 emygvdmhvvrgrdgceyslgltptgilifegankiglffwpkitkmdfkkskltl.....................
Mpf_ENSMPUP00000008193 yarvravvmtrddssggwlplggsglscvtvfkvphqeengcadffirgerlrdkmv....................
Mpf_ENSMPUP00000007177 shlrqssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllkshsrtltptp...
Mpf_ENSMPUP00000010360 tgydgnlselgkllmqgsfsvwtdhkkghskvkdlarfkpmqrhlflhekavlfckrreesgegyekapsysykqsl
Mpf_ENSMPUP00000010611 rtqetpsaqmegflnrkheweahnkkassrswhnvycvinnqemgfykdaktaasgipyhsevpvslk.........
Mpf_ENSMPUP00000007161 evllevkfirevtpyikkpslvsdlpwegaspqspsfsgsedsgspkhqnntkdrkviplk................
Mpf_ENSMPUP00000006134 yivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgflihgerqkdklvvl.................
Mpf_ENSMPUP00000004983 aikkmneiqknidgwegkdigqccnefimegpltrigakherhiflfdglmisckpnhsqsrlpgyssaeyrlkekf
Mpf_ENSMPUP00000001920 dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladfnqvqtiqysnsedkdr..................
Mpf_ENSMPUP00000013542 lfemlgrkcwtlatavvqlylalppgaehwtkehcgavcfvkdnpqksyfir.........................
Mpf_ENSMPUP00000008337 dlkssskfkngltfrkedmlqrqlqlegplcwkttsgrlkdvlavlltdvllllqekdqkyvfasvdskh.......
Mpf_ENSMPUP00000013626 matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispeg..................
Mpf_ENSMPUP00000001949 rkktqgfftmsrrrisckdlghadcqgwlykkkekgtflsnkwkkfwvvlkgtslywysnqma..............
Mpf_ENSMPUP00000017721 evvlevkymkevspyfknsasgtsvgwdsppasplqrqpsspgppprdlsdak........................
Mpf_ENSMPUP00000001109 evllevkymreatpyvkkgspvseigwetpppesprlgagasdalsaaqpcsfhrdrknipl...............
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 kcllekvevitgeeaesnvlqiqcklfvfdktsqswvergrgllrlndmasaddgtlqsrlvmrtqgslrlilntkl
Mpf_ENSMPUP00000005676 egtl.........................................................................
Mpf_ENSMPUP00000005196 lregwvvhysnkdtlrkrhywrldckcitlfqnnttnryykeiplseiltv..........................
Mpf_ENSMPUP00000012589 emygvdlhpvygenkseyflgltpvgvvvyknkkqvgkyfwpritkvhfketqfelrvlgkdcnetsfffearskta
Mpf_ENSMPUP00000010571 etygvdphpckdvsgnaaflaftpfgfvvlqgnkrvhfikwnevtklkfegktfylyvsq.................
Mpf_ENSMPUP00000011589 hnmvsevpperpsvratrtsrkaiafgkrshsmkrnlsapvtkagwlfkqassgvkqwnk.................
Mpf_ENSMPUP00000005676 fqvefpap.....................................................................
Mpf_ENSMPUP00000002533 ivregyllkrkeepaslttrfafkkryfwlsgealsyskspewqmrssipvshiravervdegafqlph........
Mpf_ENSMPUP00000004215 aprkefvvtmrpteasercrlrgsytlragetalelwgghelgsklyewpyrflrrfgrdkvtfsfeagrrcisgeg
Mpf_ENSMPUP00000013399 hqvtnvddegvelgsgvmeltqselvlhlqrreavrwpylclrrygydsnlfsfesgrrcqtgqgif..........
Mpf_ENSMPUP00000010530 rkelelqilteairswegddittlgsvvymsqvmvqcagseeknerylllfpnillm....................
Mpf_ENSMPUP00000006089 dvnlkeqgqlvrqdeflvrtgrrkslrrvflfeelllfskprrgptgtdtfaykrsfk...................
Mpf_ENSMPUP00000016498 vqreqnerfnvylmptpnldiyg......................................................
Mpf_ENSMPUP00000007327 dfygvelhsgrdlhnlelmigiasagiavyrkyictsfypwvnilkisfkrkkffihqrqkqtesrehivafnmln.
Mpf_ENSMPUP00000001749 gnlnelgkmimqgafsvwtghkkgatkmkdfarfkpmqrhlflyekaivfckrrvesgegsd...............
Mpf_ENSMPUP00000016475 npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpncfelynpshkgqvik
Mpf_ENSMPUP00000013206 rnqrpssmvsetstagttstveakpgpkimkssnkvhsfgkrdqairrnpnvpvvvrgwlhkqdssgmrlwkrrwfv
Mpf_ENSMPUP00000006140 yaslklrhaphaeeddscsinsd......................................................
Mpf_ENSMPUP00000005780 ienktytklknghvfrkqaliskertllhdglvywktatgrfkdilallltdvllflqekdqkyif...........
Mpf_ENSMPUP00000001869 rkqlelqilsepiqawegesiktlgnvlfmsqvmvqygtceekeerylllfssvlimlsasprmsgfi.........
Mpf_ENSMPUP00000012475 pdregwllklaggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedskkpncfelyipdnkdqvik
Mpf_ENSMPUP00000008316 dgygeesypakdsqgsdicigaclegifvkhkngrppvvfrwhdianmshnksffalelankeetiqfqtedmetak
Mpf_ENSMPUP00000001167 fkevwqvilkpkglgqtknligiyr....................................................
Mpf_ENSMPUP00000008230 sqfwvtvqrteaaercglqgsyv......................................................
Mpf_ENSMPUP00000017717 mvqvravvmarddssggwlpvgggglsqvsvcrvrgarpeggarqghyvihgerlrd....................
Mpf_ENSMPUP00000010272 dvslkeqgplrcqdefivccgrrkhlrhvflfedlilfsktrkveg...............................
Mpf_ENSMPUP00000003964 pdregwllkleggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprkpncfelyipnnkgqlik
Mpf_ENSMPUP00000017478 lealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvtgskkstkrtksings
Mpf_ENSMPUP00000010168 vkegwmvhyssrdtlrkrhywrldskcltlfqnesgskyykeiplseilrisspqdftn..................
Mpf_ENSMPUP00000009546 lekkpqvaykteiiggvvvhtpinqnggdgqegsepgshailrrsqsyipttgsrvpsgppliksgycvkqgnvrks
Mpf_ENSMPUP00000002870 vsyrtdivggvpiitptqkeevnecgesidrnnlkrsqshlpyfapkpppdsavikagycv................
Mpf_ENSMPUP00000000151 tdlkeqgqllhrdpftvicgrkkclrhvflfehlllfsklkgpeggsetfvykqafktadmg...............
Mpf_ENSMPUP00000000216 airkmenlkklleiyemlgeeedivnpsnelikegqilklaarntsaqerylflfnnmll.................
Mpf_ENSMPUP00000007012 lrqitnfqlsienldqslahygrpkidgelkitsverrskmdryaflldkallickrrgdsydlkdfvnlhsfqvrd
Mpf_ENSMPUP00000012096 lkkisefqssienlqvkleeygrpkidgelkvrsivnhtkqdrylflfdkvvivckrrgysyelkeviellfhkmtd
Mpf_ENSMPUP00000004281 denldvqgelilqdafqvwdpkslirkgrerhlflfeislvfskeikdssghtkyvyknkllts.............
Mpf_ENSMPUP00000004460 vqceqtdrfnvfllpcpnldvyg......................................................
Mpf_ENSMPUP00000011499 nkspdeatvadqeseddlsasrtslerqapprgnttvhvcwhrntsvsmvdfsvavenqlsgnllrkfknsngwqkl
Mpf_ENSMPUP00000003498 lslassastisslgslstkkppravskvhafgkrgnalrrdpnlpvhirgwlhkqdssg..................
Mpf_ENSMPUP00000006723 qrdhgysvqmegylgrkhdlegpnkkasnrswnnlycvlrnseltfykdaknlalgvpyhgeep.............
Mpf_ENSMPUP00000006149 ereqserfnvylmpspnldvhg.......................................................
Mpf_ENSMPUP00000011052 dgkivaqgklllqdtflvtdqdsgllprckerrvflfeqivifsepldkkkgfsmpgflfknsikvsclcleenv..
Mpf_ENSMPUP00000015653 typagvaetqeapeqpdtspvsgrkkskgvatrlsrrrvscrelgqpdcdgwlllrkvpggfmgprwrrcwfvlk..
Mpf_ENSMPUP00000014937 pkcllekidvvtgeeaehnvlkincklfifnkttqswtergrgalrlndtassdcgtfqsrl...............
Mpf_ENSMPUP00000006713 havrlqeiqsllinwkgpdltiygelvlegtfrvhrvrnertfflfdkallitkkrgdhfv................
Mpf_ENSMPUP00000005370 vlkegwmvhytskdtlrkrhywrldskcitlfqndtgsryykeiplseilslepakpsdlipnganphcfeittanv
Mpf_ENSMPUP00000017142 lrrhhchacgkivcrncsrnkyplkylkdrmakvcdgcygelkkrggdvpgllrerpvsmsfplssprfsssafssv
Mpf_ENSMPUP00000011052 egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskylyksklf............
Mpf_ENSMPUP00000000930 ptygvhyyavkdkqgipwwlglsykgifqydyhdkvkprkifqwrqlenlyfrekkfsv..................
Mpf_ENSMPUP00000016865 ptygvhyyavkdkqglpwwlgisykgigqydlqdkvkprklfqwkqlenlyfrekkfav..................
Mpf_ENSMPUP00000000090 lreikqfqlsienlnqpvllfgrpqgdgeirittldkhtkqerhiflfdlavivckrkgdnyemkeiidlqqykian
Mpf_ENSMPUP00000012035 kegwlhfrplitdkgkrvg..........................................................
Mpf_ENSMPUP00000009068 lgpvlkegwlkrqrsimknwqqrwfvlrgdqlfyykdkdetkpqgfislqgtrvtellpgpedagkhlfeispggag
Mpf_ENSMPUP00000000172 lpgsvvcmppsrcmeevspeqesedarssrgslegqgqpranttvrvcwyrntsvsradhsaavenqlsgyllrkfk
Mpf_ENSMPUP00000013402 dgfgqeifsvkdnhgnsvhlgiffmgifvrnrigrqaviyrwndignithnkstilvelinkeetalfhtddienak
Mpf_ENSMPUP00000012726 gvgrgggaagptsggggqpqwqkcrlllrsegeggggsrleffvppkasrprlsipc....................
Mpf_ENSMPUP00000010329 havrlqeiqslltnwkgpdltsygelvlegtfriqraknertlflfdklllitkkrddtftykahilcgnlmlvevi
Mpf_ENSMPUP00000005886 cps..........................................................................
Mpf_ENSMPUP00000011911 ensiysswqeagefpvvvqrteaatrcqlkgpy............................................
Mpf_ENSMPUP00000013895 hvqcdglaeqlifnsltnclgprkllhsgklyktksnkelhgflfndfllltymvkqfavssgseklfssksnaqfk
Mpf_ENSMPUP00000009754 ppspppsppeippkplrlppefddsdydevpeegpgapaglmtkkeelpvshipravrvasllsegeelsedddqgd
Mpf_ENSMPUP00000017452 dsksimrmksgqmfakedl..........................................................
Mpf_ENSMPUP00000004281 gtltaqgkllqqdtfyvieldtgmqsrtkerrvflfeqivifsellrkgsltpgymfkrsikmnylvleenvd....
Mpf_ENSMPUP00000017577 papppppthtvqhegfllrkreldanrkssnrswvslycvlskgelgfykdakgpasrgthggepllslhr......
Mpf_ENSMPUP00000004977 raqapvpgkgpfgreellrrrlihdgcllwktatgrfkdvlmllmtdvllflqekdqky..................
Mpf_ENSMPUP00000017884 kfdag........................................................................
Mpf_ENSMPUP00000007027 tvpvytalkgratqistvpfvdessgsdddccsqasfrtsvpcsesrktsglgspraikrgvsmsslssegdyaipp
Mpf_ENSMPUP00000012725 eklehklnqtpekwqqlwekvtvdlkeepradrlqrhpsgspgivstnltscqkrsllhlpdssmgqehsasispsn
Mpf_ENSMPUP00000000871 dqetyrceliqgw................................................................
Mpf_ENSMPUP00000006220 gviikqgcllkqghrrknwkvrkfilredpaylhyydpaggedplgaihlrgcvvt.....................
Mpf_ENSMPUP00000008418 prqvellda....................................................................
Mpf_ENSMPUP00000003932 ykdvwqvivkprglghrkelsgvfr....................................................
Mpf_ENSMPUP00000001861 pvvlstpaqliapvvvakgtlsittteiyfevdeddpafkkidtkvlay............................
Mpf_ENSMPUP00000008418 smep.........................................................................
Mpf_ENSMPUP00000006249 pnplerpikmgwlkkqrsivknwqqryfvlraqqlffykdeedtkpqgc............................
Mpf_ENSMPUP00000003836 ntprptcrgylhkrthsgfvkgwrkrwfvlkhdgclhyyrhkkdegkcspleviklegaevgmdssl..........
Mpf_ENSMPUP00000015858 ppvkegplfihrtkgkghlmssfkklhfslttealsfaktpsskksaliklaniraaekveeksf............
Mpf_ENSMPUP00000002835 qddedlqallkgsqllkvksnswrrerfyklqedcktiwqesrkvmrtpesqlfsiediqe................
Mpf_ENSMPUP00000004473 airkmekmhkllevyerlggeedivnpanelikegpiqklsakngtaqdrhlfl.......................
Mpf_ENSMPUP00000000137 fqqsslqhkskkknkgpiagkskrrisckdlgrgdcegwlwkkkdaksyfsqkwk......................
Mpf_ENSMPUP00000001907 egkltaqgkllgqdtfwvtepeaggllssrgrerrvflfeqivifsealgggvrggsqagyvykssikvsclglegn
Mpf_ENSMPUP00000014024 ntllregpvlkisfrrsdpmerylflfnnmllycipkviqvgaqfqvrtridvagmkvreltdaefphsflvsgkqr
Mpf_ENSMPUP00000001742 ktsikegqllkqtssfqrwkkryfklrgrtlyyakdskslifdevdlsdasvaeastknannsfti...........
Mpf_ENSMPUP00000000172 enlqkltelqrdlvgienlitpgrefiregclhkltkkglqqrmfflfsdmllytskgvtgsshfrirgrlplhgml
Mpf_ENSMPUP00000005480 vvtspaetvikegmltkqnnsfqrskrryfklrgrtlyyaktaksiifdevdltdasvaesstknvnnsft......
Mpf_ENSMPUP00000018515 ntrrinivencfgaagqpltipgrvligegvltklcrkkpkarqfflfndilvygniviqkkkynkqhi........
Mpf_ENSMPUP00000009502 pslgtkegyltkqgglvktwktrwftlhrnelkyfkdqmspep..................................
Mpf_ENSMPUP00000013672 malnknhsegggvivnntesilmsydhveltfndmknvpeafkgtkkgtvyltpy......................
Mpf_ENSMPUP00000011336 irkmermhkllkvyellggeedivsptkelikeghilklsakngttqdrylilfndrllycvpr.............
Mpf_ENSMPUP00000001410 sdcinsmvegselkkvrsnsriyhryflldadmqslrwepskkdsekakidiksikevrt.................
Mpf_ENSMPUP00000003424 gpelsaqeqmegmlcrkqemeafgkkaanrswqnvycvlrrgslgfykdakaasagvp...................
Mpf_ENSMPUP00000007040 vslstpaqlvapsvvvkgtlsvtsselyfevdeedshfkkidpkilayte...........................
Mpf_ENSMPUP00000019493 gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypld......................
Mpf_ENSMPUP00000018830 qriaavescfgasgqplalpgrvllgegvltkecrkkakprifflfndilvygsvvlpkrkyrsqhvi.........
Mpf_ENSMPUP00000003141 d............................................................................
Mpf_ENSMPUP00000010983 qealkqgwlhkkgggsstlsrrnwkkrwfvlrqsrlmyfendsedklk.............................
Mpf_ENSMPUP00000010498 triryalgevhrfhvavapgtklesgpatlhlcndvlvlardvppavmgqwklsdlrry..................
Mpf_ENSMPUP00000012786 vyksgflarkihadmdgkktprgkrgwktfyavlkgtvlylqkdeykpekalseedlknav................
Mpf_ENSMPUP00000014114 vdapsgvvmegylfkras...........................................................
Mpf_ENSMPUP00000007256 klkgvvaga....................................................................
Mpf_ENSMPUP00000005608 affpspspgplprvlgassgaaqgagagllidcrasmsdnqswnssgseedpetesgppvercgvlskwtnyihgwq
Mpf_ENSMPUP00000002033 hhrrslgvylqegpvgstlslsldsdqssgstasssrqaarrststlysqfqtaesenrsyegtlykkgafmkpwka
Mpf_ENSMPUP00000016751 npfgesgggtksete..............................................................
Mpf_ENSMPUP00000016435 sedlllmqkgtlmrkvrskswkklryfrlqddgmtvwharqags.................................
Mpf_ENSMPUP00000001167 dvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiples....................
Mpf_ENSMPUP00000001585 erlkitalplyfegfllvkrseyqeykhywtelrgttlffysdkksptyvdkldli.....................
Mpf_ENSMPUP00000002351 ddikklgkllmhgsfnvwtvhkdrykmkdfirfkpsqrqiylfergivfckirmepsdqglaphy............
Mpf_ENSMPUP00000011499 nfqklhelkkdligidnlvipgrefirlgslsklsgkglqqrmfflfndvllytsrgltasnqfkvhgqlplygmti
Mpf_ENSMPUP00000005375 enygiewhsvrdsegqklligvgpegisickddfcpinr......................................
Mpf_ENSMPUP00000015986 hrprcitkf....................................................................
Mpf_ENSMPUP00000004747 prpsspsglpeedsvlfn...........................................................
Mpf_ENSMPUP00000009754 etqallgcgagvncfsgdpeaptplalaeqagqilqmeflrnnrttevprldsvkplekhysvvlptvshsgflykt
Mpf_ENSMPUP00000002257 eygvhfhrvhpekksqtgillgvcskgvlvfe.............................................
Mpf_ENSMPUP00000006734 ggndevdkllkeflhldltapipgaspeetrqlllegslrmkegkdgkmdvycflftdlll................
Mpf_ENSMPUP00000003502 lqyefka......................................................................
Mpf_ENSMPUP00000011019 epvllpgeivvnevnfvrkciatdtsqydlwgklicsnfkisfitddpmplqkfhyrnlllgehdvplt........
Mpf_ENSMPUP00000003673 algkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsveetqiker.............
Mpf_ENSMPUP00000000383 eklvlsedcelitiidvipgrleittqhvyfydcsidke......................................
Mpf_ENSMPUP00000008997 khgvltrkthadmdgkrtprgrrgwkkfyavlkgtilylqkdeyrpdkalsegdlknairvhh..............
Mpf_ENSMPUP00000010040 egpsgllmeghlfkrasnafktwsrrwftiqsnqlvyqkkykdpvtvvv............................
Mpf_ENSMPUP00000007257 rrhhcracgkivcqacssnkygldylknqparvcehcfqelqkldhqhspkigspgnhkspssalssvlhsipsgrk
Mpf_ENSMPUP00000016774 tpepgaavykhgalvrkvhadpdcrktprgkrgwksfhgilkgmilylqkeeyqpgkalseaelknai.........
Mpf_ENSMPUP00000001960 qkslpdlpppkiiperkqlsipkiespegyyeeaepydaslnedgeavsssyesydeeenskgksaphqwpspeasi
Mpf_ENSMPUP00000007610 vercmsamqagtqmvklrggskglvrfyfldehrscvrwrpsrkhekakisidsiqev...................
Mpf_ENSMPUP00000017612 haarlqevqrrlggwtgpelsafgelvlegafrggggggprlrggerllflfsrmllvakr................
Mpf_ENSMPUP00000007907 sdcisfmqagcelkkvrpnsriynrfftldtdlqalrwepskkdlekakldisa.......................
Mpf_ENSMPUP00000014021 pgqgdsegsspftpa..............................................................
Mpf_ENSMPUP00000008982 peygvlvhrvlpekarveg..........................................................
Mpf_ENSMPUP00000005803 plsstsgnaessivssnaispyacfygssarkvksgwldklspqgkrmfqkrwvkfdglsisyynnekekyskgi..
Mpf_ENSMPUP00000002728 vercmsvmqsgtqmiklkrgskglvrlfyldehrtrlrwrpsrksekakilidsiy.....................
Mpf_ENSMPUP00000007017 slstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrp........................
Mpf_ENSMPUP00000003752 lfntvgldekqsattllvgprhgishvidlktnlttvlsefskis................................
Mpf_ENSMPUP00000001306 vqceglseqlvfnsvtnclgprkflhsgklykaksnkelygflfndfllltqiikplgssgsdkvf...........
Mpf_ENSMPUP00000005338 gvsfflvkekm..................................................................
Mpf_ENSMPUP00000001689 sslcsqkggvikqgwlhkanvnstitvtmkvfkrryfyltqlpdgsyilnsykdeknskesk...............
Mpf_ENSMPUP00000010415 msssyesydeeeedgkgkktrhqwpseeasmdlvk..........................................
Mpf_ENSMPUP00000006220 kriregylvkrg.................................................................
Mpf_ENSMPUP00000016350 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000018773 skrkklhits...................................................................
Mpf_ENSMPUP00000017599 nevsvikegwlhkrgeyiktwrpryfllksdgsfigykerpdapdqtlpplnnfsvaecqlmkterpr.........
Mpf_ENSMPUP00000016349 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000015036 rregwlyykqvltkkgkkaggglrqwkrvyaalrarslslskerrepgpaaagaaaavagedeaapvcigsclvdis
Mpf_ENSMPUP00000007938 lpgdsnlslptldvetnddlispyasfsstadrpspllsgwldklspqgnyvfqrrfvqfngrslmyfgsdkd....
Mpf_ENSMPUP00000007257 nfqklmqiqyslnghheivqpgrvflkegtlmklsrkvmqprvfflfndallyttpmqsgmyklnnm..........
Mpf_ENSMPUP00000005203 dvavhyyrlykdkreieasltlgltmrgiqifqnldeekqllydfpwtnvgklvfvgkkfeilpdglpsarkliyyt
Mpf_ENSMPUP00000000650 gvsfflvkekm..................................................................
Mpf_ENSMPUP00000007937 dafyknivkkgyllkkgkgkrwknlyfilegsdaqliyfesekratkpkglidlsvc....................
Mpf_ENSMPUP00000007017 gvlkegflvkrghivhnwkarwfilrqntllyykleggrkvtppkgrilldgctitcpcleyenrpllik.......
Mpf_ENSMPUP00000012780 fkgwllkwtnyl.................................................................
Mpf_ENSMPUP00000002522 grvfkatlvqaekrsevtllvgprygishvintktnlvalla...................................
Mpf_ENSMPUP00000004905 pshyyesflqkkgphdqdykkfwaglqgctlyfynsnrdsqhveklvlgafv.........................
Mpf_ENSMPUP00000011326 aslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhllqlgdgsynlnfykdekiskepkgsifldscmgviqnn
Mpf_ENSMPUP00000009449 ykqgilarkmhhdadgkktpwgkrgwkmfhtllrgmvlyflkgedhcppageslvgqmvdepvgvhhslatpathy.
Mpf_ENSMPUP00000000014 kkgwltkqyedgqwkkhwfvladqslryyrdsaaeeaadldgeidlstcydv.........................
Mpf_ENSMPUP00000012737 kkgwmsildepgewkkhwfvltdsslkyyrdstaeeadeldg...................................
Mpf_ENSMPUP00000002136 msdvaivkegwlhkrgeyiktwrpryfllksdgsftgykerpqdv................................
Mpf_ENSMPUP00000017782 vdwfnalraarfhylqvafpgasdadlvpklsrnylkegymektgpkqtegfrkrwftmddrrlmyfkdpldafarg
Mpf_ENSMPUP00000013550 algrdcimhgymlklgnpfltqwqrryfylfpnrlewrgegesrqnlltmeqilsveetq.................
Mpf_ENSMPUP00000017362 tvvansdesqlltpgkmnqrqgkeayptptkdlyqpffspasphsqgfergkedisqnkdesslsmsksksesklyn
Mpf_ENSMPUP00000006996 slaapkmasimegplskwtnvmkgwqyrwfvldynagllsyytskdkmmrgsrrgcvrlrgavigid..........
Mpf_ENSMPUP00000004785 kvcrgylvkmggkikswkkrwfvfdrlkrtlsyyvdkhetklkgviy..............................
Mpf_ENSMPUP00000014164 eefdcdlsdlrdmpeddgepckgaspepakspslrhsadlppplpqrpppedyyeealplgpgkspeyisshsaaps
Mpf_ENSMPUP00000016592 fstatvswdirtlystvpedaehkaenllvkeackfyssqwyvvnykyeqysgdirqlpraeykpeklpshsfevdh
Mpf_ENSMPUP00000000486 pkqyeniiksgtlyrltvqnnwkaftfvlsrtylmafqpgkldedpllsyhvdvclavqvdnlddcdscfq......
Mpf_ENSMPUP00000003712 nvdaangivmegylfkrasnafktwnrkkpdhirrwfsiqnnqlvyqkkfkdnptvvvedlrlctvkh.........
Mpf_ENSMPUP00000006850 ccrgslvkmggriktwkkrwfcfdrqarrlayyadkeetklkgviyfqaie..........................
Mpf_ENSMPUP00000015574 fqdvwpvtlrpkglgrtqglgsgryrlclgsgvlsllrkpkgrgsgdtqasppppalrlsllsvrrcgha.......
Mpf_ENSMPUP00000014962 eklvlsaecqlvtvvavipgll.......................................................
Mpf_ENSMPUP00000016814 lepsseevqknlrpfctldltspmlgvaseyirql..........................................
Mpf_ENSMPUP00000000139 vspivskkgylhflephtagwakrfvvvrrpyaylynsdkdsverfvln............................
Mpf_ENSMPUP00000012020 iqkagylnlrsktglvtttwerlyfftqggnlmcqprgavaggl.................................
Mpf_ENSMPUP00000006069 gkifnatlmlqdresyiallvgakygisqiissklnimstlaefanisrveltees.....................
Mpf_ENSMPUP00000017142 nlqklvhiehsvrgqgdllqpgreflkegtlmkvtgksrrprhlflmsdvllytypqkdgkyrlkntlsv.......
Mpf_ENSMPUP00000013991 pvlfssikkilkegpllkncnsfkrwklryflvrgqrlcfahhptfarfetidlsqvalaesscrnl..........
Mpf_ENSMPUP00000010353 ekiqhmyrcarvqgldtseglllfgkehfyvidgftmtatreirdietlppnmhepiiprgarq.............
Mpf_ENSMPUP00000000014 kpiyggwlllapdgtdfdnpvhrsrkwqrrffilyehgllryaldempttlpqgtinmnqctdvvdgegrtgqkfsl
Mpf_ENSMPUP00000009546 pyvdrqnricgfldieehensgkflrryfildtqancllwymdnpqnlamgagavgslqlty...............
Mpf_ENSMPUP00000012020 fgetedet.....................................................................
Mpf_ENSMPUP00000016751 trkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidnc..........................
Mpf_ENSMPUP00000000216 rrrhhcracghvvcwkcsdykaqleydggklnkvckdcyqiisgftdseekkrkgileiesae..............
Mpf_ENSMPUP00000010854 mpggvakagylhkkggtqlqllkwplrfviihkrciyyfksstsaspqgafslsgynrvmraa..............
Mpf_ENSMPUP00000016813 mdkpqnmkhsgylwaigknvw........................................................
Mpf_ENSMPUP00000002870 pyvdrqnricgfldieenensgkflrryfildtredsfvwymdnpqnlpsgssrvgaikltyiskvsdatklrpkae
Mpf_ENSMPUP00000003651 vekegylqkakiadggkklrknwstswivlssrklefykesk...................................
Mpf_ENSMPUP00000002370 levleewqshiegwedlniialcyklslhsfmlnlvshfpfeerliflidsvvmlcvattrrlknskastdghryif
Mpf_ENSMPUP00000006780 mdkpahmkhsgylyalgqkvw........................................................
Mpf_ENSMPUP00000002802 ssvshssimhtesenlpetvkencqeetpettaspveyqdklylhlkenfskvkayameigkkipvpdqctiedsvr
Mpf_ENSMPUP00000011336 vicsflhymekggkgwhkawfvvpeneplvlyiygapqdvkaqrslpligfevgpp.....................
Mpf_ENSMPUP00000003120 megvlykwtnyltgwqprwfvldngilsyydsqddvckgskg...................................
Mpf_ENSMPUP00000005803 kkwcvleggflsyyendkstapngtinineviclavhkedfylntgpift...........................
Mpf_ENSMPUP00000004980 megvlykwtnylsgwqprwfllcggilsyydspedawkgckgsiqmav.............................
Mpf_ENSMPUP00000015621 msdvtvvkegwvqkrgeyiknwrpryfllktdgsfigykekpqdvdlpyplnnfsvakcqlmkterpk.........
Mpf_ENSMPUP00000003141 pg...........................................................................
Mpf_ENSMPUP00000013099 nkehgterngnlykksdgirkvwqkrkcsvkngfltishgtanrppaklnlltcq......................
Mpf_ENSMPUP00000010983 qefivrgwlhkevknspkmsslklkkrwfvlthnsldyyksseknalklgtlvlnslcsvvppdek...........
Mpf_ENSMPUP00000004910 dpsvvimadslkirgtlkswtklwcvlkpgvlliyktpkvgqwvgtvllh...........................
Mpf_ENSMPUP00000016233 vltqcqdvelsfphqpegssvfcgtkrgtvf..............................................
Mpf_ENSMPUP00000002953 esirvnrrcisvapsretagelllgkcgmyfvednasdtvessslqgelepasfsw.....................
Mpf_ENSMPUP00000011716 fvksgwllrqstilkrwkknwfdlwsdghliyyddqtrhsvedkihmpvdcinirighecwdi..............
Mpf_ENSMPUP00000007767 vnssveergfltifedvsgfgawhrrwcvlsgncisywtypddekrknpigrinlanctshqiepanrefcarrntf
Mpf_ENSMPUP00000014585 itrkylkqgfmektgpkqkepfkkrwfvldpqerrllyyknpldafeqgqvflg.......................
Mpf_ENSMPUP00000014164 kksslaelkgsvsraagrkitriisfskkkpladdpqmpcseeevpccgylnvlvnqg...................
Mpf_ENSMPUP00000005886 pne..........................................................................
Mpf_ENSMPUP00000013797 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfq.......................................
Mpf_ENSMPUP00000004108 vygylmkytnlvtgwqyrffvlnneaglleyfvneqsrnqkprgtlqlagavispsdedshtftvn...........
Mpf_ENSMPUP00000009167 sqikralelgtvmtvfsfrkstperrtvqvimetrqvawsktadkiegfldi.........................
Mpf_ENSMPUP00000016226 pegvitkegmlhykagtsylgkehwktcfvvlsngil........................................
Mpf_ENSMPUP00000014024 imcgflqlvgdkwgksgprgwcviprddplvlyvyaapqdmrahtsv..............................
Mpf_ENSMPUP00000008448 gsaffevkqttepnfpeil..........................................................
Mpf_ENSMPUP00000010607 nhedfaldasilnvam.............................................................
Mpf_ENSMPUP00000015774 kqfgtekvgflykksdgirrvwqkrkcgvkygcltishstin...................................
Mpf_ENSMPUP00000008639 ededvramlqgsrlckirsrtwhkerlyrlqedglsvwfqrriprapsq............................
Mpf_ENSMPUP00000012941 kygllnvtkitengkkvrknwlsswavlqgssllftktqgsstswfgsnqskpeftvdlkgatvem...........
Mpf_ENSMPUP00000016218 skvllchgelknksghklyiflfqdilvltrpvtrnerhfyqvyrqp..............................
Mpf_ENSMPUP00000007001 eeliylsqkiefeckifplisqsrwlvksgeltalefslspglrrklntrpvhlhlfndclllsrpregsrflv...
Mpf_ENSMPUP00000001986 vrkagwlffkplvtlqkekklelvarrkwkqy.............................................
Mpf_ENSMPUP00000010415 tcgylnvlsnsrwrerwcrvkdnrlifhkdrtdlkth........................................
Mpf_ENSMPUP00000003836 aiknpeclgllhqsdgstdrwvqhycilkdgclyfyasirstqasgglylqgykvneqt..................
Mpf_ENSMPUP00000007027 lprggskptvkgwltkvkhghsklvwcalvgrtfyyyrshedkrplghlpvrdarieevdrsc..............
Mpf_ENSMPUP00000002688 emmytinsqlefkikpfplvsssrwlvkrgeltayvedtvlfsrrtskqqvyfflfndvliitkkksees.......
Mpf_ENSMPUP00000001373 smhqlqgnkeygsekkgyllkksdglrkvwqrrkcavkngiltishatsnrqpa.......................
Mpf_ENSMPUP00000013700 trqlvkdgflvevsessrklrhvflftdvllcaklkktsagkhqqydckwyipladlvfpspeeseaspqvhpfpdh
Mpf_ENSMPUP00000016589 gsaffevkqtsetsypdi...........................................................
Mpf_ENSMPUP00000015325 qdgtrkgylskrssdntkwqtkwfallqnllfyfesdsssrpsglyllegcvcdrapspkpa...............
Mpf_ENSMPUP00000001960 ssylnvlvnsqwksrwcsvrdshlhfyqdrnrskvaqqplsl...................................
Mpf_ENSMPUP00000006310 gltyylvrfkgskkddi............................................................
Mpf_ENSMPUP00000016747 qkdslidnsrvlcchgelknnrgvkl...................................................
Mpf_ENSMPUP00000013323 spsrstsscsskqgsrqdswevveglrgemsytqepaiqkgfllkkrkwplkgwhkrffyldkgilkyaksqtdier
Mpf_ENSMPUP00000007350 sdaldistkvqlygvlwkrpfgrpsakwsrrffiikesfllyysesekknfesnkyfni..................
Mpf_ENSMPUP00000017588 crslevgtvmtlfyskksqrperktfqvkletrqitwsr......................................
Mpf_ENSMPUP00000007745 ikqqrlnrlvegtcfrklncrrrqdkfwycrlspnhkvlhygdleespqgevphdslq...................
Mpf_ENSMPUP00000006409 klcgylskfggkgpirgwksrwffydekkchlyysrtaqdanpldsidlssavfdckadaee...............
Mpf_ENSMPUP00000015574 dvrlcghlrkqksqrrrffvlradpprlecyesekkfragrappklsvslagac.......................
Mpf_ENSMPUP00000008365 dkagvlhrtktvdkgkrlrkkhwsaswtvleggvltffkdskasaagglrqppklstpeytvdlrgaslswap....
Mpf_ENSMPUP00000001054 rrkwkhywvslkgctlffyesdgrsgidhnsipkhavwvensivqavpehpkkdfvfclsn................
Mpf_ENSMPUP00000017488 ikqqrlnrlcegssfrkignrrrqerfwycrlalnhkvlhygdlddnpqgevtfeslqek.................
Mpf_ENSMPUP00000005234 eqmisiqkkmefkiksvpiishsrwllkqgelqqmsgpktsrtlrtkklfreiyl......................
Mpf_ENSMPUP00000013182 rprkltlkgyrqhwvvfkettlsyyksqdeapgdpiqqlnlkgcevvpd............................
Mpf_ENSMPUP00000011513 ttpvyttlkgkatqissspflddssgseeedssrsssrtsesdtrnrsgpgspramkrgvslssvasesdyaippda
Mpf_ENSMPUP00000005385 githfiarfqggkkeeligiayn......................................................
Mpf_ENSMPUP00000009077 ekvtqkyslvivqghlvsegvllfghqhfyicenftlspvgdvyctrhclsnisdpfi...................
Mpf_ENSMPUP00000001767 eliktprvdnvvlhrpfypavegtlcltghhlilssrqdnteelwllhs............................
Mpf_ENSMPUP00000007827 pytmegylyvqekrhfgtswvkhyctyqrdskqitmvpfdqksggkggede..........................
Mpf_ENSMPUP00000000541 adkagwikkssggllgfwkdrylllcqaqllvyenedeqkcvetvelgsyekcq.......................
Mpf_ENSMPUP00000001809 veksgllnvtkiaqggrklrknwssswvvlagnslvfyrepppaapssiwgpagsrpe...................
Mpf_ENSMPUP00000005803 esikegmlkikeepskilsgnkfqdryfvlrdgylflykdsksskydkmfslgslkfylgvkkkmkpptswgltays
Mpf_ENSMPUP00000013182 gisyivvrfkgsrkdeilgiannrliridlavgdvvktwrfsnmrqwnvnwdi........................
Mpf_ENSMPUP00000005315 gnhpsappekvgwvrkfcgkgifreiwknryvvlkgdqlyvsdkevkdekniqevfdlsdyekceelr.........
Mpf_ENSMPUP00000014585 gnregflwkrgrdnaqflrrkfvllakegllkyytkeegkgpkavisik............................
Mpf_ENSMPUP00000015166 rkeghllkkrkwplkgwhkryfvledgilhyattrqditkgklhgsidvrl..........................
Mpf_ENSMPUP00000002409 rrvkvytlnedrqwddrgtghvsstyveelkgmsllvr.......................................
Mpf_ENSMPUP00000005807 virrgwltinnislmkggskeywfvltaesls.............................................
Mpf_ENSMPUP00000013796 elpwtlqrrlirlraasghrtagsavcasrvklqhlpsqeqqdrllvlypssla.......................
Mpf_ENSMPUP00000017782 pdkqepysagyregflwkrgrdngqflsrkfvlteregslkyfnrndakepkaimkiehlnatfqpakighphglqv
Mpf_ENSMPUP00000019464 sdspadhtgflrtwggpgtaptpsgtgrrcwfvlkgnllfsfesresraplslvvlegctvela.............
Mpf_ENSMPUP00000012725 rpallpgeeivceglrvlldpdgreeatggllggpqllpaegalflttyrilfrgtphdqlvgeqtvvrsfpiasit
Mpf_ENSMPUP00000010996 gflnqqqmeenliswrrlycvlrggklycfyspqeieakvepalvvsinke..........................
Mpf_ENSMPUP00000007938 elerplhpkervleqalqwcqlpepcsaslllrkvslaqagclftgirresprvgllrcreepprllgnrfqerffl
Mpf_ENSMPUP00000009654 vrggwlwrqssilrrwkrnwfalwldgtlgyyrdetaqdeedrvliqfnird.........................
Mpf_ENSMPUP00000005385 kpkkltlkgykqywctfkdtsiscykskeessgtpahqmnlrgcevtp.............................
Mpf_ENSMPUP00000006310 rpkklilkafkqywfifkdtsiayfknkeleqgepveklnlrgc.................................
Mpf_ENSMPUP00000007963 pdvleyykndhskkplriinlnfceqvdagltfnkkelqdsfvfdiktser..........................
Mpf_ENSMPUP00000002310 raipikqgmllkrsgkslnkewkkkyvtlcdngvltyhpslhdymqnvhgkeidllrttvkvpgkrppratsacapi
Mpf_ENSMPUP00000000486 qafpnilkkgyleirkdhdsy........................................................
Mpf_ENSMPUP00000007805 rrvkvytlnedrqwddrgtghvssgyverlkgmsllvraesd...................................
Mpf_ENSMPUP00000010246 eklhmeckaemvtplvtnpghvcitdtnlyfqplngypkpvvqitlqdvrriy........................
Mpf_ENSMPUP00000004460 divkqgyvkmksrklgiyrrcwlvfrkssskgpqrlekypdeksvclrgcpkvteisnvkcvtrlpketk.......
Mpf_ENSMPUP00000014791 lhccdeavsfslrsyehtrdlslflfndallvssrgtvhtpfertsksty...........................
Mpf_ENSMPUP00000003154 dkhegfmlkkrkwplkgwhkrffvldngmlkyskapldiqkgkvhgsidvglsvmsikk..................
Mpf_ENSMPUP00000005214 kndqhlrrvqallsgrqakgltsgrwflrqgwllvvpphgeprprmfflfsdvllmakprpplhllqsgtfacraly
Mpf_ENSMPUP00000003932 evckrgylrkqkhghrryfvlkletadaparleyyenarkfrhsvraaaaaaaaaasgaavpalipprrvitlyqc.
Mpf_ENSMPUP00000008710 dckvdsigsgraipikqgvllkrsgkslnkewkkkyvtlcdnglltyhpslhdymqnihgkeidllrttvkvpgkrl
Mpf_ENSMPUP00000005632 lirqqrllrlcegtlfrkissrrrqltdklwfcclspnhkvlqygd...............................
Mpf_ENSMPUP00000002828 kgehrqllkdsfmvelvegarklrhvflftdlllctklkkqsggktqqydckwyipltdlsfqtvdeseaapsiplv
Mpf_ENSMPUP00000017859 kvenvrlvdrisskkaalgtlyltathvifvenapdtrketwilhsqist...........................
Mpf_ENSMPUP00000013754 gssatvptmegplrrktllkegrrpalsswtrywvilsgstllyy................................
Mpf_ENSMPUP00000004548 pgqptiegylytqekwalgiswvkyycqyeketkmltmtpmeqkpgakqgpldltlky...................
Mpf_ENSMPUP00000000646 kveqvkl......................................................................
Mpf_ENSMPUP00000004473 lcsslqvsdsgvvwsevwatipaseplelvlhlqrdsqdggpprtiplagctv........................
Mpf_ENSMPUP00000000402 peiegvlwlkddgkkswkkryfllrasgiyyvpkgkakvsrelvcflqldhvnvyygqdyrnkykaptdhclvl...
Mpf_ENSMPUP00000007412 eqmyelharldfgrvkslplisasrwllkrgelfvveetrlfrklasrptcylflfn....................
Mpf_ENSMPUP00000004935 psgeeifatiiitgnggiqwsrgkhkesetlteqdlqlycdfpdiidvtikq.........................
Mpf_ENSMPUP00000011513 kvkhgyskrvwctligktlyyfrsqedkfplgqiklweakveevdrscdsde.........................
Mpf_ENSMPUP00000001759 psqwtmegylyvqekrplgftwikhyctydkgsktftmsvsemkssgkmnglvtg......................
Mpf_ENSMPUP00000008353 lsnpfrglmklgtverrgamgiwkelfcelsplefrlylnteerlcvetcsllrcesvgpahsdg............
Mpf_ENSMPUP00000012083 pelegalylkedgkkswkrryfllrasgiyyvpkgktktsrdlacfiqfknvniyygiqckmrykaptd........
Mpf_ENSMPUP00000006956 sqftaegylyvqekrpapfgsswvkhycmyrkaakkfniipfehrsggklgdgevfflk..................
Mpf_ENSMPUP00000014860 peiqgflqlrgsgrklwkrffcflrrsglyystkgtskdprhl..................................
Mpf_ENSMPUP00000009647 mivgkkpvlslphrrlvcccqlyevpdpnrpqrlglhqrevflfndllvvtkifqkk....................
Mpf_ENSMPUP00000005803 aatpekcgylelrgykakiftvlsgssvwlckneqdfksglgitiipmnvanv........................
Mpf_ENSMPUP00000005109 vtiqgvlrrktllkegkkptvaswtkywaalcgtqlfyyaakslkaterkhfkstsnk...................
Mpf_ENSMPUP00000006149 qnstkiyqrcwlvfkkasskgpkrlekfsderaayfrcyhkvtelnnvk............................
Mpf_ENSMPUP00000001981 raipikqsfllkrsg..............................................................
Mpf_ENSMPUP00000017916 yvtkveksivgmktvlsvphrrlvccsrlfevtdvnklqkqaahqrevflfndllvilklcpkkk............
Mpf_ENSMPUP00000003318 ssrtllidgrvelkrglqrqerhlflfndlfvvakikynnnfkiknkiklsdmw.......................
Mpf_ENSMPUP00000017175 vlslphrrlvcycrlfevpdpnkpqklglhqreiflfndllvvtkifqkkknsvtysfrqs................
Mpf_ENSMPUP00000016038 spdvleyyrskhaskpiraidlsecavwrhvgpgfprkefq....................................
Mpf_ENSMPUP00000016192 ihfegkifplisqarwlvrhgelvelaplpaappaklklsskavylhlfndclll......................
Mpf_ENSMPUP00000015325 nirknlaiermiiegceilldtsqtfvrqgsliqvpmsekgkitrgrlgslslkkegerqcflfskhliic......
Mpf_ENSMPUP00000000660 lssst........................................................................
Mpf_ENSMPUP00000005493 tgclpgeqilgwapgvrkglepelpgtlictnlrvtfqpcgwqrsqetplsseydfvlvnigrleavsglsrvqllr
Mpf_ENSMPUP00000009754 khgmmkfredrsllglglpsggfhdryfilnssclrlykeirshrpekewpvrslkvylgvkkklrpptcwgftvv.
Mpf_ENSMPUP00000013796 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfqhsqdvsdcylelfhsylyfq...................
Mpf_ENSMPUP00000010667 hfepvvplpdkievktgeedeeeffc...................................................
Mpf_ENSMPUP00000013126 virkgwltinnigimkggskeywfvltaenlswykddethslsetdm..............................
Mpf_ENSMPUP00000018046 nflnssscpeiqgflhvkelgrks.....................................................
Mpf_ENSMPUP00000006359 qdpklrelldvgnigrlehrmitvvygpdlvnis...........................................
Mpf_ENSMPUP00000015086 lhllpgeqllceastvlkyvqedscqrgiygklvctdfkiaflgddesaldndetqfknkvigenditlhcvdqiyg
Mpf_ENSMPUP00000008387 nirknlaiermivegcdilldtsqtfirqgsliqvpsvergklskvrlgslslkkegerqcflftkhflic......
Mpf_ENSMPUP00000015207 daliaisnyrlhikfkdsvinvplrmidtvesrdmfqlhiackdskvvrchfstfkqcqew................
Mpf_ENSMPUP00000004217 thsgc........................................................................
Mpf_ENSMPUP00000015689 gedakgllrvagdsgiawssggqealqpfcdfpeivdisikqapcvgpagehrl.......................
Mpf_ENSMPUP00000015159 lrgpeapplrgtlcvtghhlllspgpqgtsdlwllllrsvdsiekrvsgdsgtit......................
Mpf_ENSMPUP00000018833 vkvyslnedqqwddlgtghvsstyvkrlqgvsllvrsds......................................
Mpf_ENSMPUP00000007866 asgtlrvqqagelqdwarvhgvlkgtslfcyrqpedadtgeeplftiainketrvragepdqa..............
Mpf_ENSMPUP00000007938 qpprplrtgmlelrghkakvfaalspgelalykseqafssgigicfielqgcsvretksrsfdlltp..........
Mpf_ENSMPUP00000010694 ntdtlscsswptspglrwekrwcdlrlipllhsrfsqyvpgtdlsr...............................
Mpf_ENSMPUP00000013131 iialsnyrlhikfkeslvnvplqliesvecrdifqlhltck....................................
Mpf_ENSMPUP00000000312 hagrfsvnwfilfndalvhaqfsthhvfplatlwaeplseeaggvnglkittpeeqft...................
Mpf_ENSMPUP00000019132 atvlkegvlekrsggllqlwkrkrcvlterglqlfeakgtggrpkel..............................
Mpf_ENSMPUP00000015959 lseldlgaerdvrvw..............................................................
Mpf_ENSMPUP00000012612 npdregwllklgwgrkwdrmwlrgaslqhdeeagrtsnpqrgavamcgkmakhldsgartfclelynpscrgqkika
Mpf_ENSMPUP00000007938 lyrkphpqypdhsqllqalcaavagpnllknmtqllcveasegeepwspaaldgsfpglqlpdpspgvynevvvpat
Mpf_ENSMPUP00000007989 eelirltqrlrfhkvkalplvswsrrlelqgeltelgcrrggvlftsrprftplclllfsdlllitqpksg......
Mpf_ENSMPUP00000016156 deeasdeppkvvvtevkeedafyskkcklfy..............................................
Mpf_ENSMPUP00000013721 riifsgnlfqyqednkkwrnrfslvphnyglvlyenkvayerqvppraiinsagykiltsldqylelvgnslpgtss
Mpf_ENSMPUP00000005447 pesriegwlsipnrgnikrygwkkqyvvvsskkilfyndeqdkeqsspsmvldidklfhvrpvtqgdvyraeteeip
Mpf_ENSMPUP00000015768 ehrgpltqlgghpprwqpifcvlrgdgrlewfshreeyengghplgsttltgytvltsqreylh.............
Mpf_ENSMPUP00000004215 vkqgflyllqqqtfgkkwrrfgavlygesdcalarlelqegpekprrgeaarr........................
Mpf_ENSMPUP00000010108 eedpdvvvkgwlygeprgggarpwlpprrawfvltrdsldqfsssg...............................
Mpf_ENSMPUP00000002188 mpdnlytfvlkvkdrtdiif.........................................................
Mpf_ENSMPUP00000013446 pesrlegwlslpvrnntkkfgwvkkyvivsskkilfydseqdkeqsnpymvldidklfhvrpvtqtdvyradakeip
Mpf_ENSMPUP00000012407 etgtgta......................................................................
Mpf_ENSMPUP00000017043 egmimkrsgg...................................................................
Mpf_ENSMPUP00000007898 vfpvfvqpldlcnpartlllseelllyegrnkaievtlfaysdlllftkedepgrcdvlrn................
Mpf_ENSMPUP00000017064 qkqifdvvyevdgcpanllsshrslvqrvetislgehpcdrgeqvtlflfndcleiarkrhkvigtfrsppghtrpp
Mpf_ENSMPUP00000009754 hagslelrgfknklyvavvgdkvqlyknleeyhlgigitfidmsvgnvkeadrrsfdlt..................
Mpf_ENSMPUP00000016461 svwvktgalqwwcdwkphkwvdvcvaleqftgldgardsilfiyyvvheekkylhv.....................
Mpf_ENSMPUP00000008230 gavmegplflqsqrfgtkrwrktwavlypasphgvarleffdhkgsssgggrggsrrldckvirla...........
Mpf_ENSMPUP00000001993 enevckqdyfikspppqlffsasswkrryfilsksgerslrlsyykdqhrrgsieidrnssvevgihgqekmqsvqk
Mpf_ENSMPUP00000014500 tcrgtinlatanitvedscnfiisng...................................................
Mpf_ENSMPUP00000002405 silgqefcfevttss..............................................................
Mpf_ENSMPUP00000002933 pglqskepssglhlegwmkvprnnkrgqqgwdrkyivlegskvliydneareagq......................
Mpf_ENSMPUP00000007268 ssilgqdycfevttssgs...........................................................
Mpf_ENSMPUP00000010983 avgtldvglid..................................................................
Mpf_ENSMPUP00000010498 egqvklrdgkkwktrwlvlrkpspvadcllmlvykdkaerakglrerssltledicglepglpyeg...........
Mpf_ENSMPUP00000018101 ayegrvwipkkagarkgwqralavvcdfklflynmdeekdskpnvvvsqvidmrdgafsvssvwlsn..........
Mpf_ENSMPUP00000002033 rprllpgeecvldglrvyllpdgreegaggsgggpallpaegavflttyrviftgmptdplvgeqvvvrsf......
Mpf_ENSMPUP00000010694 pvnqqivymgwceareqdplqdrvysptflalrgsclykflappvttwdwtraektfsvyeimckilkdsdll....
Mpf_ENSMPUP00000008353 daikesllylytdr...............................................................
Mpf_ENSMPUP00000009754 ferlgrlpykaglslqraqegwfsltgselravfpegpceeplqlrklqelsvqgdsenqvlvlverrrtly.....
Mpf_ENSMPUP00000015718 gtayeghvripkpagvkkgwqralavvcdfklflydvaegkasqpsvvvsqvidmrdeefs................
Mpf_ENSMPUP00000002358 a............................................................................
Mpf_ENSMPUP00000005077 csavecldlgrgepvsvkplhss......................................................
Mpf_ENSMPUP00000009107 ptmegflefqqqlwsaqrqpclslwdgchgtlrgsslslfwdkrtaaenmapvatldlrgaq...............
Mpf_ENSMPUP00000016101 gqrqlllcetltetvygdrgqlikskerrvfllndmlvcaninfkpannrgqleisslvplgpkyvvkwntalpqvq
Mpf_ENSMPUP00000011911 pletpvkdgilyqqhikfgkkswrkvwgllyagspsgvarleswevregglgptgdrptgps...............
Mpf_ENSMPUP00000007938 gllrlgrlwlrspthsalapglwlsgfgllrgdllflcpasgpgppapedmvhl.......................
Mpf_ENSMPUP00000009676 harvlqeieahiegmedlqaplrrflrqemvievkavggkkdrslflftdlii........................
Mpf_ENSMPUP00000005809 yegplwkssrffgwrlfwvvlehgvlswyrkqpdavrniyrqg..................................
Mpf_ENSMPUP00000016410 mqlpvnrwtrrqvilcgtclivssvkdsltgkmhvlpliggkveevkkhq...........................
Mpf_ENSMPUP00000006638 wtyfcdfqdithvvlkech..........................................................
Mpf_ENSMPUP00000005803 dligqlyykdchaldqwrkgwfsmeksslrfclqmqevqedr...................................
Mpf_ENSMPUP00000010983 tlpyfhsflymkgg...............................................................
Mpf_ENSMPUP00000000717 nfsyfpeithivikesvvsinkqdnk...................................................
Mpf_ENSMPUP00000002793 geivktkerrvfllsdvlmcatvsartadsnalaspgrkyllkwsvplgrvevve......................
Mpf_ENSMPUP00000007833 mdhldrillsgiynvrkgktqlhkwaerlvvlcgtclivssvkdcqtgkm...........................
Mpf_ENSMPUP00000002271 anhesyllmastqnd..............................................................
Mpf_ENSMPUP00000010974 snkhvfaifnteqrnvy............................................................
Mpf_ENSMPUP00000010755 egvirkrsgghrvpgltccgrdqvcyrwskrwlvvkds.......................................
Mpf_ENSMPUP00000013112 ldtcaefrikyvgaieklkfsegkslegpldlinyidvaqqdgklpfvpleeef.......................


                                                                                                    
                                                                                                    
d1shca_                .............................................................................
Mpf_ENSMPUP00000000236 hflillfskdedisltlnmneeevekrfegrltknmsgslyemvsrvmkalvnrkitvpgnfqghsgaqc.......
Mpf_ENSMPUP00000001054 shrlsiyedwdpf................................................................
Mpf_ENSMPUP00000001986 nsrpahnsad...................................................................
Mpf_ENSMPUP00000006133 .............................................................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 .............................................................................
Mpf_ENSMPUP00000012215 .............................................................................
Mpf_ENSMPUP00000016175 .............................................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 .............................................................................
Mpf_ENSMPUP00000018612 .............................................................................
Mpf_ENSMPUP00000018966 .............................................................................
Mpf_ENSMPUP00000004660 erydkddeahsegnqfppiaaqdlpfvlkagylekrrkdhsflgf................................
Mpf_ENSMPUP00000002149 rrgeessemeqisiierfpypfqvvydegp...............................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 .............................................................................
Mpf_ENSMPUP00000011363 .............................................................................
Mpf_ENSMPUP00000015445 .............................................................................
Mpf_ENSMPUP00000015195 sltsdapflpdyqdegvedllkgaqeldniikqgylekksk....................................
Mpf_ENSMPUP00000011751 g............................................................................
Mpf_ENSMPUP00000009831 kyevvdiedgrdddfnv............................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 eqyihdldtnsfeldlefsedek......................................................
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000000642 elvdledgrdkdwnls.............................................................
Mpf_ENSMPUP00000015373 .............................................................................
Mpf_ENSMPUP00000003213 .............................................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 .............................................................................
Mpf_ENSMPUP00000003212 .............................................................................
Mpf_ENSMPUP00000001158 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 .............................................................................
Mpf_ENSMPUP00000003768 .............................................................................
Mpf_ENSMPUP00000008012 .............................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 .............................................................................
Mpf_ENSMPUP00000017573 .............................................................................
Mpf_ENSMPUP00000012859 .............................................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013200 .............................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 mdrqtvsmainevfnelil..........................................................
Mpf_ENSMPUP00000002913 .............................................................................
Mpf_ENSMPUP00000003504 dkyplimvpdeveyllkkvlssmslevglgeleellaqeaqaaqttgglsvwqflelfnsgrclrgvgrdtlsmaih
Mpf_ENSMPUP00000004361 .............................................................................
Mpf_ENSMPUP00000017389 if...........................................................................
Mpf_ENSMPUP00000015829 aiievrttmplempekdnt..........................................................
Mpf_ENSMPUP00000003644 .............................................................................
Mpf_ENSMPUP00000006376 .............................................................................
Mpf_ENSMPUP00000014536 aakrl........................................................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 sakrl........................................................................
Mpf_ENSMPUP00000006727 .............................................................................
Mpf_ENSMPUP00000000961 racknlwkacvehhtffrldrplppqknffahyftlgs.......................................
Mpf_ENSMPUP00000004942 a............................................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 .............................................................................
Mpf_ENSMPUP00000010395 fmrkvqind....................................................................
Mpf_ENSMPUP00000015361 .............................................................................
Mpf_ENSMPUP00000001991 khlw.........................................................................
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 .............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 nmaavgit.....................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 .............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 vm...........................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 .............................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 waqmqidka....................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 ckhlwkcsvehhtffrmpenesnsls...................................................
Mpf_ENSMPUP00000010571 .............................................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 nfefetrqgn...................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 .............................................................................
Mpf_ENSMPUP00000007327 .............................................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 ackt.........................................................................
Mpf_ENSMPUP00000013206 ladyclfyykdsreeavlgsiplpsyv..................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 ackt.........................................................................
Mpf_ENSMPUP00000008316 yvwrlcvarhkfyrlnqcslqtqtv....................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 ackt.........................................................................
Mpf_ENSMPUP00000017478 lyifrgrintevmevenvedgtadyhsngytvtng..........................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 wkrrffvldd...................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 dss..........................................................................
Mpf_ENSMPUP00000012096 dptnnkdvkkwsygfylihlqg.......................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000011499 wvvftnfclffykshqdnhplaslpllgyslt.............................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 fhsinpstfkk..................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 .............................................................................
Mpf_ENSMPUP00000016865 .............................................................................
Mpf_ENSMPUP00000000090 npttdkenkk...................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 erekvpanpealllmassq..........................................................
Mpf_ENSMPUP00000000172 nsngwqklwvvftnfc.............................................................
Mpf_ENSMPUP00000013402 yisrlfat.....................................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 p............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 my...........................................................................
Mpf_ENSMPUP00000009754 ededdhayegipnggwhtsslssslpssllipelpphpmdghpvgpapitpvikagwldknppqgsyiyqkrwvrld
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 .............................................................................
Mpf_ENSMPUP00000007027 daysldsdysepehklqrtssysaegpglagesle..........................................
Mpf_ENSMPUP00000012725 gvdrraatlysqyasrndenrsfegtlykrg..............................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 lqg..........................................................................
Mpf_ENSMPUP00000014024 tlelqarsqeemisw..............................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 veegehe......................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 .............................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 drwvvlknntl..................................................................
Mpf_ENSMPUP00000002033 rwfvl........................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 eesedewg.....................................................................
Mpf_ENSMPUP00000005375 .............................................................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 .............................................................................
Mpf_ENSMPUP00000009754 asagkllqdrrar................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 .............................................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 qkkipaalkevsantedssmsgy......................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 elmrda.......................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 .............................................................................
Mpf_ENSMPUP00000014021 .............................................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 .............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 ragkneflnlvpdieeirpgsvvsk....................................................
Mpf_ENSMPUP00000018773 .............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 ragkneflnlvpdieeirpgsvvsk....................................................
Mpf_ENSMPUP00000015036 ys...........................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 gcpmrsrhllqllsnshr...........................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 k............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 evfigskesgytvldglppstqghhwp..................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 gsekdssasskltkkeslkvqkknyreekkratkellstitdpsvi...............................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 .............................................................................
Mpf_ENSMPUP00000014164 tnptdgcspahsimdgyyedadssypatrmngelknsyndsdpmsssyesydeeeeegkgpqpthqwpseeasmhlv
Mpf_ENSMPUP00000016592 edadkdedttshssskgggaaggtgvfk.................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 .............................................................................
Mpf_ENSMPUP00000000014 c............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 rgrintevmevenvddgtadfhssghivvngwkihnt........................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 scvaklfftcslkghyclyskssfilisqepqpwiqimflfqqslfpeplsiqshsvqflralwektqaegahsfet
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 .............................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 elitvrpqred..................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 .............................................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 .............................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 eledmkmkisalkseiqkekankgqsraierlkkkmfe.......................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 eklhgcidvglsvmsvkkss.........................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 ystd.........................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 .............................................................................
Mpf_ENSMPUP00000001767 .............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 ek...........................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 tylkdn.......................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 kekk.........................................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 lrghcllllk...................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 sspktng......................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 pmaqcqlhrvfghsg..............................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 pratpatapgt..................................................................
Mpf_ENSMPUP00000005632 .............................................................................
Mpf_ENSMPUP00000002828 ldeeldamkik..................................................................
Mpf_ENSMPUP00000017859 .............................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 .............................................................................
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 p............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 vfdekkkplf...................................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 ckt..........................................................................
Mpf_ENSMPUP00000007938 yssflycg.....................................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 ksgtapilkcptqfplil...........................................................
Mpf_ENSMPUP00000005447 kifqilyanegecrkdvemepvqq.....................................................
Mpf_ENSMPUP00000015768 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 rifq.........................................................................
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 aslkhi.......................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 mf...........................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 vvevgqesgsydkdnvliqhagakkasavgqaqnkvyfgpprlfqelqdlqkdlavveqitflistlhgtyqnlnmt
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 .............................................................................
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                                                         10        20          30   
                                                                          |         |           |   
d1shca_                ..........................................--HMGQLGGEEWTRHGSFVN..KPTRGWLHPNDKV
Mpf_ENSMPUP00000000236 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001054 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001986 ..........................................------------------L-..-------------
Mpf_ENSMPUP00000006133 ..........................................-------GGEEWTRHGSFVN..KPTRGWLHPNDKV
Mpf_ENSMPUP00000009494 ..........................................--------------------..------------D
Mpf_ENSMPUP00000004093 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012215 ..........................................----------CPLPGPGEPT..PGSRQDRHFLQHL
Mpf_ENSMPUP00000016175 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009909 ..........................................--------ADEWIRKGSFIH..KPAHGWLHPDARV
Mpf_ENSMPUP00000010977 ..........................................--------------------..------------D
Mpf_ENSMPUP00000016638 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018612 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018966 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004660 ..........................................--------------------..E------------
Mpf_ENSMPUP00000002149 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018066 ..........................................--------------------..----------TEL
Mpf_ENSMPUP00000017958 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011450 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016402 ..........................................--------------------..-----------DL
Mpf_ENSMPUP00000004951 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011363 ..........................................----GEPSITLRPPNEATAS..TPVQYWQHHPEKL
Mpf_ENSMPUP00000015445 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015195 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011751 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009831 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004111 ..........................................--------------------..------------D
Mpf_ENSMPUP00000005349 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006137 ..........................................--------------------..------------L
Mpf_ENSMPUP00000009095 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005832 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014567 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015198 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008441 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005146 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010667 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000642 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015373 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003213 ..........................................-------KLTLRPPSLAAPY..APVQSWQHQPEKL
Mpf_ENSMPUP00000012196 ..........................................--------------------..LFTREFLHGMEIL
Mpf_ENSMPUP00000012194 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003212 ..........................................-------KLTLRPPSLAAPY..APVQSWQHQPEKL
Mpf_ENSMPUP00000001158 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010667 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013386 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016712 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003302 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003768 ..........................................--------QSFRRKKDVYVPeaSRPHQWQTDEEGV
Mpf_ENSMPUP00000008012 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002625 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010667 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006140 ..........................................--------------------..-----DFPTPKTE
Mpf_ENSMPUP00000015670 ..........................................--------------------..-LPENWTDTRETL
Mpf_ENSMPUP00000008341 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017573 ..........................................--------------------..SRPHQWQADEDAV
Mpf_ENSMPUP00000012859 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012131 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000172 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013200 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003522 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011499 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011494 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012716 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002913 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003504 .................evyqeliqdvlkqgylwkrghlrrn--------------------..-WAERWFQLQPSS
Mpf_ENSMPUP00000004361 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017389 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015829 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003644 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006376 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014536 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011501 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017670 ..........................................--------------------..--W----------
Mpf_ENSMPUP00000006727 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000961 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004942 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002151 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014680 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005563 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011333 ..........................................-------------------K..-------------
Mpf_ENSMPUP00000000969 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010395 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015361 ..........................................--------I-----------..-------------
Mpf_ENSMPUP00000001991 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005637 ..........................................-EDYWYEAYNMRTGARGVFP..AYYAIEVTKEPEH
Mpf_ENSMPUP00000007307 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008193 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007177 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010360 ..........................................--------------------..----------E--
Mpf_ENSMPUP00000010611 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007161 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006134 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004983 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001920 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013542 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008337 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013626 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001949 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017721 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001109 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001935 ..........................................EDDFWFRGFNMRTGERGVFP..AFYAHAVPGPAKD
Mpf_ENSMPUP00000006252 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005676 ..........................................---------PFPAQSLSPEP..LPQEEEKLPPRNA
Mpf_ENSMPUP00000005196 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012589 ..........................................--------------------..---------RKLS
Mpf_ENSMPUP00000010571 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011589 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005676 ..........................................--------------------..----------KNE
Mpf_ENSMPUP00000002533 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004215 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013399 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010530 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006089 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016498 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007327 ..........................................----------Y---------..-------------
Mpf_ENSMPUP00000001749 ..........................................-----------RYPSYSFKH..CLKMDEVGITEYV
Mpf_ENSMPUP00000016475 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013206 ..........................................--------------------..-----I-------
Mpf_ENSMPUP00000006140 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005780 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001869 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012475 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008316 ..........................................----TVNPIRRRSSSRVSLP..KPQPYVMPPPPQ-
Mpf_ENSMPUP00000001167 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008230 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017717 ..........................................--------------------..-----Q-------
Mpf_ENSMPUP00000010272 ..........................................-----------G--------..-------------
Mpf_ENSMPUP00000003964 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017478 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010168 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009546 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002870 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000151 ..........................................--------------------..--------L----
Mpf_ENSMPUP00000000216 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007012 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012096 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004281 ..........................................--------------------..-----E-------
Mpf_ENSMPUP00000004460 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011499 ..........................................--------------------..------IPSESED
Mpf_ENSMPUP00000003498 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006723 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006149 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011052 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015653 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014937 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006713 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005370 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017142 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011052 ..........................................--------------------..---TSELGVTEHV
Mpf_ENSMPUP00000000930 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016865 ..........................................--------------------..-----E-------
Mpf_ENSMPUP00000000090 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012035 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009068 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000172 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013402 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012726 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010329 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005886 ..........................................--------------------..----------EFD
Mpf_ENSMPUP00000011911 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013895 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009754 ............................adhlryfdsnkday--------------------..-------------
Mpf_ENSMPUP00000017452 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004281 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017577 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004977 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017884 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007027 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012725 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000871 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006220 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008418 ..........................................--------------------..------------V
Mpf_ENSMPUP00000003932 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001861 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008418 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006249 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003836 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015858 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002835 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004473 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000137 ..........................................--------------------..---K---------
Mpf_ENSMPUP00000001907 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014024 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001742 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000172 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005480 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018515 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009502 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013672 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011336 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001410 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003424 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007040 ..........................................--------------------..-------------
Mpf_ENSMPUP00000019493 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018830 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003141 ..........................................--------------------..---------NEDA
Mpf_ENSMPUP00000010983 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010498 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012786 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014114 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007256 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005608 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002033 ..........................................--------------------..---------D---
Mpf_ENSMPUP00000016751 ..........................................--------------------..------------D
Mpf_ENSMPUP00000016435 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001167 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001585 ..........................................-------D------------..-------------
Mpf_ENSMPUP00000002351 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011499 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005375 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015986 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004747 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009754 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002257 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006734 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003502 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011019 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003673 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000383 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008997 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010040 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007257 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016774 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001960 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007610 ..........................................-----------------SEG..RQSEVFQRYPDGV
Mpf_ENSMPUP00000017612 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007907 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014021 ..........................................--------------------..------------A
Mpf_ENSMPUP00000008982 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005803 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002728 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007017 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003752 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001306 ..........................................------------S-------..-------------
Mpf_ENSMPUP00000005338 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001689 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010415 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006220 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016350 ..........................................--------------------..---K---------
Mpf_ENSMPUP00000018773 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017599 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016349 ..........................................--------------------..---K---------
Mpf_ENSMPUP00000015036 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007938 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007257 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005203 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000650 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007937 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007017 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012780 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002522 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004905 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011326 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009449 ..........................................------------T-------..-------------
Mpf_ENSMPUP00000000014 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012737 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002136 ..........................................----------------EQRE..APLNNFSVAQCQL
Mpf_ENSMPUP00000017782 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013550 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017362 ..........................................--------------------..-V-----------
Mpf_ENSMPUP00000006996 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004785 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014164 ..................................rdcricaf--------------------..-------------
Mpf_ENSMPUP00000016592 ..........................................--------------------..---S---------
Mpf_ENSMPUP00000000486 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003712 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006850 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015574 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014962 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016814 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000139 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012020 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006069 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017142 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013991 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010353 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000014 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009546 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012020 ..........................................--------------------..-------FPEAED
Mpf_ENSMPUP00000016751 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000216 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010854 ..........................................--------------------..---------E---
Mpf_ENSMPUP00000016813 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002870 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003651 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002370 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006780 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002802 ammestfpqqkdldqvqlhleevrffdvfgfseaagawqcfm--------------------..-------------
Mpf_ENSMPUP00000011336 ..........................................-------E------------..-------------
Mpf_ENSMPUP00000003120 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005803 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004980 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015621 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003141 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013099 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010983 ..........................................--------------------..------------I
Mpf_ENSMPUP00000004910 ..........................................--------------------..--------C----
Mpf_ENSMPUP00000016233 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002953 ..........................................-------------T------..-------------
Mpf_ENSMPUP00000011716 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007767 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014585 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014164 ..........................................---W----------------..-------------
Mpf_ENSMPUP00000005886 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013797 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004108 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009167 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016226 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014024 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008448 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010607 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015774 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008639 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012941 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016218 ..........................................--------------------..------I------
Mpf_ENSMPUP00000007001 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001986 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010415 ..........................................-----------------I--..-------------
Mpf_ENSMPUP00000003836 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007027 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002688 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001373 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013700 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016589 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015325 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001960 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006310 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016747 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013323 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007350 ..........................................--------------------..-H-----------
Mpf_ENSMPUP00000017588 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007745 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006409 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015574 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008365 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001054 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017488 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005234 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013182 ..........................................--------------------..------------V
Mpf_ENSMPUP00000011513 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005385 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009077 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001767 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007827 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000541 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001809 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005803 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013182 ..........................................--------------------..--R----------
Mpf_ENSMPUP00000005315 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014585 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015166 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002409 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005807 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013796 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017782 ..........................................--------------------..-------------
Mpf_ENSMPUP00000019464 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012725 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010996 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007938 ..........................................---------------E----..-------------
Mpf_ENSMPUP00000009654 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005385 ..........................................--------------------..-----------D-
Mpf_ENSMPUP00000006310 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007963 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002310 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000486 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007805 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010246 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004460 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014791 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003154 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005214 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003932 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008710 ..........................................---------S----------..-------------
Mpf_ENSMPUP00000005632 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002828 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017859 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013754 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004548 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000646 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004473 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000402 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007412 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004935 ..........................................--------------------..-------------
Mpf_ENSMPUP00000011513 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001759 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008353 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012083 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006956 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014860 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009647 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005803 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005109 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006149 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001981 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017916 ..........................................--------------------..-------------
Mpf_ENSMPUP00000003318 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017175 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016038 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016192 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015325 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000660 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005493 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009754 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013796 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010667 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013126 ..........................................----S---------------..-------------
Mpf_ENSMPUP00000018046 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006359 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015086 ..........................................--------------------..---GQLKKYPEKL
Mpf_ENSMPUP00000008387 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015207 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004217 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015689 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015159 ..........................................--------------------..-------------
Mpf_ENSMPUP00000018833 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007866 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007938 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010694 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013131 ..........................................--------------------..-------------
Mpf_ENSMPUP00000000312 ..........................................--------------------..-------------
Mpf_ENSMPUP00000019132 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015959 ..........................................--------------------..------PL-HPSL
Mpf_ENSMPUP00000012612 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007938 ..........................................--------------------..----------P--
Mpf_ENSMPUP00000007989 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016156 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013721 ..........................................--------------------..-----W-------
Mpf_ENSMPUP00000005447 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015768 ..........................................--------------------..-------------
Mpf_ENSMPUP00000004215 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010108 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002188 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013446 ..........................................--------------------..-------------
Mpf_ENSMPUP00000012407 ..........................................--------------------..-------------
Mpf_ENSMPUP00000017043 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007898 ..........................................--------------------..----------P--
Mpf_ENSMPUP00000017064 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009754 ..........................................--------------------..T------------
Mpf_ENSMPUP00000016461 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008230 ..........................................--------------------..-------------
Mpf_ENSMPUP00000001993 ..........................................--------------------..-------------
Mpf_ENSMPUP00000014500 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002405 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002933 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007268 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010983 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010498 ..........................................--------------------..-----L-------
Mpf_ENSMPUP00000018101 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002033 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010694 ..........................................--------------------..-------------
Mpf_ENSMPUP00000008353 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009754 ..........................................--------------------..-------------
Mpf_ENSMPUP00000015718 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002358 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005077 ..........................................--------------------..------------I
Mpf_ENSMPUP00000009107 ..........................................-----C--------------..-------------
Mpf_ENSMPUP00000016101 .....................................vaqdw--------------------..-------------
Mpf_ENSMPUP00000011911 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007938 ..........................................--------------------..-------------
Mpf_ENSMPUP00000009676 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005809 ..........................................--------------------..-------------
Mpf_ENSMPUP00000016410 ..........................................--------------------..-------------
Mpf_ENSMPUP00000006638 ..........................................--------------------..-------------
Mpf_ENSMPUP00000005803 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010983 ..........................................-----------------LMN..SWKRRWCV-----
Mpf_ENSMPUP00000000717 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002793 ..........................................--------------------..-------------
Mpf_ENSMPUP00000007833 ..........................................--------------------..-------------
Mpf_ENSMPUP00000002271 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010974 ..........................................--------------------..-------------
Mpf_ENSMPUP00000010755 ..........................................--------------------..-------------
Mpf_ENSMPUP00000013112 ..........................................--------------------..-------------


                                   40         50                                                    
                                    |          |                                                    
d1shca_                M.......GPGVSY.LVRYMGCVEVLQSMRALDF...........................................
Mpf_ENSMPUP00000000236 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001054 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001986 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006133 M.......GPGVSY.LVRYMGCVEVLQSMRALDF...........................................
Mpf_ENSMPUP00000009494 L.......IDGIIF.AANYLGSTQLLSD-KTPSK...........................................
Mpf_ENSMPUP00000004093 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012215 L.......GMGMNY.YVRYMGCIEVLQSMRSLDF...........................................
Mpf_ENSMPUP00000016175 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009909 L.......GPGVSY.IVRYMGCIEILRSMRSLDF...........................................
Mpf_ENSMPUP00000010977 L.......IDGIIF.AANYLGSTQLLSE-RNPSK...........................................
Mpf_ENSMPUP00000016638 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018612 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018966 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004660 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002149 -.......------.-------L-----------...........................................
Mpf_ENSMPUP00000018066 L.......KQGAAC.NVWYLNSVEMESL------...........................................
Mpf_ENSMPUP00000017958 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011450 -.......------.--------VLDRK------...........................................
Mpf_ENSMPUP00000016402 L.......KQGAAC.NVLFVNSVDMESL------...........................................
Mpf_ENSMPUP00000004951 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011363 I.......FQSCDY.KAFYLGSMLIKEL------...........................................
Mpf_ENSMPUP00000015445 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015195 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011751 -.......------.------------Q------...........................................
Mpf_ENSMPUP00000009831 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004111 L.......LDGVIF.GAKYLGSTQLVSE-RNPPP...........................................
Mpf_ENSMPUP00000005349 -.......------.------V------------...........................................
Mpf_ENSMPUP00000006137 L.......RQGAAC.SVLYLTSVETESL------...........................................
Mpf_ENSMPUP00000009095 -.......------.------M------------...........................................
Mpf_ENSMPUP00000005832 -.......------.R------------------...........................................
Mpf_ENSMPUP00000014567 -.......----GC.HALYLTSVSVETL------...........................................
Mpf_ENSMPUP00000015198 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008441 -.......------.-------------MRSLDF...........................................
Mpf_ENSMPUP00000005146 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010667 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000642 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015373 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003213 I.......FESCGY.EANYLGSMLIKDL------...........................................
Mpf_ENSMPUP00000012196 L.......QHEIKY.LRKFLGSTEVEQP------...........................................
Mpf_ENSMPUP00000012194 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003212 I.......FESCGY.EANYLGSMLIKDL------...........................................
Mpf_ENSMPUP00000001158 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010667 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013386 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016712 -.......------.------------L------...........................................
Mpf_ENSMPUP00000003302 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003768 R.......TGKCSF.PVKYLGHVEVDES------...........................................
Mpf_ENSMPUP00000008012 -.......------.------TFCLGEE------...........................................
Mpf_ENSMPUP00000002625 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010667 -.......------.---------------EVNG...........................................
Mpf_ENSMPUP00000006140 L.......--VQKF.HVQYLGMLPVDKP------...........................................
Mpf_ENSMPUP00000015670 L.......-EGMLF.SLKYLGMTLVEQP------...........................................
Mpf_ENSMPUP00000008341 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017573 R.......KGTCSF.PVRYLGHVEVEES------...........................................
Mpf_ENSMPUP00000012859 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012131 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000172 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013200 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003522 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011499 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011494 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012716 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002913 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003504 L.......------.--CYFGSEECKEK------...........................................
Mpf_ENSMPUP00000004361 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017389 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015829 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003644 -.......------.------THKVQDP------...........................................
Mpf_ENSMPUP00000006376 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014536 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011501 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017670 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006727 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000961 -.......------.KFRYCGRTEVQSV------...........................................
Mpf_ENSMPUP00000004942 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002151 -.......FKRKHF.LIKLHANILVLCK-DTLEF...........................................
Mpf_ENSMPUP00000014680 -.......GDGVKY.KAKLIGIDDVPDA------...........................................
Mpf_ENSMPUP00000005563 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011333 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000969 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010395 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015361 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001991 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005637 MaaltknsDWVDQF.RVKFLGSVQVPYH------...........................................
Mpf_ENSMPUP00000007307 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008193 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007177 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010360 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010611 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007161 -.......---M--.-------------------...........................................
Mpf_ENSMPUP00000006134 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004983 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001920 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013542 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008337 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013626 -.......------.-----------------K-...........................................
Mpf_ENSMPUP00000001949 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017721 -.......--R---.-------------------...........................................
Mpf_ENSMPUP00000001109 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001935 LlgskrspCWVERF.DVQFLGSVEVPCH------...........................................
Mpf_ENSMPUP00000006252 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005676 N.......PGIKCF.AVRSLGWVEMTEE--ELAP...........................................
Mpf_ENSMPUP00000005196 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012589 K.......FGSMSY.KHRYSGRTAL---------...........................................
Mpf_ENSMPUP00000010571 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011589 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005676 L.......--VQKF.QVYYLGNVPVAKP------...........................................
Mpf_ENSMPUP00000002533 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004215 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013399 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010530 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006089 -.......------.-M-----------------...........................................
Mpf_ENSMPUP00000016498 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007327 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001749 K.......GDNRKF.EIWYAGKEEVY--------...........................................
Mpf_ENSMPUP00000016475 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013206 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006140 -.......PEAKCF.AVRSLGWVEMAEE--DLAP...........................................
Mpf_ENSMPUP00000005780 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001869 -.......------.---Y---------------...........................................
Mpf_ENSMPUP00000012475 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008316 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001167 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008230 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017717 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010272 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003964 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017478 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010168 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009546 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002870 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000151 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000216 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007012 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012096 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004281 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004460 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011499 I.......HKDYVF.KLHFKSHVYYFRAESEYTF...........................................
Mpf_ENSMPUP00000003498 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006723 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006149 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011052 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015653 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014937 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006713 -.......------.---YKGHIPCSSL------...........................................
Mpf_ENSMPUP00000005370 -.......------.-VYYVGENVVNPS------...........................................
Mpf_ENSMPUP00000017142 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011052 E.......GDPCKF.A-LWVGRTPTSD-------...........................................
Mpf_ENSMPUP00000000930 -.......------.--------EVHDP------...........................................
Mpf_ENSMPUP00000016865 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000090 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012035 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009068 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000172 L.......------.-------------------...........................................
Mpf_ENSMPUP00000013402 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012726 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010329 -.......K-----.-------------------...........................................
Mpf_ENSMPUP00000005886 D.......TFAKKF.EVLFCGRVTVAHKKAPPALideciekfkhvsgrrraefdvgsprsesprpaagpslpervpp
Mpf_ENSMPUP00000011911 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013895 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009754 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017452 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004281 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017577 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004977 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017884 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007027 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012725 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000871 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006220 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008418 S.......QAAQKY.EALYMGTLPVNKA------...........................................
Mpf_ENSMPUP00000003932 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001861 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008418 -.......-GAKCF.AVHSLGWVEVPEE--DLVP...........................................
Mpf_ENSMPUP00000006249 -.......----M-.-------------------...........................................
Mpf_ENSMPUP00000003836 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015858 -.......------.-----G-------------...........................................
Mpf_ENSMPUP00000002835 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004473 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000137 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001907 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014024 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001742 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000172 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005480 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018515 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009502 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013672 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011336 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001410 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003424 -.......------.---Y---------------...........................................
Mpf_ENSMPUP00000007040 -.......------.-------------------...........................................
Mpf_ENSMPUP00000019493 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018830 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003141 F.......YNSQKF.EVLYCGKVTVTHKKAPSSLiddciekfslheqqrlkiqgeqrgadagddpgvfeatapcpaa
Mpf_ENSMPUP00000010983 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010498 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012786 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014114 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007256 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005608 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002033 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016751 S.......ILHQLF.IVRFLGSMEVKSD------...........................................
Mpf_ENSMPUP00000016435 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001167 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001585 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002351 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011499 -.......---V--.-------------------...........................................
Mpf_ENSMPUP00000005375 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015986 -.......------.-AQYVGSFPVDDL------...........................................
Mpf_ENSMPUP00000004747 -.......------.KLTYLGCMKVSSP------...........................................
Mpf_ENSMPUP00000009754 -.......------.----------------E--...........................................
Mpf_ENSMPUP00000002257 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006734 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003502 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011019 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003673 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000383 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008997 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010040 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007257 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016774 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001960 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007610 F.......DPNCCF.S------------------...........................................
Mpf_ENSMPUP00000017612 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007907 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014021 D.......EDSVVFsKLTYLGCASVNAP------...........................................
Mpf_ENSMPUP00000008982 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005803 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002728 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007017 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003752 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001306 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005338 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001689 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010415 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006220 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016350 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018773 -.......-EDPTY.TVLYLGNATTIQA------...........................................
Mpf_ENSMPUP00000017599 -.......--PNTF.VIRCLQWTTVIERTFHVDS...........................................
Mpf_ENSMPUP00000016349 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015036 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007938 -.......------.-----------------P-...........................................
Mpf_ENSMPUP00000007257 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005203 -.......------.--LYMNLQPVLRHIRKLEE...........................................
Mpf_ENSMPUP00000000650 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007937 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007017 -.......------.----------------L--...........................................
Mpf_ENSMPUP00000012780 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002522 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004905 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011326 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009449 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000014 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012737 -.......------.---------------EIDL...........................................
Mpf_ENSMPUP00000002136 Mkter...PRPNTF.IIRCLQWTTVIERTFHVET...........................................
Mpf_ENSMPUP00000017782 -.......------.----H--------------...........................................
Mpf_ENSMPUP00000013550 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017362 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006996 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004785 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014164 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016592 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000486 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003712 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006850 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015574 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014962 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016814 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000139 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012020 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006069 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017142 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013991 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010353 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000014 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009546 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012020 S.......LLQQMF.IVRFLGSMAVKTD------...........................................
Mpf_ENSMPUP00000016751 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000216 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010854 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016813 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002870 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003651 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002370 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006780 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002802 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011336 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003120 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005803 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004980 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015621 -.......--PNTF.IIRCLQWTTVIERTFHVDT...........................................
Mpf_ENSMPUP00000003141 -.......--DKRF.RLWYVGGSCLDRR------...........................................
Mpf_ENSMPUP00000013099 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010983 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004910 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016233 -.......--LTSY.RVIFVTSHTVNDSMCSF--...........................................
Mpf_ENSMPUP00000002953 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011716 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007767 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014585 -.......------.------S------------...........................................
Mpf_ENSMPUP00000014164 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005886 -.......-PSVDF.SLQLVGSLPVHSL------...........................................
Mpf_ENSMPUP00000013797 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004108 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009167 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016226 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014024 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008448 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010607 -.......------.VVGYLGSIELPSTSCNL-E...........................................
Mpf_ENSMPUP00000015774 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008639 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012941 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016218 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007001 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001986 -.......------.WVTLKGCTLLFYE------...........................................
Mpf_ENSMPUP00000010415 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003836 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007027 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002688 -.......------.------------------Y...........................................
Mpf_ENSMPUP00000001373 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013700 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016589 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015325 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001960 -.......------.----VGC------------...........................................
Mpf_ENSMPUP00000006310 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016747 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013323 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007350 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017588 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007745 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006409 -.......------.-----G-------------...........................................
Mpf_ENSMPUP00000015574 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008365 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001054 -.......------.---SLGDAFLFQT------...........................................
Mpf_ENSMPUP00000017488 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005234 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013182 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011513 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005385 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009077 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001767 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007827 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000541 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001809 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005803 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013182 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005315 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014585 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015166 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002409 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005807 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013796 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017782 -.......------.-------------------...........................................
Mpf_ENSMPUP00000019464 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012725 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010996 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007938 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009654 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005385 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006310 -.......------.-------E-----------...........................................
Mpf_ENSMPUP00000007963 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002310 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000486 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007805 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010246 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004460 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014791 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003154 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005214 -.......------.-------------------...........................................
Mpf_ENSMPUP00000003932 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008710 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005632 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002828 -.......------.---------I---------...........................................
Mpf_ENSMPUP00000017859 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013754 -.......------.------------G------...........................................
Mpf_ENSMPUP00000004548 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000646 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004473 -.......------.--------S----------...........................................
Mpf_ENSMPUP00000000402 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007412 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004935 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011513 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001759 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008353 -.......----RF.ELVFSGRKLALRASSQDEA...........................................
Mpf_ENSMPUP00000012083 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006956 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014860 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009647 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005803 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005109 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006149 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001981 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017916 S.......------.-------------------...........................................
Mpf_ENSMPUP00000003318 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017175 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016038 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016192 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015325 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000660 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005493 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009754 -.......------.----------H--------...........................................
Mpf_ENSMPUP00000013796 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010667 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013126 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018046 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006359 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015086 I.......IHCKDL.RVFHFGLRYTKEE------...........................................
Mpf_ENSMPUP00000008387 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015207 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004217 -.......------.KVTYLGKVPT---------...........................................
Mpf_ENSMPUP00000015689 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015159 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018833 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007866 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007938 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010694 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013131 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000312 -.......------.-------------------...........................................
Mpf_ENSMPUP00000019132 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015959 L.......EEPHCF.QVTWTGG------------...........................................
Mpf_ENSMPUP00000012612 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007938 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007989 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016156 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013721 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005447 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015768 -.......------.-------------------...........................................
Mpf_ENSMPUP00000004215 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010108 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002188 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013446 -.......------.-------------------...........................................
Mpf_ENSMPUP00000012407 -.......------.---YEGFLSVPRP------...........................................
Mpf_ENSMPUP00000017043 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007898 -.......------.-------------------...........................................
Mpf_ENSMPUP00000017064 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009754 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016461 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008230 -.......------.-------------------...........................................
Mpf_ENSMPUP00000001993 -.......------.-------------------...........................................
Mpf_ENSMPUP00000014500 -.......------.------G------------...........................................
Mpf_ENSMPUP00000002405 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002933 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007268 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010983 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010498 -.......------.-------------------...........................................
Mpf_ENSMPUP00000018101 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002033 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010694 -.......------.-------------------...........................................
Mpf_ENSMPUP00000008353 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009754 -.......------.-------------------...........................................
Mpf_ENSMPUP00000015718 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002358 -.......------.---YKGYVKVPKP------...........................................
Mpf_ENSMPUP00000005077 L.......GQDFCF.EVTYLSGSKCFSC------...........................................
Mpf_ENSMPUP00000009107 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016101 -.......------.-------------------...........................................
Mpf_ENSMPUP00000011911 -.......------.-------------------...........................................
Mpf_ENSMPUP00000007938 -.......------.-------------------...........................................
Mpf_ENSMPUP00000009676 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005809 -.......------.-------------------...........................................
Mpf_ENSMPUP00000016410 -.......------.-------------------...........................................
Mpf_ENSMPUP00000006638 -.......------.-------------------...........................................
Mpf_ENSMPUP00000005803 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010983 -.......------.-------------------...........................................
Mpf_ENSMPUP00000000717 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002793 -.......------.------------Y------...........................................
Mpf_ENSMPUP00000007833 -.......------.-------------------...........................................
Mpf_ENSMPUP00000002271 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010974 -.......------.-------------------...........................................
Mpf_ENSMPUP00000010755 -.......------.-------------------...........................................
Mpf_ENSMPUP00000013112 -.......------.-------------------...........................................


                                                                       60        70        80       
                                                                        |         |         |       
d1shca_                .................................................NTRTQVTREAISLVCEAVPGAKGATRRR
Mpf_ENSMPUP00000000236 .................................................----------------------------
Mpf_ENSMPUP00000001054 .................................................R---------------------------
Mpf_ENSMPUP00000001986 .................................................----------------------------
Mpf_ENSMPUP00000006133 .................................................NTRTQVTREAISLVCDAVPGAKGATRRR
Mpf_ENSMPUP00000009494 .................................................NVRMMQAQEAVSRIKMAQKLAKSRKKA-
Mpf_ENSMPUP00000004093 .................................................----------------------------
Mpf_ENSMPUP00000012215 .................................................GMRTQVTREAISRLCEAVSGANGAIKKR
Mpf_ENSMPUP00000016175 .................................................----------------------------
Mpf_ENSMPUP00000009909 .................................................NTRTQVTREAINRLHEAVPGIRGSWKKK
Mpf_ENSMPUP00000010977 .................................................NIRMMQAQEAVSRVKN------------
Mpf_ENSMPUP00000016638 .................................................----------------------------
Mpf_ENSMPUP00000018612 .................................................----------------------------
Mpf_ENSMPUP00000018966 .................................................----------------------------
Mpf_ENSMPUP00000004660 .................................................----------------------------
Mpf_ENSMPUP00000002149 .................................................----------------------------
Mpf_ENSMPUP00000018066 .................................................-TGHQAIQKALSLTLV------------
Mpf_ENSMPUP00000017958 .................................................----------------------------
Mpf_ENSMPUP00000011450 .................................................-DAMITVDDGIRKLKLLD----------
Mpf_ENSMPUP00000016402 .................................................-TGPQAISKATSETLA------------
Mpf_ENSMPUP00000004951 .................................................----------------------------
Mpf_ENSMPUP00000011363 .................................................-RGTESTQDACAKMRA------------
Mpf_ENSMPUP00000015445 .................................................--------N-------------------
Mpf_ENSMPUP00000015195 .................................................----------------------------
Mpf_ENSMPUP00000011751 .................................................----------------------------
Mpf_ENSMPUP00000009831 .................................................----------------------------
Mpf_ENSMPUP00000004111 .................................................STRMAQAREAMDRVKA------------
Mpf_ENSMPUP00000005349 .................................................----------------------------
Mpf_ENSMPUP00000006137 .................................................-TGPQAVARASSAALS------------
Mpf_ENSMPUP00000009095 .................................................----------------------------
Mpf_ENSMPUP00000005832 .................................................----------------------------
Mpf_ENSMPUP00000014567 .................................................-SGALAVRKAISTTFE------------
Mpf_ENSMPUP00000015198 .................................................----------------------------
Mpf_ENSMPUP00000008441 .................................................STRTQITREAISRVCEAVPGAKGAFRKR
Mpf_ENSMPUP00000005146 .................................................----------------------------
Mpf_ENSMPUP00000010667 .................................................---------Q------------------
Mpf_ENSMPUP00000000642 .................................................----------------------------
Mpf_ENSMPUP00000015373 .................................................----------------------------
Mpf_ENSMPUP00000003213 .................................................-RGTESTQDACAKMRKSTE---------
Mpf_ENSMPUP00000012196 .................................................-KGTEVVRDAVRKLKFARHIKK------
Mpf_ENSMPUP00000012194 .................................................----------------------------
Mpf_ENSMPUP00000003212 .................................................-RGTESTQDACAKMRKSTE---------
Mpf_ENSMPUP00000001158 .................................................----------------------------
Mpf_ENSMPUP00000010667 .................................................----------------------------
Mpf_ENSMPUP00000013386 .................................................----------------------------
Mpf_ENSMPUP00000016712 .................................................----------------------------
Mpf_ENSMPUP00000003302 .................................................----------------------------
Mpf_ENSMPUP00000003768 .................................................-RGMHICEDAVKRLKAERKFFKGFFGK-
Mpf_ENSMPUP00000008012 .................................................-DGVHTVEDASRKLAVMDS---------
Mpf_ENSMPUP00000002625 .................................................---------------------E------
Mpf_ENSMPUP00000010667 .................................................KLRMLMRREQVLKVCA------------
Mpf_ENSMPUP00000006140 .................................................-VGMDTLNNAIENLMT------------
Mpf_ENSMPUP00000015670 .................................................-KGEELSAAAVKRIVATAK---------
Mpf_ENSMPUP00000008341 .................................................----------------------------
Mpf_ENSMPUP00000017573 .................................................-RGMHVCEDAVKKLKA------------
Mpf_ENSMPUP00000012859 .................................................----------------------------
Mpf_ENSMPUP00000012131 .................................................----------------------------
Mpf_ENSMPUP00000000172 .................................................----------------------------
Mpf_ENSMPUP00000013200 .................................................----------------------------
Mpf_ENSMPUP00000003522 .................................................----------------------------
Mpf_ENSMPUP00000011499 .................................................----------------------------
Mpf_ENSMPUP00000011494 .................................................----------------------------
Mpf_ENSMPUP00000012716 .................................................------------D---------------
Mpf_ENSMPUP00000002913 .................................................----------------------------
Mpf_ENSMPUP00000003504 .................................................-R--------------------------
Mpf_ENSMPUP00000004361 .................................................----------------------------
Mpf_ENSMPUP00000017389 .................................................----------------------------
Mpf_ENSMPUP00000015829 .................................................----------------------------
Mpf_ENSMPUP00000003644 .................................................-------RDALRKLQEMDA---------
Mpf_ENSMPUP00000006376 .................................................----------------------------
Mpf_ENSMPUP00000014536 .................................................--------------W-------------
Mpf_ENSMPUP00000011501 .................................................----------------------------
Mpf_ENSMPUP00000017670 .................................................----------------------------
Mpf_ENSMPUP00000006727 .................................................----------------------------
Mpf_ENSMPUP00000000961 .................................................----------------------------
Mpf_ENSMPUP00000004942 .................................................----------A-----------------
Mpf_ENSMPUP00000002151 .................................................TMASRDACKAFWKTCVEYHAFFRLSEEP
Mpf_ENSMPUP00000014680 .................................................-RGDKMSQDSMMKLKGMAAA--------
Mpf_ENSMPUP00000005563 .................................................---------------A------------
Mpf_ENSMPUP00000011333 .................................................----------------------------
Mpf_ENSMPUP00000000969 .................................................----------------------------
Mpf_ENSMPUP00000010395 .................................................----------------------------
Mpf_ENSMPUP00000015361 .................................................----------------------------
Mpf_ENSMPUP00000001991 .................................................--------------------------K-
Mpf_ENSMPUP00000005637 .................................................-KGNDVLCAAMQKIATTRRLTV------
Mpf_ENSMPUP00000007307 .................................................----------------------------
Mpf_ENSMPUP00000008193 .................................................------VLECMLKK--------------
Mpf_ENSMPUP00000007177 .................................................----------------------------
Mpf_ENSMPUP00000010360 .................................................----------------------------
Mpf_ENSMPUP00000010611 .................................................--------E-------------------
Mpf_ENSMPUP00000007161 .................................................----------------------------
Mpf_ENSMPUP00000006134 .................................................----------------------------
Mpf_ENSMPUP00000004983 .................................................----------------------------
Mpf_ENSMPUP00000001920 .................................................----------------------------
Mpf_ENSMPUP00000013542 .................................................----------------------------
Mpf_ENSMPUP00000008337 .................................................----------------------------
Mpf_ENSMPUP00000013626 .................................................----------------------------
Mpf_ENSMPUP00000001949 .................................................-----E----------------------
Mpf_ENSMPUP00000017721 .................................................----------------------------
Mpf_ENSMPUP00000001109 .................................................----------------------------
Mpf_ENSMPUP00000001935 .................................................-QGNGILCAAMQKIATARKLTV------
Mpf_ENSMPUP00000006252 .................................................----------------------------
Mpf_ENSMPUP00000005676 .................................................GRSSVAVNNCIRQLSYHKNNLHDPM---
Mpf_ENSMPUP00000005196 .................................................----------------------------
Mpf_ENSMPUP00000012589 .................................................----------------------------
Mpf_ENSMPUP00000010571 .................................................----------------------------
Mpf_ENSMPUP00000011589 .................................................----------------------------
Mpf_ENSMPUP00000005676 .................................................-VGVDVINGALESVLS------------
Mpf_ENSMPUP00000002533 .................................................----------------------------
Mpf_ENSMPUP00000004215 .................................................----------------------------
Mpf_ENSMPUP00000013399 .................................................----------------------------
Mpf_ENSMPUP00000010530 .................................................----------------------------
Mpf_ENSMPUP00000006089 .................................................----------------------------
Mpf_ENSMPUP00000016498 .................................................----------------------------
Mpf_ENSMPUP00000007327 .................................................----------------------------
Mpf_ENSMPUP00000001749 .................................................----------------------------
Mpf_ENSMPUP00000016475 .................................................----------------------------
Mpf_ENSMPUP00000013206 .................................................----------------------------
Mpf_ENSMPUP00000006140 .................................................GKSSVAVNNCIRQLSY------------
Mpf_ENSMPUP00000005780 .................................................----------------------------
Mpf_ENSMPUP00000001869 .................................................----------------------------
Mpf_ENSMPUP00000012475 .................................................----------------------------
Mpf_ENSMPUP00000008316 .................................................----------------------------
Mpf_ENSMPUP00000001167 .................................................----------------------------
Mpf_ENSMPUP00000008230 .................................................----------------------------
Mpf_ENSMPUP00000017717 .................................................----------------------------
Mpf_ENSMPUP00000010272 .................................................----------------------------
Mpf_ENSMPUP00000003964 .................................................----------------------------
Mpf_ENSMPUP00000017478 .................................................---W------------------------
Mpf_ENSMPUP00000010168 .................................................----------------------------
Mpf_ENSMPUP00000009546 .................................................----------------------------
Mpf_ENSMPUP00000002870 .................................................------K---------------------
Mpf_ENSMPUP00000000151 .................................................----------------------------
Mpf_ENSMPUP00000000216 .................................................----------------------------
Mpf_ENSMPUP00000007012 .................................................----------------------------
Mpf_ENSMPUP00000012096 .................................................----------------------------
Mpf_ENSMPUP00000004281 .................................................----------------------------
Mpf_ENSMPUP00000004460 .................................................----------------------------
Mpf_ENSMPUP00000011499 .................................................ERWMEVIR--------------------
Mpf_ENSMPUP00000003498 .................................................----------------------------
Mpf_ENSMPUP00000006723 .................................................----LALRHAICEIAANYKKKKHVF---
Mpf_ENSMPUP00000006149 .................................................----------------------------
Mpf_ENSMPUP00000011052 .................................................---------------E------------
Mpf_ENSMPUP00000015653 .................................................----------------------------
Mpf_ENSMPUP00000014937 .................................................----I-----------------------
Mpf_ENSMPUP00000006713 .................................................-MLIESTRDS------------------
Mpf_ENSMPUP00000005370 .................................................----------------------------
Mpf_ENSMPUP00000017142 .................................................--------------Q-------------
Mpf_ENSMPUP00000011052 .................................................----------------------------
Mpf_ENSMPUP00000000930 .................................................-R--------------------------
Mpf_ENSMPUP00000016865 .................................................----------------------------
Mpf_ENSMPUP00000000090 .................................................----------------------------
Mpf_ENSMPUP00000012035 .................................................----------------------------
Mpf_ENSMPUP00000009068 .................................................-RDMEDWVQAIR----------------
Mpf_ENSMPUP00000000172 .................................................----------------------------
Mpf_ENSMPUP00000013402 .................................................----------------------------
Mpf_ENSMPUP00000012726 .................................................----------------------------
Mpf_ENSMPUP00000010329 .................................................----------------------------
Mpf_ENSMPUP00000005886 .....................................gppagdgepgrgPMRKSFSQPGLRSLAFRKEFQDGSLRSR
Mpf_ENSMPUP00000011911 .................................................----------------------------
Mpf_ENSMPUP00000013895 .................................................----------------------------
Mpf_ENSMPUP00000009754 .................................................-S--------------------------
Mpf_ENSMPUP00000017452 .................................................-------------------------KRK
Mpf_ENSMPUP00000004281 .................................................----------------------------
Mpf_ENSMPUP00000017577 .................................................---------A------------------
Mpf_ENSMPUP00000004977 .................................................----------------------------
Mpf_ENSMPUP00000017884 .................................................----------------------------
Mpf_ENSMPUP00000007027 .................................................----------------------------
Mpf_ENSMPUP00000012725 .................................................----------------------------
Mpf_ENSMPUP00000000871 .................................................----------------------------
Mpf_ENSMPUP00000006220 .................................................-------------S--------------
Mpf_ENSMPUP00000008418 .................................................-MGMDVLNEAIGTLTT------------
Mpf_ENSMPUP00000003932 .................................................----------------------------
Mpf_ENSMPUP00000001861 .................................................----------------------------
Mpf_ENSMPUP00000008418 .................................................GKSSIAVNNCIQQLAQTRS---------
Mpf_ENSMPUP00000006249 .................................................----------------------------
Mpf_ENSMPUP00000003836 .................................................----------------------------
Mpf_ENSMPUP00000015858 .................................................----------------------------
Mpf_ENSMPUP00000002835 .................................................----------------------------
Mpf_ENSMPUP00000004473 .................................................----------------------------
Mpf_ENSMPUP00000000137 .................................................----------------------------
Mpf_ENSMPUP00000001907 .................................................----------------------------
Mpf_ENSMPUP00000014024 .................................................---IQACQAAIDQIEKRN----------
Mpf_ENSMPUP00000001742 .................................................----------------------------
Mpf_ENSMPUP00000000172 .................................................----------------------------
Mpf_ENSMPUP00000005480 .................................................-----V----------------------
Mpf_ENSMPUP00000018515 .................................................----------------------------
Mpf_ENSMPUP00000009502 .................................................----------------------------
Mpf_ENSMPUP00000013672 .................................................----------------------------
Mpf_ENSMPUP00000011336 .................................................-------------L--------------
Mpf_ENSMPUP00000001410 .................................................----------------------------
Mpf_ENSMPUP00000003424 .................................................----------------------------
Mpf_ENSMPUP00000007040 .................................................----------------------------
Mpf_ENSMPUP00000019493 .................................................----------------------------
Mpf_ENSMPUP00000018830 .................................................----------------------------
Mpf_ENSMPUP00000003141 dilaeegdgvpdilptlpatasqpglpssragfperiledsgfdeqqefRSRCSSVTGVLQKKVHENSQKPLPRRRH
Mpf_ENSMPUP00000010983 .................................................----------------------------
Mpf_ENSMPUP00000010498 .................................................----------------------------
Mpf_ENSMPUP00000012786 .................................................-----------S----------------
Mpf_ENSMPUP00000014114 .................................................-------------------------NAF
Mpf_ENSMPUP00000007256 .................................................----------------------------
Mpf_ENSMPUP00000005608 .................................................----------------------------
Mpf_ENSMPUP00000002033 .................................................----------------------------
Mpf_ENSMPUP00000016751 .................................................-DNPDVVYETMRQILAARA---------
Mpf_ENSMPUP00000016435 .................................................------------T---------------
Mpf_ENSMPUP00000001167 .................................................---------C------------------
Mpf_ENSMPUP00000001585 .................................................----------------------------
Mpf_ENSMPUP00000002351 .................................................----------------------------
Mpf_ENSMPUP00000011499 .................................................----------------------------
Mpf_ENSMPUP00000005375 .................................................----------------------------
Mpf_ENSMPUP00000015986 .................................................-----DTQESVWLVQQQLWALK------
Mpf_ENSMPUP00000004747 .................................................-RNEVEALRAMATMKS------------
Mpf_ENSMPUP00000009754 .................................................----------------------------
Mpf_ENSMPUP00000002257 .................................................------VHNGIRTLVLRFP---------
Mpf_ENSMPUP00000006734 .................................................----------------------------
Mpf_ENSMPUP00000003502 .................................................----------------------------
Mpf_ENSMPUP00000011019 .................................................---------C------------------
Mpf_ENSMPUP00000003673 .................................................----------------------------
Mpf_ENSMPUP00000000383 .................................................----------------------------
Mpf_ENSMPUP00000008997 .................................................---------------A------------
Mpf_ENSMPUP00000010040 .................................................----------------------------
Mpf_ENSMPUP00000007257 .................................................----------------------------
Mpf_ENSMPUP00000016774 .................................................-----------S----------------
Mpf_ENSMPUP00000001960 .................................................----------------------------
Mpf_ENSMPUP00000007610 .................................................----------------------------
Mpf_ENSMPUP00000017612 .................................................----------------------------
Mpf_ENSMPUP00000007907 .................................................----------I-----------------
Mpf_ENSMPUP00000014021 .................................................-RSEVEALRMMSILRS------------
Mpf_ENSMPUP00000008982 .................................................----------------------------
Mpf_ENSMPUP00000005803 .................................................----------------------------
Mpf_ENSMPUP00000002728 .................................................------------K---------------
Mpf_ENSMPUP00000007017 .................................................----------------------------
Mpf_ENSMPUP00000003752 .................................................----------------------------
Mpf_ENSMPUP00000001306 .................................................----------------------------
Mpf_ENSMPUP00000005338 .................................................----------------------------
Mpf_ENSMPUP00000001689 .................................................--G-------------------------
Mpf_ENSMPUP00000010415 .................................................----------------------------
Mpf_ENSMPUP00000006220 .................................................----------------------------
Mpf_ENSMPUP00000016350 .................................................----------------------------
Mpf_ENSMPUP00000018773 .................................................-RGDGCTDLAVGKIWS------------
Mpf_ENSMPUP00000017599 .................................................PDEREEWMRAIQMVA-------------
Mpf_ENSMPUP00000016349 .................................................----------------------------
Mpf_ENSMPUP00000015036 .................................................-----------------------E----
Mpf_ENSMPUP00000007938 .................................................----------------------------
Mpf_ENSMPUP00000007257 .................................................----------------------------
Mpf_ENSMPUP00000005203 .................................................----------------------------
Mpf_ENSMPUP00000000650 .................................................----------------------------
Mpf_ENSMPUP00000007937 .................................................----------------------------
Mpf_ENSMPUP00000007017 .................................................----------------------------
Mpf_ENSMPUP00000012780 .................................................---------------------KGYQRRW
Mpf_ENSMPUP00000002522 .................................................----------------------------
Mpf_ENSMPUP00000004905 .................................................------------K---------------
Mpf_ENSMPUP00000011326 .................................................----------------------------
Mpf_ENSMPUP00000009449 .................................................----------------------------
Mpf_ENSMPUP00000000014 .................................................------T---------------------
Mpf_ENSMPUP00000012737 .................................................RSCTDVTEYAVQRNYG------------
Mpf_ENSMPUP00000002136 .................................................PEEREEWTTAIQTVAD------------
Mpf_ENSMPUP00000017782 .................................................----------------------------
Mpf_ENSMPUP00000013550 .................................................----------------------------
Mpf_ENSMPUP00000017362 .................................................----------------------------
Mpf_ENSMPUP00000006996 .................................................----------------------------
Mpf_ENSMPUP00000004785 .................................................----------------------------
Mpf_ENSMPUP00000014164 .................................................----------------------------
Mpf_ENSMPUP00000016592 .................................................----------------------------
Mpf_ENSMPUP00000000486 .................................................----------------------------
Mpf_ENSMPUP00000003712 .................................................----------------------------
Mpf_ENSMPUP00000006850 .................................................------------E---------------
Mpf_ENSMPUP00000015574 .................................................----------------------------
Mpf_ENSMPUP00000014962 .................................................----------------------------
Mpf_ENSMPUP00000016814 .................................................------LLEGPVRVKE------------
Mpf_ENSMPUP00000000139 .................................................----------------------------
Mpf_ENSMPUP00000012020 .................................................----------------------------
Mpf_ENSMPUP00000006069 .................................................----------------------------
Mpf_ENSMPUP00000017142 .................................................-A--------------------------
Mpf_ENSMPUP00000013991 .................................................----------------------------
Mpf_ENSMPUP00000010353 .................................................----------------------------
Mpf_ENSMPUP00000000014 .................................................----------------------------
Mpf_ENSMPUP00000009546 .................................................----------------------------
Mpf_ENSMPUP00000012020 .................................................-NTTEVIYEAMRQVLAARA---------
Mpf_ENSMPUP00000016751 .................................................----------------------------
Mpf_ENSMPUP00000000216 .................................................----------------------------
Mpf_ENSMPUP00000010854 .................................................----------------------------
Mpf_ENSMPUP00000016813 .................................................----------------------------
Mpf_ENSMPUP00000002870 .................................................----------------------------
Mpf_ENSMPUP00000003651 .................................................----------------------------
Mpf_ENSMPUP00000002370 .................................................----------------------------
Mpf_ENSMPUP00000006780 .................................................----------------------------
Mpf_ENSMPUP00000002802 .................................................----------------------------
Mpf_ENSMPUP00000011336 .................................................----------------------------
Mpf_ENSMPUP00000003120 .................................................----------------------------
Mpf_ENSMPUP00000005803 .................................................----------------------------
Mpf_ENSMPUP00000004980 .................................................----------------------------
Mpf_ENSMPUP00000015621 .................................................PEEREEWTEAIQAVAD------------
Mpf_ENSMPUP00000003141 .................................................------------TTLPMLPWLMAEIRRR
Mpf_ENSMPUP00000013099 .................................................----------------------------
Mpf_ENSMPUP00000010983 .................................................----------------------------
Mpf_ENSMPUP00000004910 .................................................----------------------------
Mpf_ENSMPUP00000016233 .................................................----------------------------
Mpf_ENSMPUP00000002953 .................................................----------------------------
Mpf_ENSMPUP00000011716 .................................................----------------------------
Mpf_ENSMPUP00000007767 .................................................-DRETLVSQCRDTLCVTKNWLSADTK--
Mpf_ENSMPUP00000014585 .................................................----------------------------
Mpf_ENSMPUP00000014164 .................................................----------------------------
Mpf_ENSMPUP00000005886 .................................................------------TTMPMLPWVVAEVRRL
Mpf_ENSMPUP00000013797 .................................................----------------------------
Mpf_ENSMPUP00000004108 .................................................--------A-------------------
Mpf_ENSMPUP00000009167 .................................................------------------------M---
Mpf_ENSMPUP00000016226 .................................................----------------------------
Mpf_ENSMPUP00000014024 .................................................------------------P---------
Mpf_ENSMPUP00000008448 .................................................----------------------------
Mpf_ENSMPUP00000010607 .................................................SDSLQAIRGCLRRLRAEQ----------
Mpf_ENSMPUP00000015774 .................................................----------------------------
Mpf_ENSMPUP00000008639 .................................................----------------------------
Mpf_ENSMPUP00000012941 .................................................----------------------------
Mpf_ENSMPUP00000016218 .................................................----------------------------
Mpf_ENSMPUP00000007001 .................................................----------------------------
Mpf_ENSMPUP00000001986 .................................................----------------------------
Mpf_ENSMPUP00000010415 .................................................----------------------------
Mpf_ENSMPUP00000003836 .................................................----------------------------
Mpf_ENSMPUP00000007027 .................................................----------D-----------------
Mpf_ENSMPUP00000002688 .................................................----------------------------
Mpf_ENSMPUP00000001373 .................................................----------------------------
Mpf_ENSMPUP00000013700 .................................................----------------------------
Mpf_ENSMPUP00000016589 .................................................----------------------------
Mpf_ENSMPUP00000015325 .................................................------------------------L---
Mpf_ENSMPUP00000001960 .................................................----------------------------
Mpf_ENSMPUP00000006310 .................................................----------------------------
Mpf_ENSMPUP00000016747 .................................................----------------------------
Mpf_ENSMPUP00000013323 .................................................----------------------------
Mpf_ENSMPUP00000007350 .................................................----------------------------
Mpf_ENSMPUP00000017588 .................................................--GADKIEGA------------------
Mpf_ENSMPUP00000007745 .................................................----------------------------
Mpf_ENSMPUP00000006409 .................................................----------------------------
Mpf_ENSMPUP00000015574 .................................................----------------------T-----
Mpf_ENSMPUP00000008365 .................................................----------------------------
Mpf_ENSMPUP00000001054 .................................................----------------------------
Mpf_ENSMPUP00000017488 .................................................----------------------------
Mpf_ENSMPUP00000005234 .................................................----------------------------
Mpf_ENSMPUP00000013182 .................................................----------------------------
Mpf_ENSMPUP00000011513 .................................................--------------T-------------
Mpf_ENSMPUP00000005385 .................................................----------------------------
Mpf_ENSMPUP00000009077 .................................................----------------------------
Mpf_ENSMPUP00000001767 .................................................----------------------------
Mpf_ENSMPUP00000007827 .................................................----------------------------
Mpf_ENSMPUP00000000541 .................................................------------D---------------
Mpf_ENSMPUP00000001809 .................................................---------------S------------
Mpf_ENSMPUP00000005803 .................................................-H--------------------------
Mpf_ENSMPUP00000013182 .................................................----------------------------
Mpf_ENSMPUP00000005315 .................................................---------------------K------
Mpf_ENSMPUP00000014585 .................................................----------------------------
Mpf_ENSMPUP00000015166 .................................................----------------------------
Mpf_ENSMPUP00000002409 .................................................---------A------------------
Mpf_ENSMPUP00000005807 .................................................----------------------------
Mpf_ENSMPUP00000013796 .................................................----------------------------
Mpf_ENSMPUP00000017782 .................................................----------------------------
Mpf_ENSMPUP00000019464 .................................................---------------E------------
Mpf_ENSMPUP00000012725 .................................................----------------------------
Mpf_ENSMPUP00000010996 .................................................----------------------------
Mpf_ENSMPUP00000007938 .................................................----------------------------
Mpf_ENSMPUP00000009654 .................................................----------------------------
Mpf_ENSMPUP00000005385 .................................................----------------------------
Mpf_ENSMPUP00000006310 .................................................----------------------------
Mpf_ENSMPUP00000007963 .................................................----------------------------
Mpf_ENSMPUP00000002310 .................................................----------------------------
Mpf_ENSMPUP00000000486 .................................................----------------------------
Mpf_ENSMPUP00000007805 .................................................----------------------------
Mpf_ENSMPUP00000010246 .................................................----------------------------
Mpf_ENSMPUP00000004460 .................................................----------------------------
Mpf_ENSMPUP00000014791 .................................................----------------------------
Mpf_ENSMPUP00000003154 .................................................----------------------------
Mpf_ENSMPUP00000005214 .................................................----------------------------
Mpf_ENSMPUP00000003932 .................................................---F------------------------
Mpf_ENSMPUP00000008710 .................................................----------------------------
Mpf_ENSMPUP00000005632 .................................................----------------------------
Mpf_ENSMPUP00000002828 .................................................----------------------------
Mpf_ENSMPUP00000017859 .................................................----------------------------
Mpf_ENSMPUP00000013754 .................................................----------------------------
Mpf_ENSMPUP00000004548 .................................................---------C------------------
Mpf_ENSMPUP00000000646 .................................................----------------------------
Mpf_ENSMPUP00000004473 .................................................----------------------------
Mpf_ENSMPUP00000000402 .................................................----------------------------
Mpf_ENSMPUP00000007412 .................................................----------------------------
Mpf_ENSMPUP00000004935 .................................................----------------------------
Mpf_ENSMPUP00000011513 .................................................------D---------------------
Mpf_ENSMPUP00000001759 .................................................--------------------------S-
Mpf_ENSMPUP00000008353 .................................................EDWLDRVREALQKCRPQQ----------
Mpf_ENSMPUP00000012083 .................................................----------------------------
Mpf_ENSMPUP00000006956 .................................................--------E-------------------
Mpf_ENSMPUP00000014860 .................................................----------------------------
Mpf_ENSMPUP00000009647 .................................................----------------------------
Mpf_ENSMPUP00000005803 .................................................----------------------------
Mpf_ENSMPUP00000005109 .................................................-------------N--------------
Mpf_ENSMPUP00000006149 .................................................---------------------N------
Mpf_ENSMPUP00000001981 .................................................----------------------------
Mpf_ENSMPUP00000017916 .................................................----------------------------
Mpf_ENSMPUP00000003318 .................................................------T---------------------
Mpf_ENSMPUP00000017175 .................................................----------------------------
Mpf_ENSMPUP00000016038 .................................................----------------------------
Mpf_ENSMPUP00000016192 .................................................----------------------------
Mpf_ENSMPUP00000015325 .................................................----------------------------
Mpf_ENSMPUP00000000660 .................................................----------------------------
Mpf_ENSMPUP00000005493 .................................................----------------------------
Mpf_ENSMPUP00000009754 .................................................----------------------------
Mpf_ENSMPUP00000013796 .................................................----------------------------
Mpf_ENSMPUP00000010667 .................................................----------N-----------------
Mpf_ENSMPUP00000013126 .................................................----------------------------
Mpf_ENSMPUP00000018046 .................................................----------------------------
Mpf_ENSMPUP00000006359 .................................................----------------------------
Mpf_ENSMPUP00000015086 .................................................----------------------------
Mpf_ENSMPUP00000008387 .................................................----------------------------
Mpf_ENSMPUP00000015207 .................................................----------------------------
Mpf_ENSMPUP00000004217 .................................................-TGMQFLSGCTEKPVIELWKKHTLA-R-
Mpf_ENSMPUP00000015689 .................................................----------------------------
Mpf_ENSMPUP00000015159 .................................................----------------------------
Mpf_ENSMPUP00000018833 .................................................----------------------------
Mpf_ENSMPUP00000007866 .................................................----------------------------
Mpf_ENSMPUP00000007938 .................................................----------------------------
Mpf_ENSMPUP00000010694 .................................................-------Q--------------------
Mpf_ENSMPUP00000013131 .................................................----------------------------
Mpf_ENSMPUP00000000312 .................................................----------------------------
Mpf_ENSMPUP00000019132 .................................................----------------------------
Mpf_ENSMPUP00000015959 .................................................-SRCFSCRSAAERDRWIED---------
Mpf_ENSMPUP00000012612 .................................................----------------------------
Mpf_ENSMPUP00000007938 .................................................----------------------------
Mpf_ENSMPUP00000007989 .................................................-Q--------------------------
Mpf_ENSMPUP00000016156 .................................................----------------------------
Mpf_ENSMPUP00000013721 .................................................----------------------------
Mpf_ENSMPUP00000005447 .................................................---------A------------------
Mpf_ENSMPUP00000015768 .................................................------L---------------------
Mpf_ENSMPUP00000004215 .................................................-------------V--------------
Mpf_ENSMPUP00000010108 .................................................----------------------------
Mpf_ENSMPUP00000002188 .................................................----------------------------
Mpf_ENSMPUP00000013446 .................................................----------------------------
Mpf_ENSMPUP00000012407 .................................................----------------------------
Mpf_ENSMPUP00000017043 .................................................----------------------------
Mpf_ENSMPUP00000007898 .................................................----------------------------
Mpf_ENSMPUP00000017064 .................................................----------------------------
Mpf_ENSMPUP00000009754 .................................................----------------------------
Mpf_ENSMPUP00000016461 .................................................----------------------------
Mpf_ENSMPUP00000008230 .................................................--------E-------------------
Mpf_ENSMPUP00000001993 .................................................---------------K------------
Mpf_ENSMPUP00000014500 .................................................----------------------------
Mpf_ENSMPUP00000002405 .................................................GTKCFACRSAAERDKWIENLQ-------
Mpf_ENSMPUP00000002933 .................................................------------R---------------
Mpf_ENSMPUP00000007268 .................................................--KCFSCRSAAERDKWMENLRR------
Mpf_ENSMPUP00000010983 .................................................----------------------------
Mpf_ENSMPUP00000010498 .................................................----------------------------
Mpf_ENSMPUP00000018101 .................................................----------------------------
Mpf_ENSMPUP00000002033 .................................................-----------P----------------
Mpf_ENSMPUP00000010694 .................................................----------------------------
Mpf_ENSMPUP00000008353 .................................................----------------------------
Mpf_ENSMPUP00000009754 .................................................-------I--------------------
Mpf_ENSMPUP00000015718 .................................................-V--------------------------
Mpf_ENSMPUP00000002358 .................................................-TG-------------------------
Mpf_ENSMPUP00000005077 .................................................-------NSAS-----------------
Mpf_ENSMPUP00000009107 .................................................----------------------------
Mpf_ENSMPUP00000016101 .................................................----------C-----------------
Mpf_ENSMPUP00000011911 .................................................-------R--------------------
Mpf_ENSMPUP00000007938 .................................................----------------------------
Mpf_ENSMPUP00000009676 .................................................--------------C-------------
Mpf_ENSMPUP00000005809 .................................................---C------------------------
Mpf_ENSMPUP00000016410 .................................................----------------------------
Mpf_ENSMPUP00000006638 .................................................----------------------------
Mpf_ENSMPUP00000005803 .................................................----------------------------
Mpf_ENSMPUP00000010983 .................................................----------------------------
Mpf_ENSMPUP00000000717 .................................................----------------------------
Mpf_ENSMPUP00000002793 .................................................----------------------------
Mpf_ENSMPUP00000007833 .................................................------------H---------------
Mpf_ENSMPUP00000002271 .................................................----------------------------
Mpf_ENSMPUP00000010974 .................................................----------------------------
Mpf_ENSMPUP00000010755 .................................................----------------------------
Mpf_ENSMPUP00000013112 .................................................----------------------------


                        90       100                 110          120                              1
                         |         |                   |            |                               
d1shca_                KPCSRPLSSILGR..........SNLKFAGMPITLTV...STSSLNLM.......AADCK................Q
Mpf_ENSMPUP00000000236 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001054 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001986 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006133 KPCSRPLSSILGR..........SNLKFAGMPITLTV...STSSLNLM.......AADCK................Q
Mpf_ENSMPUP00000009494 ------------P..........EGESQPMTEVDLFI...STQRIKVL.......NADSQ................E
Mpf_ENSMPUP00000004093 ----I--------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012215 KPPVKFLSTVLGK..........SNLQFSGMNIKLTI...STCSLTLM.......NIDNQ................Q
Mpf_ENSMPUP00000016175 -------------..........--------------...---YIKLE.......DRTSG................E
Mpf_ENSMPUP00000009909 APNK-ALASILGK..........SNLRFAGMSIAVSI...STDGLNLS.......VPATR................Q
Mpf_ENSMPUP00000010977 ------------S..........EGDAQTLTEVDLFI...STQRIKVL.......NADTQ................E
Mpf_ENSMPUP00000016638 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018612 -----C-------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018966 -----C-------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004660 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002149 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018066 -------------..........QEPPPLCTVVHFKV...SAQGITLT.......DNQRKl...............F
Mpf_ENSMPUP00000017958 -------------..........-S------------...--------.......-----................-
Mpf_ENSMPUP00000011450 -------------..........AKGKVWTQDMILQV...DDRAVSLI.......DLESK................N
Mpf_ENSMPUP00000016402 -------------..........ADPTPAATIVHFKV...SAQGITLT.......DNQRKl...............F
Mpf_ENSMPUP00000004951 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011363 --------NCQKS..........TEQMKKVPTIILSV...SYKGVKFI.......DATNK................N
Mpf_ENSMPUP00000015445 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015195 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011751 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009831 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004111 ------------P..........DGETQPMTEVDLFV...STKRVKVL.......TADSQ................E
Mpf_ENSMPUP00000005349 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006137 -------------..........CSPRATPAIVHFKV...SAQGITLT.......DNQRKl...............F
Mpf_ENSMPUP00000009095 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005832 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014567 -------------..........RDVLPTPTVVHFKV...TDQGITLT.......DVQRKv...............F
Mpf_ENSMPUP00000015198 -------------..........--------------...--------.......-----................R
Mpf_ENSMPUP00000008441 KPPSKMLSSILGK..........TNLQFAGMSISLTV...STASLNLR.......TPDSK................Q
Mpf_ENSMPUP00000005146 -------------..........---NKKGTDLWLGV...DALGLNIY.......EKDDKl...............T
Mpf_ENSMPUP00000010667 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000642 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015373 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003213 -------------..........--HMKKIPTIILSI...TYKGVKFI.......DASNK................N
Mpf_ENSMPUP00000012196 -------------..........-SEGQKIPKVELQI...SIYGVKIL.......EPKTK................E
Mpf_ENSMPUP00000012194 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003212 -------------..........--HMKKIPTIILSI...TYKGVKFI.......DASNK................N
Mpf_ENSMPUP00000001158 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010667 ------A------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013386 -------------..........--------------...--------.......-I---................-
Mpf_ENSMPUP00000016712 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003302 -------------..........---NKKGTELWLGV...DALGLNIY.......EHDDKl...............T
Mpf_ENSMPUP00000003768 -------------..........--TGKKAVKAVLWV...SADGLRVV.......DEKTK................D
Mpf_ENSMPUP00000008012 -------------..........-QGRIWAQEMLLRV...SPDHVTLL.......DPISK................E
Mpf_ENSMPUP00000002625 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010667 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006140 -------------..........SSNKEDWPSVNMNV...ADATVTVI.......SEKSEe...............D
Mpf_ENSMPUP00000015670 -------------..........-ASGKKLQKVTLKV...SPRGIILT.......DNITN................Q
Mpf_ENSMPUP00000008341 -------------..........------ASPVILRV...DPKGYYLY.......WTYQS................K
Mpf_ENSMPUP00000017573 -------------..........--MGRKSVKSVLWV...SADGLRVV.......DDKTK................D
Mpf_ENSMPUP00000012859 -------------..........-----SRNLVTLRV...DSNGFFLY.......WTGPN................M
Mpf_ENSMPUP00000012131 --N----------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000172 -------------..........-----EGARINLAV...SHMGVLVF.......QGTTK................I
Mpf_ENSMPUP00000013200 -------------..........---NKKGTELLLGV...DALGLHIY.......DPENRl...............T
Mpf_ENSMPUP00000003522 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011499 -------------..........-----EGTKINLAV...ANTGILVF.......QGFTK................I
Mpf_ENSMPUP00000011494 -------------..........-------------I...TNYRLYLR.......SLETDs...............A
Mpf_ENSMPUP00000012716 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002913 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003504 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004361 -------------..........---------I----...--------.......-----................-
Mpf_ENSMPUP00000017389 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015829 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003644 -------------..........-QGRVWSQDLLLQV...RDGWLQLL.......DIETK................E
Mpf_ENSMPUP00000006376 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014536 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011501 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017670 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006727 -------------..........--------------...---FLRIF.......DIKDG................K
Mpf_ENSMPUP00000000961 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004942 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002151 KSKPK--------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014680 ------------G..........RSQGQHKQRIWVNI...SLSGIKII.......DEKTG................V
Mpf_ENSMPUP00000005563 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011333 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000969 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010395 ----------K--..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015361 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001991 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005637 -------------..........--HFNPPSSCVLEI...SVRGVKIGvkaddsqEAKGN................K
Mpf_ENSMPUP00000007307 -------------..........--------------...-----VVV.......EDDDQ................-
Mpf_ENSMPUP00000008193 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007177 -------------..........-DGKTMLRPV----...----LRLT.......SAITR................E
Mpf_ENSMPUP00000010360 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010611 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007161 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006134 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004983 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001920 K------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013542 -------------..........--------------...------LY.......GLQTG................R
Mpf_ENSMPUP00000008337 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013626 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001949 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017721 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001109 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001935 -------------..........--HLRPPASCDLEI...SLRGVKLSlsg....GPEFQ................H
Mpf_ENSMPUP00000006252 -------------..........--------------...S-------.......-----................-
Mpf_ENSMPUP00000005676 -------------..........SGGWGEGKDLLLQL...EDETLKLV.......EPQSQ................A
Mpf_ENSMPUP00000005196 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012589 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010571 -------------..........--------------...--K-----.......-----................-
Mpf_ENSMPUP00000011589 -------------..........--------RWFVLV...DRCLFYYK.......DEKEE................S
Mpf_ENSMPUP00000005676 -------------..........SSSREQWTPSHVSV...APATLTIL.......HQQTE................A
Mpf_ENSMPUP00000002533 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004215 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013399 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010530 -------------..........-------------L...--------.......-----................-
Mpf_ENSMPUP00000006089 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016498 -------------..........--------ECTMQI...THENIYLW.......DIHNAk...............V
Mpf_ENSMPUP00000007327 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001749 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016475 -------------..........--------------...--------.......E----................-
Mpf_ENSMPUP00000013206 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006140 -----CKNDIRDT..........VGIWGEGKDMYLIL...ENDTLSLV.......DPMDR................S
Mpf_ENSMPUP00000005780 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001869 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012475 -------------..........--------------...--------.......EADGR................V
Mpf_ENSMPUP00000008316 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001167 -------------..........-----------LCL...TSKTISFV.......KLNSE................A
Mpf_ENSMPUP00000008230 -------------..........-----------LRV...EAERLTLL.......TMGTQ................S
Mpf_ENSMPUP00000017717 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010272 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003964 -------------..........--------------...--------.......EADGR................V
Mpf_ENSMPUP00000017478 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010168 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009546 -----F-------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002870 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000151 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000216 --------YCVPR..........FSLVGSKFTVRTRV...GIDGMKIV.......ETHNE................E
Mpf_ENSMPUP00000007012 ------------G..........DRENKKWTHMFLLI...EDQ-----.......-----................-
Mpf_ENSMPUP00000012096 -------------..........--------------...--------.......----K................-
Mpf_ENSMPUP00000004281 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004460 -------------..........--------ECKLQI...THENIYLW.......DIHNPr...............V
Mpf_ENSMPUP00000011499 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003498 -------------..........----L---------...--------.......-----................-
Mpf_ENSMPUP00000006723 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006149 -------------..........--------ECALQI...TYEHICLW.......DVQNPr...............V
Mpf_ENSMPUP00000011052 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015653 -------------..........--------------...-R------.......-----................-
Mpf_ENSMPUP00000014937 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006713 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005370 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017142 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011052 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000930 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016865 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000090 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012035 -------------..........-GSIRPWKQMYVVL...RGHSLYLY.......KDKRE................Q
Mpf_ENSMPUP00000009068 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000172 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013402 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012726 -------------..........--------------...--S-----.......-----................-
Mpf_ENSMPUP00000010329 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005886 SFFSSFEENDIENhlisghnvvqPTDMEENRTMLFTI...GQSEVYLI.......SPDTK................K
Mpf_ENSMPUP00000011911 -------------..........----------LLVL...GQDTIQLR.......EASSP................Q
Mpf_ENSMPUP00000013895 -------------..........--------K-----...--------.......-----................-
Mpf_ENSMPUP00000009754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017452 KLVRDGGVFLKSA..........TGRLKEVQAVLL--...--------.......-----................-
Mpf_ENSMPUP00000004281 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017577 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004977 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017884 -------------..........----------TLLL...STHRLIWR.......DQKNH................E
Mpf_ENSMPUP00000007027 -----K-------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012725 -------------..........-A------------...--------.......-----................-
Mpf_ENSMPUP00000000871 -------------..........------NITVDLVI...GPKGIRQL.......TSQDAkpt.............C
Mpf_ENSMPUP00000006220 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008418 -------------..........RGDQDSWVPAMLSV...SDSLMTAH.......RIQAEagaee...........E
Mpf_ENSMPUP00000003932 -------------..........-----------LCL...TDEEVVFV.......RLNTE................V
Mpf_ENSMPUP00000001861 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008418 ------RSRSQPP..........DGAWGEGQNMLMIL...KKDAMSLV.......NPLDH................S
Mpf_ENSMPUP00000006249 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003836 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015858 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002835 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004473 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000137 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001907 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014024 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001742 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000172 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005480 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018515 -------------..........----I---------...--------.......-----................-
Mpf_ENSMPUP00000009502 -------------..........--------------...----I---.......-----................-
Mpf_ENSMPUP00000013672 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011336 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001410 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003424 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007040 -------------..........-G------------...--------.......-----................-
Mpf_ENSMPUP00000019493 -------------..........--------------...---G----.......-----................-
Mpf_ENSMPUP00000018830 -------------..........-----P--------...--------.......-----................-
Mpf_ENSMPUP00000003141 ASAPSHVQ-----..........PSDSEKNRTMLFQV...GRFEINLI.......SPDTK................S
Mpf_ENSMPUP00000010983 -------------..........---------G----...--------.......-----................-
Mpf_ENSMPUP00000010498 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012786 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014114 KTWNRRWFSIQNS..........QLVYQKKVKDALTV...VVDDLRLC.......SVKP-................-
Mpf_ENSMPUP00000007256 -------------..........RSKGEHKQKIFLTI...SFGGIKIF.......DEKTG................A
Mpf_ENSMPUP00000005608 --------S----..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002033 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016751 -------------..........IHNIFRMTESHLLV...TCDCLKLI.......DPQTQ................V
Mpf_ENSMPUP00000016435 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001167 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001585 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002351 -------------..........-S------------...--------.......-----................-
Mpf_ENSMPUP00000011499 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005375 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015986 -------------..........--DCPRRRAVILKF...SLQGLKIY.......SGEGE................V
Mpf_ENSMPUP00000004747 -------------..........--SSQHPFPVTLYVpnvPEGSVRII.......DQSNN................V
Mpf_ENSMPUP00000009754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002257 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006734 -------------..........--------------...------V-.......-----................-
Mpf_ENSMPUP00000003502 -------------..........--KNIKKKKVSIMV...SVDGVKVI.......LKKKKkkkewtwdesk.....M
Mpf_ENSMPUP00000011019 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003673 -------------..........--------K-----...--------.......-----................-
Mpf_ENSMPUP00000000383 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008997 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010040 -------------..........--------------...--D-----.......-----................-
Mpf_ENSMPUP00000007257 ---------L---..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016774 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001960 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007610 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017612 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007907 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014021 -------------..........--QCQISLDVTLSVpnvSEGTVRLL.......DPQTN................T
Mpf_ENSMPUP00000008982 -------------..........--------EMALGI...CTKGVIVY.......EVTNN................S
Mpf_ENSMPUP00000005803 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002728 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007017 -------------..........---------V----...--------.......-----................-
Mpf_ENSMPUP00000003752 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001306 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005338 -------------..........-KGKNKLVPRLLGI...TKECVMRV.......DEKTK................E
Mpf_ENSMPUP00000001689 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010415 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006220 -------------..........-SMFNTWKPMWVVL...LEDGIEFY.......-----................-
Mpf_ENSMPUP00000016350 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018773 ------------K..........SEAGRQGTKMKLTV...SAQGIRMV.......HAEERalr.............R
Mpf_ENSMPUP00000017599 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016349 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015036 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007938 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007257 -------------..........-------------L...--------.......-----................-
Mpf_ENSMPUP00000005203 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000650 -------------..........-KGKNKLVPRLLGI...TKDSVMRV.......DEKTK................E
Mpf_ENSMPUP00000007937 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007017 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012780 FVLSNGLLSYYRN..........QGEMAHTCRGTINL...ST------.......-----................-
Mpf_ENSMPUP00000002522 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004905 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011326 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009449 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000014 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012737 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002136 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017782 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013550 -------------..........----I---------...--------.......-----................-
Mpf_ENSMPUP00000017362 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006996 -------------..........--------------...--------.......D----................-
Mpf_ENSMPUP00000004785 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014164 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016592 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000486 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003712 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006850 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015574 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014962 -------------..........------------EI...TTQHVYFY.......D----................-
Mpf_ENSMPUP00000016814 -------------..........--GREGKLDVYLFL...FSDMLLVT.......KPQRK................-
Mpf_ENSMPUP00000000139 -------------..........-------------L...--------.......-----................-
Mpf_ENSMPUP00000012020 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006069 -------------..........--E-----------...--------.......-----................-
Mpf_ENSMPUP00000017142 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013991 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010353 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000014 -------------..........--------------...------I-.......-----................-
Mpf_ENSMPUP00000009546 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012020 -------------..........IHNIFRTTESHLMV...TSQTLRLI.......DPQTQ................V
Mpf_ENSMPUP00000016751 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000216 -------------..........--------------...----V---.......-----................-
Mpf_ENSMPUP00000010854 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016813 -------------..........-KRWKKRFFVLVQV...SQYTFAMC.......SYREK................-
Mpf_ENSMPUP00000002870 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003651 -------QQALSN..........MKTGHKPESVDL--...--------.......-----................-
Mpf_ENSMPUP00000002370 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006780 -------------..........-KRWKKRYFVLVQV...SQYTFAMC.......SYREKksep............Q
Mpf_ENSMPUP00000002802 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011336 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003120 -------------..........----------SIKM...AVCEIKVH.......SAD--................-
Mpf_ENSMPUP00000005803 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004980 -------------..........--------------...--C-----.......-----................-
Mpf_ENSMPUP00000015621 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003141 SQKPEAGGC----..........--GAPAAREVLLVL...SAPFLRCV.......PAPGVgaaggvgpaaaqpnpaV
Mpf_ENSMPUP00000013099 -------------..........--------------...----V---.......-----................-
Mpf_ENSMPUP00000010983 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004910 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016233 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002953 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011716 -------------..........QPPDGKPKDCMLQI...--------.......-----................-
Mpf_ENSMPUP00000007767 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014585 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014164 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005886 SGQS---------..........SKKEPGARQVRLCV...SPSGLRCE.......PEPGKsqqwdplic.......S
Mpf_ENSMPUP00000013797 -------------..........--HSQDVSDCYLEL...FHSYLYFQ.......-----................-
Mpf_ENSMPUP00000004108 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009167 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016226 -------------..........--------------...-----Y--.......-----................-
Mpf_ENSMPUP00000014024 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008448 -------------..........----------LIAI...NKYGISLI.......DPRTK................D
Mpf_ENSMPUP00000010607 -------------..........----KIHSLVTMRV...LHDRVQLC.......TD-QA................A
Mpf_ENSMPUP00000015774 -------------..........----R---------...--------.......-----................-
Mpf_ENSMPUP00000008639 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012941 -------------..........--------------...-------A.......-----................-
Mpf_ENSMPUP00000016218 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007001 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001986 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010415 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003836 ---L---------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007027 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002688 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001373 -------------..........----------K---...--------.......-----................-
Mpf_ENSMPUP00000013700 -------------..........--------------...--------.......----N................-
Mpf_ENSMPUP00000016589 -------------..........---------ILIAI...NRHGVLLI.......HPKTK................E
Mpf_ENSMPUP00000015325 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001960 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006310 -------------..........-----------LGV...SYNRLIRI.......DAATG................I
Mpf_ENSMPUP00000016747 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013323 -------------..........--------------...-----KCI.......DLDTE................E
Mpf_ENSMPUP00000007350 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017588 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007745 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006409 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015574 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008365 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001054 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017488 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005234 -------------..........------------F-...--------.......-----................-
Mpf_ENSMPUP00000013182 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011513 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005385 -------------..........--------------...---RLIRM.......DASTG................D
Mpf_ENSMPUP00000009077 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001767 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007827 -------------..........--------S-----...--------.......-----................-
Mpf_ENSMPUP00000000541 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001809 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005803 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013182 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005315 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014585 -------------..........--------------...-D------.......-----................-
Mpf_ENSMPUP00000015166 -------------..........------------S-...--------.......-----................-
Mpf_ENSMPUP00000002409 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005807 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013796 -------------..........--------------...------I-.......-----................-
Mpf_ENSMPUP00000017782 -------------..........--------------...S-------.......-----................-
Mpf_ENSMPUP00000019464 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012725 ----------I--..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010996 -------------..........--------------...--TRIRAM.......DKDTK................K
Mpf_ENSMPUP00000007938 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009654 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005385 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006310 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007963 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002310 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000486 -------------..........------WQSCYAEL...SPYNLYFY.......SLDSS................-
Mpf_ENSMPUP00000007805 -------------..........--------------...--G-----.......-----................-
Mpf_ENSMPUP00000010246 -------------..........--------------...--------.......-K---................-
Mpf_ENSMPUP00000004460 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014791 -------------..........--------------...--------.......-----................Q
Mpf_ENSMPUP00000003154 -------------..........-----K--------...--------.......-----................-
Mpf_ENSMPUP00000005214 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003932 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008710 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005632 -------------..........---------M----...--------.......-----................-
Mpf_ENSMPUP00000002828 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017859 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004548 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000646 ----------LDR..........FSTNNKSLTGTLYL...TATHLLFI.......DSHQKe...............T
Mpf_ENSMPUP00000004473 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000402 -------------..........--------------...--------.......----K................-
Mpf_ENSMPUP00000007412 -------------..........--------------...--D-----.......-----................-
Mpf_ENSMPUP00000004935 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011513 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001759 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008353 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012083 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006956 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014860 -------------..........--------------...--------.......-----................Q
Mpf_ENSMPUP00000009647 -------------..........--------------...--------.......-----................K
Mpf_ENSMPUP00000005803 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005109 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006149 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001981 -------------..........NSLNKEWKKKYVTL...SSNGFLLY.......HPSIN................D
Mpf_ENSMPUP00000017916 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000003318 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017175 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016038 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016192 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015325 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000660 --YPEIHGFLHAK..........EQGKKSWKKIYFLL...RRSGLYFS.......TKGTSkeprhl..........Q
Mpf_ENSMPUP00000005493 -------------..........-G------------...--------.......-----................-
Mpf_ENSMPUP00000009754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013796 -------------..........--------------...--------.......A----................-
Mpf_ENSMPUP00000010667 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013126 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018046 -------------..........------WRKLYVCL...RRSGLYCS.......T----................-
Mpf_ENSMPUP00000006359 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015086 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008387 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015207 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004217 -------------..........--EDVFPANALLEI...RPFQVWLH.......HLDHKgeat............V
Mpf_ENSMPUP00000015689 -------------..........--------------...----V---.......-----................-
Mpf_ENSMPUP00000015159 -------------..........-------------L...--------.......-----................-
Mpf_ENSMPUP00000018833 -------------..........--------------...-Q------.......-----................-
Mpf_ENSMPUP00000007866 -------------..........-----AGRPLTLSI...S-------.......-----................-
Mpf_ENSMPUP00000007938 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010694 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013131 -------------..........--------------...--------.......--D--................-
Mpf_ENSMPUP00000000312 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000019132 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015959 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012612 -------------..........--------------...--------.......D----................-
Mpf_ENSMPUP00000007938 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007989 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016156 -----------K-..........--------------...--------.......-----................-
Mpf_ENSMPUP00000013721 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005447 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015768 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000004215 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010108 -------------..........--------------...--------.......----K................-
Mpf_ENSMPUP00000002188 -------------..........------------E-...--------.......-----................-
Mpf_ENSMPUP00000013446 --------I----..........--------------...--------.......-----................-
Mpf_ENSMPUP00000012407 -------------..........SGVRRGWQRVFAAL...SDSRLLLF.......DAPD-................-
Mpf_ENSMPUP00000017043 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007898 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000017064 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016461 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008230 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000001993 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000014500 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002405 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002933 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007268 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010983 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010498 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000018101 ------------F..........IPVRRKEMPCVFTV...TASQL---.......-----................-
Mpf_ENSMPUP00000002033 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010694 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000008353 -------------..........-----TWMPYIFSL...SLESLKCF.......RVRNNek..............M
Mpf_ENSMPUP00000009754 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000015718 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002358 -------------..........--V-----------...--------.......-----................-
Mpf_ENSMPUP00000005077 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009107 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016101 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000011911 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007938 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000009676 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005809 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000016410 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000006638 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000005803 MYLRRLQELTIST..........VVQNGEKIDVLLLV...--------.......-----................-
Mpf_ENSMPUP00000010983 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000000717 -------------..........--------K-----...--------.......-----................-
Mpf_ENSMPUP00000002793 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000007833 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000002271 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010974 -------------..........--------------...--------.......-----................-
Mpf_ENSMPUP00000010755 -------------..........--------------...---F----.......-----................-
Mpf_ENSMPUP00000013112 -------------..........----------IMGV...SKYGIKVS.......SSDQY................D


                       30       140         150                                          160        
                        |         |           |                                            |        
d1shca_                IIANHHMQSISFASG..GDPDTAE...........YVAYVAK....................DP....VN.....QR
Mpf_ENSMPUP00000000236 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001054 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001986 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006133 IIANHHMQSISFASG..GDPDTAE...........YVAYVAK....................DP....VN.....QR
Mpf_ENSMPUP00000009494 TMMDHPLRTISYIA-..---DIGN...........IVVLMARrrlprsnsqenveashpsq.DGkr..QY.....KM
Mpf_ENSMPUP00000004093 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012215 IIANHHMQSISFASG..GDPDTTD...........YVAYVAK....................DP....VN.....QR
Mpf_ENSMPUP00000016175 LFAQAPVD-------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009909 IIANHHMQSISFASG..GDTDMTD...........YVAYVAK....................DP....IN.....QR
Mpf_ENSMPUP00000010977 TMMDHALRTISYIA-..---DIGN...........IVVLMARrrmprsasqdciettpgaqeGKk...QY.....KM
Mpf_ENSMPUP00000016638 ---Q-----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018612 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018966 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004660 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002149 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018066 FRRHYPVSSVIFCAL..DP-QDRKwitdgpcsr..VFGFVAR....................KQgs..AT.....DN
Mpf_ENSMPUP00000017958 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011450 ELENFPLSTIQHCQAvmHSCNYDS...........ILALVCK....................EPt...QN.....KP
Mpf_ENSMPUP00000016402 FRRHYPLNTVTFCDL..DP-QERKwmkteggvpakLFGFVAR....................KQgs..TT.....DN
Mpf_ENSMPUP00000004951 -------------Y-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011363 IIAEHEIRNISCAAQ..DP-EDLS...........TFAYITK....................DLk...SN.....HH
Mpf_ENSMPUP00000015445 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015195 ---------------..----D--...........-------....................--....--.....--
Mpf_ENSMPUP00000011751 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009831 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004111 AMMDHALQTISYIA-..---DIGS...........VLVLMARrrlarrpasqaps.......HK....LY.....KM
Mpf_ENSMPUP00000005349 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006137 FRRHYPVNSITFSST..DP-QDRRwanpdgttsk.IFGFVAK....................KPgs..PW.....EN
Mpf_ENSMPUP00000009095 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005832 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014567 FRRHYPLTTLRFCGM..DP-EQRKwqkyckpsw..IFGFVAK....................SQte..SQ.....EN
Mpf_ENSMPUP00000015198 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008441 IIANHHMQSISFASG..GDPDTTD...........YVAYVAK....................DP....VN.....RR
Mpf_ENSMPUP00000005146 PKIGFPWSEIRNISF..ND-----...........-------....................--....--.....--
Mpf_ENSMPUP00000010667 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000642 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015373 ---------------..----V--...........-------....................--....--.....--
Mpf_ENSMPUP00000003213 VIAEHEIRNISCAAQ..DP-EDLC...........TFAYITK....................DLq...TS.....HH
Mpf_ENSMPUP00000012196 VQHNCQLHRISFCAD..DK-TDKR...........IFTFICK....................DSe...SN.....KH
Mpf_ENSMPUP00000012194 ------------V--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003212 VIAEHEIRNISCAAQ..DP-EDLC...........TFAYITK....................DLq...TS.....HH
Mpf_ENSMPUP00000001158 ---------------..N------...........-------....................--....--.....--
Mpf_ENSMPUP00000010667 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013386 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016712 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003302 PKIGFPWSEIRNISF..ND-----...........-------....................--....--.....--
Mpf_ENSMPUP00000003768 LIVDQTIEKVSFCAP..DR-NFDR...........AFSYICR....................DGt...TR.....RW
Mpf_ENSMPUP00000008012 ELELYPLGAIVRC--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002625 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010667 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006140 VLVECRVRFLSFMGV..GK--DVH...........TFAFIMD....................TG....NQ.....RF
Mpf_ENSMPUP00000015670 LIENVSIYRISYCTA..DK-MHDK...........VFAYIAQ....................SQh...NE.....NL
Mpf_ENSMPUP00000008341 EMEFLDITNIRDTRF..GK-----...........-------....................--....--.....--
Mpf_ENSMPUP00000017573 LLVDQTIEKVSFCAP..DR-NLDK...........AFSYICR....................DGt...TR.....RW
Mpf_ENSMPUP00000012859 EVDTLDISSIRDTRT..G------...........-------....................--....--.....--
Mpf_ENSMPUP00000012131 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000172 NTFN-----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013200 PKISFPWNEIRNISY..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003522 ---------------..-----K-...........-------....................--....--.....--
Mpf_ENSMPUP00000011499 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011494 LILDVPLGVIS----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012716 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002913 -V-------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003504 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004361 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017389 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015829 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003644 ELDSYRLDSIQ----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006376 ---------------..-------...........--A----....................--....--.....--
Mpf_ENSMPUP00000014536 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011501 ------------V--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017670 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006727 LLWEQEL--------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000961 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004942 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002151 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014680 IEHEHPVNKISFIAR..DV-TDNR...........AFGYVCG....................GEg...QH.....QF
Mpf_ENSMPUP00000005563 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011333 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000969 ---------------..-------...........---F---....................--....--.....--
Mpf_ENSMPUP00000010395 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015361 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001991 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005637 CSHFFQLKNISFCGY..HP-KNNK...........YFGFITK....................HPa...DH.....RF
Mpf_ENSMPUP00000007307 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008193 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007177 VATDHKAFYVLFTWD..QEAQIY-...........-------....................--....--.....--
Mpf_ENSMPUP00000010360 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010611 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007161 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006134 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004983 -------R-------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001920 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013542 LLWEQ----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008337 -----P---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013626 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001949 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017721 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001109 ---------------..-------...........-------....................--....--.....-K
Mpf_ENSMPUP00000001935 CSHFFQMKNISFCGC..HP-RNSC...........YFGFITK....................HPl...LS.....RF
Mpf_ENSMPUP00000006252 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005676 LLHAQPIVSIRVWGV..GR-DSGR...........DFAYVAR....................DKl...TQ.....ML
Mpf_ENSMPUP00000005196 ----E----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012589 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010571 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011589 ILGSIPLLSFRVAAV..QP-----...........-------....................--....--.....--
Mpf_ENSMPUP00000005676 VLGECRVRFLSFLAV..GR--DVH...........TFAFIMA....................AG....PA.....SF
Mpf_ENSMPUP00000002533 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004215 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013399 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010530 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006089 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016498 KLVMWPLSSLRRYG-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007327 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001749 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016475 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013206 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006140 VLHSQPIASIRVWGV..GR-DNGR...........DFAYVAR....................DKd...TR.....IL
Mpf_ENSMPUP00000005780 ---------------..-------...........--A----....................--....--.....--
Mpf_ENSMPUP00000001869 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012475 VEGNHTVYRISA---..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008316 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001167 AAVVLQLMNIRRCGH..SE-----...........-------....................--....--.....--
Mpf_ENSMPUP00000008230 QIL------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017717 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010272 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003964 VEGNHMVYRIS----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017478 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010168 ------------I--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009546 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002870 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000151 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000216 YPHTFQV--------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007012 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012096 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004281 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004460 KLVSWPLCSLRRYGR..DA-----...........-------....................--....--.....--
Mpf_ENSMPUP00000011499 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003498 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006723 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006149 KLISWPLSA------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011052 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015653 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014937 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006713 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005370 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017142 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011052 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000930 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016865 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000090 --W------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012035 TTPSEEEQPISVNA-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009068 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000172 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013402 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012726 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010329 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005886 IALEKNFKEISFCSQ..GI-RHVD...........HFGFICR....................ES....SGgggf.HF
Mpf_ENSMPUP00000011911 ALYTWPYRFLRKFG-..---SDKD...........VFSFEAG....................RRc...DS.....GE
Mpf_ENSMPUP00000013895 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017452 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004281 ---------------..---NDPC...........KFALMNR....................ET....--.....--
Mpf_ENSMPUP00000017577 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004977 -I-------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017884 CCMAIPLSQIVFI--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007027 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012725 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000871 LAEFKQIRSIR----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006220 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008418 PLWQCPVRLVTFIGV..GR--DPH...........TFGLIAD....................LG....RQ.....SF
Mpf_ENSMPUP00000003932 ASVVVQLLSIRRCGH..SE-----...........-------....................--....--.....--
Mpf_ENSMPUP00000001861 ---T-----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008418 LIHCQPLVHIRVWGV..GS-SKGR...........DFAFVAG....................DKd...SC.....ML
Mpf_ENSMPUP00000006249 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003836 ---------------..-----GK...........PFVFNCT....................PQs...GN.....RT
Mpf_ENSMPUP00000015858 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002835 V--------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004473 ---------------..-------...........---F---....................--....--.....--
Mpf_ENSMPUP00000000137 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001907 ---------------..----DPC...........RFALTSR....................GP....EG.....GI
Mpf_ENSMPUP00000014024 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001742 ---------------..-------...........----I--....................--....--.....--
Mpf_ENSMPUP00000000172 ---------------..-------...........-------....................--....--.....R-
Mpf_ENSMPUP00000005480 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018515 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009502 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013672 --------R------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011336 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001410 ---------------..G------...........-------....................--....--.....--
Mpf_ENSMPUP00000003424 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007040 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000019493 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018830 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003141 VVLEKNFKDISSCSQ..GI-KHVD...........HFGFICR....................ESaepgLG.....QY
Mpf_ENSMPUP00000010983 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010498 -------------G-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012786 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014114 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007256 LQHHHAVHEISYIAK..DI-TDHR...........AFGYVCG....................KEg...NH.....R-
Mpf_ENSMPUP00000005608 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002033 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016751 TRLTFPLPSVVLYAT..HQ-ENKR...........LFGFVLR....................TSg...GRsesnlSS
Mpf_ENSMPUP00000016435 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001167 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001585 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002351 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011499 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005375 ---------I-----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015986 LLMAHALRRILYSTW..CP--ADC...........QFAFMAR....................NPqsp.AN.....KL
Mpf_ENSMPUP00000004747 ELASFPIYKVLFCAR..GH-DGTTesn........CFAFTES....................SHg...SE.....EF
Mpf_ENSMPUP00000009754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002257 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006734 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003502 LVMQDPIYRIFYVSH..DS-QDLK...........IFSYIAR....................DGa...SN.....IF
Mpf_ENSMPUP00000011019 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003673 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000383 ---------------..------D...........-------....................--....--.....--
Mpf_ENSMPUP00000008997 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010040 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007257 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016774 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001960 ---------------..------R...........ICAFLWR....................KKw...LG.....--
Mpf_ENSMPUP00000007610 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017612 ---------------..-------...........-------....................-Rgp..EY.....TY
Mpf_ENSMPUP00000007907 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014021 EIANYPIYKILFCVR..GH-DGTPesd........CFAFTES....................HYn...AE.....LF
Mpf_ENSMPUP00000008982 RIATLRFQ-------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005803 -------I-------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002728 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007017 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003752 -----------K---..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001306 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005338 VIQEWSLTNIKRWAA..SP-----...........-------....................--....--.....--
Mpf_ENSMPUP00000001689 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010415 ---------------..----DAK...........ICAFLLR....................KKr...F-.....--
Mpf_ENSMPUP00000006220 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016350 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018773 PGHLYLLHRVTYCVA..DA-RLPK...........VFAWVYR....................HEl...KHkav..ML
Mpf_ENSMPUP00000017599 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016349 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015036 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007938 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007257 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005203 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000650 VLQEWPLTTVKRWAA..SP-----...........-------....................--....--.....--
Mpf_ENSMPUP00000007937 -------------S-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007017 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012780 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002522 -----D---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004905 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011326 ---------------..-----V-...........-------....................--....--.....--
Mpf_ENSMPUP00000009449 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000014 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012737 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002136 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017782 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013550 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017362 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006996 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004785 ---FQAIEEVYYDHL..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014164 ---------------..-------...........----L--....................--....--.....--
Mpf_ENSMPUP00000016592 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000486 V--------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003712 ------------C--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006850 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015574 ---------------..-D-----...........-------....................--....--.....--
Mpf_ENSMPUP00000014962 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016814 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000139 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012020 ---------------..--IQDLD...........NCSVMAV....................DC....ED.....RR
Mpf_ENSMPUP00000006069 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017142 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013991 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010353 ---------------..-------...........-------....................-G....--.....--
Mpf_ENSMPUP00000000014 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009546 ------ISKVSIATP..KQ-KPKT...........PFCFVIN....................AL....--.....--
Mpf_ENSMPUP00000012020 TRANFELTSITQFAA..HQ-ENKR...........LVGFVVR....................TPes..TGge...AL
Mpf_ENSMPUP00000016751 ---------------..-------...........--SVMAV....................DC....ED.....RR
Mpf_ENSMPUP00000000216 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010854 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016813 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002870 ---------------..-------...........-F-----....................--....--.....--
Mpf_ENSMPUP00000003651 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002370 ---------------..---AKNK...........WFVCMAK....................TP....EE.....--
Mpf_ENSMPUP00000006780 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002802 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011336 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003120 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005803 ---------------..-------...........---F---....................--....--.....--
Mpf_ENSMPUP00000004980 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015621 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003141 FIFEHKAQHISRFIH..NS-HDLT...........YFAYLIKaqpd................DP....ES.....QM
Mpf_ENSMPUP00000013099 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010983 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004910 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016233 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002953 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011716 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007767 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014585 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014164 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005886 SIFECKPQHVHKLIH..NS-HDPS...........YFACLIK....................DHta..SQ.....QS
Mpf_ENSMPUP00000013797 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004108 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009167 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016226 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014024 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008448 ILTTHPFTKISNWSS..GN-----...........-------....................--....--.....--
Mpf_ENSMPUP00000010607 VLAEYPAEKLAFSAV..CP-DDRR...........LFGLVTMqsgddgslahe.........DEg...AL.....RT
Mpf_ENSMPUP00000015774 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008639 --------H------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012941 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016218 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007001 --F------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001986 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010415 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003836 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007027 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002688 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001373 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013700 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016589 LLTTYPFTKISSWSS..GS-----...........-------....................--....--.....--
Mpf_ENSMPUP00000015325 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001960 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006310 PMTTWRFTNMKQW--..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016747 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013323 HIYH-----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007350 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017588 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007745 --D------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006409 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015574 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008365 --------------K..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001054 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017488 ----I----------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005234 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013182 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011513 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005385 AIKTWRFSNMK----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009077 ---------------..-------...........-F-----....................--....--.....--
Mpf_ENSMPUP00000001767 -----N---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007827 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000541 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001809 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005803 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013182 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005315 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014585 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015166 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002409 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005807 -----------W---..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013796 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017782 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000019464 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012725 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010996 KIHNFSVI-------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007938 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009654 ---------I-----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005385 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006310 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007963 ---------------..-------...........T------....................--....--.....--
Mpf_ENSMPUP00000002310 L--------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000486 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007805 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010246 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004460 ---------------..------Rq..........AVAIIFT....................DDs...AR.....TF
Mpf_ENSMPUP00000014791 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003154 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005214 ---------------..G------...........-------....................--....--.....--
Mpf_ENSMPUP00000003932 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008710 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005632 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002828 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017859 ---------I-----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004548 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000646 WILHHHIALV-----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004473 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000402 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007412 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004935 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011513 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001759 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008353 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012083 ---------------..-------...........-Y-----....................--....--.....--
Mpf_ENSMPUP00000006956 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014860 YIADVNESNVYVVTQ..GR-KLYGmpt........DFGFCIK....................--....--.....--
Mpf_ENSMPUP00000009647 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005803 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005109 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006149 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001981 YIHSTH---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017916 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000003318 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017175 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016038 ---------------..------N...........NFVFVVK....................TT....SR.....TF
Mpf_ENSMPUP00000016192 --S------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015325 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000660 FFSEFG---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005493 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013796 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010667 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013126 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018046 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006359 ---------------..----H--...........-------....................--....--.....--
Mpf_ENSMPUP00000015086 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000008387 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015207 ------LSRLSRATA..RPAKPED...........LFAF---....................--....--.....--
Mpf_ENSMPUP00000004217 HMDTFQVARIAYCTA..DHNVSPN...........IFAWVYRein.................DDl...SY.....QM
Mpf_ENSMPUP00000015689 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015159 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018833 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007866 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007938 ---------------..-------...........-------....................--....--.....-H
Mpf_ENSMPUP00000010694 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013131 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000312 -L-------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000019132 -----S---------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015959 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012612 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007938 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007989 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016156 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013721 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005447 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015768 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000004215 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010108 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002188 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013446 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000012407 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017043 ----HRIPGLNCCGQ..GR-----...........-------....................--....--.....--
Mpf_ENSMPUP00000007898 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000017064 --H------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016461 ---------------..-------...........-F-----....................--....--.....--
Mpf_ENSMPUP00000008230 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000001993 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000014500 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002405 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002933 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007268 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010983 ----------SVCAS..DSPDRPN...........SFVIITA....................NR....--.....--
Mpf_ENSMPUP00000010498 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000018101 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002033 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010694 ---------------..-------...........-------....................--....DR.....RK
Mpf_ENSMPUP00000008353 LSDSHGIETIRDIL-..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009754 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000015718 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002358 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005077 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009107 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016101 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000011911 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007938 ----RRLQEISVVSA..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000009676 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005809 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000016410 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000006638 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000005803 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010983 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000000717 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002793 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000007833 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000002271 --MEDWVKSIRRVIW..GP-----...........-------....................--....--.....--
Mpf_ENSMPUP00000010974 ----KDLRQI-----..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000010755 ---------------..-------...........-------....................--....--.....--
Mpf_ENSMPUP00000013112 VLHRHALYLIIRMVC..YD-DGLGagks.......LLALKTT....................DAs...NK.....EY


                           170         180       190                                                
                             |           |         |                                                
d1shca_                ACHILECPE..GLAQDVISTIGQAFELRFKQYLR...........................................
Mpf_ENSMPUP00000000236 ---------..-----I-----------------tcsykassgllyplergfiyvhkppvhirfdeisfvnfargtt
Mpf_ENSMPUP00000001054 ---------..-----------------------frhmiptealqvralasadaeanavceivhvksesegrpervf
Mpf_ENSMPUP00000001986 ---------..-----------------------dpfkfrwlipisalqvrlgntagtennsvwelihtkseiegrp
Mpf_ENSMPUP00000006133 ACHILECPE..GLAQDVISTIGQAFELRFKQYLR...........................................
Mpf_ENSMPUP00000009494 VCHVFESED..--AQLIAQSIGQAFSVAYQEFLR...........................................
Mpf_ENSMPUP00000004093 ---------..-----------------------canhyitpmmelkpnagsdrawvwnthadfadecpkpellair
Mpf_ENSMPUP00000012215 ACHILECRS..GMAQDVISTIGQAFELRFKQYLK...........................................
Mpf_ENSMPUP00000016175 ---------..-----------------------qfpgtavesvtdssryfviriedgngrrafigigfvdrgdafd
Mpf_ENSMPUP00000009909 ACHILECCG..GVAQSVISTVGQAFELRFKQYL-...........................................
Mpf_ENSMPUP00000010977 ICHVFESED..--AQLIAQSIGQAFSVAYQEFLR...........................................
Mpf_ENSMPUP00000016638 ---------..-----------------------apveqypgiavetvtdssryfviriqdgtgrsafigigftdrg
Mpf_ENSMPUP00000018612 ---------..-----------------------anhyitpmmelkpnagsdrawvwnthadfadecpkpellairf
Mpf_ENSMPUP00000018966 ---------..-----------------------anhyitpmmelkpnagsdrawvwnthadfadecpkpellairf
Mpf_ENSMPUP00000004660 ---------..-----------------------wqkrwcalsktvfyyygsdkdkqqkgefsidgynvrmnntlrk
Mpf_ENSMPUP00000002149 ---------..-----------------------yvfspteelrkrwihqlknvirynsdlvqkyhpcfwidgqylc
Mpf_ENSMPUP00000018066 VCHLFAEHDpeQPASAIVNFV-------------skvmi......................................
Mpf_ENSMPUP00000017958 ---------..-----------------------menrtepitkdldfqlqdpfllyrnarlsiygiwfydkeecqr
Mpf_ENSMPUP00000011450 DLHLFQCDEi.K-ANLISEDIE------------saisds.....................................
Mpf_ENSMPUP00000016402 ACHLFAEL-..-----------------------dpnqpasaivnfvsknkck........................
Mpf_ENSMPUP00000004951 ---------..-----------------------dstrnvyriisldgskaiinstitpnmtftktsqkfgqwadsr
Mpf_ENSMPUP00000011363 YCHVFTAFDv.NLAYEIILTLGQAFEVAYQLA--l..........................................
Mpf_ENSMPUP00000015445 ---------..-----------------------syriisvdgakviinstitpnmtftktsqkfgqwadsrantvf
Mpf_ENSMPUP00000015195 ---------..-----------------------hsffgsewqkrwcvvsrglfyyyanekskqpkgtflikgysvr
Mpf_ENSMPUP00000011751 ---------..-----------------------evvdledgkdrdlhvsvknafrllcgttgeshllcarkseqkq
Mpf_ENSMPUP00000009831 ---------..--------S--------------mknafklhnketeeihlffakkleekirwlrafreerkmvqed
Mpf_ENSMPUP00000004111 LCHVFHSED..--AQLIAQAIGQAFSVAYSQFL-...........................................
Mpf_ENSMPUP00000005349 ---------..-----------------------vpcqnkypfqvvhdantlyifapsaqsrdrwvkklkeeiknnn
Mpf_ENSMPUP00000006137 VCHLF----..-----------------------aeldpdqpa..................................
Mpf_ENSMPUP00000009095 ---------..-----------------------fqviqperalyiqanncveakawidiltkvsqsnqkrlavyhp
Mpf_ENSMPUP00000005832 ---------..-----------------------vvgwkmqpeqqvvincaivrgikynqatpsfhqwrdarqvwgl
Mpf_ENSMPUP00000014567 VCHLFAEYD..-----------------------pvqpasqvislvrtllq..........................
Mpf_ENSMPUP00000015198 ---------..-----------------------lllekqasgnpwhqfvennlilkmgpvdkrkglfarrrqlllt
Mpf_ENSMPUP00000008441 ACHILECCD..GLAQDVIGSIGQAFELRFKQYLQ...........................................
Mpf_ENSMPUP00000005146 ---------..-----------------------kkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrr
Mpf_ENSMPUP00000010667 ---------..-----------------------vlklcanhritpdmtlqnmkgtervwvwtacdfadgerkvehl
Mpf_ENSMPUP00000000642 ---------..---------V-------------knafklvskttdevhlfcarkqedkvrwlqacederrrvredr
Mpf_ENSMPUP00000015373 ---------..-----------------------yriisiggakaiinstvtpnmtftktsqkfgqwadsrantvyg
Mpf_ENSMPUP00000003213 YCHVFSTVDv.NLTYEIILTLGQAFEVAYQLA--l..........................................
Mpf_ENSMPUP00000012196 LCYVFDSEK..C-AEEITLTIGQAFDLAYRKFL-...........................................
Mpf_ENSMPUP00000012194 ---------..-----------------------ekiggassrgensygletvckdirnlrfahkpegrtrrsifen
Mpf_ENSMPUP00000003212 YCHVFSTVDv.NLTYEIILTLGQAFEVAYQLA--l..........................................
Mpf_ENSMPUP00000001158 ---------..-----------------------dkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrr
Mpf_ENSMPUP00000010667 ---------..-----------------------nhvitktmelkplnvsnnalvwtasdyadgeakveqlavrfkt
Mpf_ENSMPUP00000013386 ---------..-----------------------vksdisipchykypfqvvhdnyllyvfapdresrqrwvlalke
Mpf_ENSMPUP00000016712 ---------..-----------------------nmhnlvepvnkdlefqlhepfllyrnaslsiysiwfydkndch
Mpf_ENSMPUP00000003302 ---------..-----------------------kkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrr
Mpf_ENSMPUP00000003768 ICHCFMAVK..DTGERLSHAVGCAFAACLERK--q..........................................
Mpf_ENSMPUP00000008012 ---------..-----------------------davlppgrsrsllllvcqeperthpdvhffqglrlgaelired
Mpf_ENSMPUP00000002625 ---------..-----------------------qtpaerqypfqivykdgllyvyasneesrsqwlkalqkeirgn
Mpf_ENSMPUP00000010667 ---------..-----------------------nhwitttmnlkplsgsdrawmwlasdfsdgdakleqlaakfkt
Mpf_ENSMPUP00000006140 ECHVFWCEP..N-AGNVSEAVQAACMLRYQK---...........................................
Mpf_ENSMPUP00000015670 ECHAFLCTKr.KVAQAVTLTVAQAFKVAFEFWQ-mskeek.....................................
Mpf_ENSMPUP00000008341 ---------..-----------------------fakipksqklrdvfnmdfpdnnfllktltvvsgpdmvdltfhn
Mpf_ENSMPUP00000017573 ICHCFLALK..DSGERLSHAVGCAFAACLERKQ-rreke......................................
Mpf_ENSMPUP00000012859 ---------..-----------------------ryarlpkdpkirevlgfggpdarleeklmtvvagpdpvnttfl
Mpf_ENSMPUP00000012131 ---------..-----------------------kknmfqvihmekplyvqanncveanewidvlcrvsrcnqnrls
Mpf_ENSMPUP00000000172 ---------..-----------------------wsrvrklsfkrkrfliklhpevrgpyqdtlefllgsrdecknf
Mpf_ENSMPUP00000013200 ---------..-----------------------sdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmr
Mpf_ENSMPUP00000003522 ---------..-----------------------qtfspvlklnavlvrsvatdkraffvictselgppqiyelval
Mpf_ENSMPUP00000011499 ---------..-----------------------nafnwakvrklsfkrkrfliklrpdanssyqdtleflmasrdf
Mpf_ENSMPUP00000011494 ---------..-----------------------riekmggatsrgensyglditckdmrnlrfalkqeghsrrdmf
Mpf_ENSMPUP00000012716 ---------..-----------------------vlkqgymmkkghkrknwterwfvlkpniisyyvsedlkdkkgd
Mpf_ENSMPUP00000002913 ---------..-----------------------inysivkglkynqatptfhqwrdarqvyglnfaskeeattfsn
Mpf_ENSMPUP00000003504 ---------..-----------------------gtipldaqccvevlpdregkrcmfcvktatrtyemsasdtrqr
Mpf_ENSMPUP00000004361 ---------..-----------------------qdhqvvincaipkglkynqatqtfhqwrdarqvyglnfgsked
Mpf_ENSMPUP00000017389 ---AFKCAR..--AEEL-----------------fnmlqeimqnnsinvveepvvernnhqtelevprtpr......
Mpf_ENSMPUP00000015829 --F------..-----------------------vlkvengaeyiletidslqkhswvadiqgcvdpgdse......
Mpf_ENSMPUP00000003644 ---------..-----------------------amdtalntcsynsilsitvqesglpatstllfqcqevgaeqlr
Mpf_ENSMPUP00000006376 ---------..-----------------------aleavgksendlegrivcvcsgtdlvnisftymvaenpevtkq
Mpf_ENSMPUP00000014536 ---------..-----------------------kvcvehhtfyrlvspeqppkakfltlgskfrysgrtqaqtrqa
Mpf_ENSMPUP00000011501 ---------..-----------------------ekigaqshgdnscgieivckdmrnlrlaykqeeqsklgifenl
Mpf_ENSMPUP00000017670 ---------..-----------------------kvciehhtffrlvspepppkgflvmgskfrysgrtqaqtrqas
Mpf_ENSMPUP00000006727 ---------..-----------------------ynnfvynsprgyfhtfagdtcqvalnfaneeeakkfrkavtdl
Mpf_ENSMPUP00000000961 ---------..-----------------------qygkekankdrvfarspsk........................
Mpf_ENSMPUP00000004942 ---------..-----------------------krlwkvcvehhtffrlllpeappkkfltlgskfrysgrtqaqt
Mpf_ENSMPUP00000002151 ---------..-----------------------tllcskgssfrysgrtqrqlleygkkgrltslpferkh.....
Mpf_ENSMPUP00000014680 ----FAIKTg.QQAEPLVIDLKDLFQVIY-----nvkkkeeekkk................................
Mpf_ENSMPUP00000005563 ---------..-----------------------stadskhtfspviklntvlvrqvatdnkalfvismsdngaqiy
Mpf_ENSMPUP00000011333 ---------..-----------------------lwkkrwfvlsdlclfyyrdekeegilgsillpsfqiamltsed
Mpf_ENSMPUP00000000969 ---------..-----------------------rldhpkackhlwkcavehhaffrlrgpvqksshrsgfirlgsr
Mpf_ENSMPUP00000010395 ---------..-----------------------ddtseykhafeiilkdensvifsaksaeeknnwmaalislqyr
Mpf_ENSMPUP00000015361 ---------..-----------------------gfklpsyraakklwkvcvehhtffrltstdtlpkskflalgsk
Mpf_ENSMPUP00000001991 ---------..-----------------------cgvenqafykyakssqiktvssskiffkgsrfrysgkvakevv
Mpf_ENSMPUP00000005637 ACHVFVSEE..S-TKALAESVGRAFQQFYKQF--v..........................................
Mpf_ENSMPUP00000007307 ---------..-----------------------greqehtfvfrldsartckhlwkcavehhsffrlrtpgnsksn
Mpf_ENSMPUP00000008193 ---------..-----------------------dliynkvtptfhhwkiddkkfgltfqspadarafdrgirraie
Mpf_ENSMPUP00000007177 ---------..-----------------------elvaqtvserknwcsliteta......................
Mpf_ENSMPUP00000010360 ---------..-----------------------svkgdvrkfeiwcngreevyivqaptpevkaawvseirkvlts
Mpf_ENSMPUP00000010611 ---------..-----------------------aicevaldykkkkhvfklrlndgneylfqakddeemntwiqai
Mpf_ENSMPUP00000007161 ---------..-----------------------cfaarnlsmpdlenrlielhspdsrntlilrckdtatahswfv
Mpf_ENSMPUP00000006134 E--------..-----------------------cyvrkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgv
Mpf_ENSMPUP00000004983 ---------..-----------------------kiqicdkddtceyknafelvskdensiifaaksaeeknnwmaa
Mpf_ENSMPUP00000001920 ---------..-----------------------gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatq
Mpf_ENSMPUP00000013542 ---------..-----------------------elysqlvystptpffhtfagdacqaglnfadegeaqvfralvq
Mpf_ENSMPUP00000008337 ---------..-----------------------vislqklivrevaneekamflisaslrgpemyeiytsskeern
Mpf_ENSMPUP00000013626 ---------..-----------------------akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkf
Mpf_ENSMPUP00000001949 ---------..-----------------------kadgfvnlpdftveraseckkkhafkishpqiktfyfaaenaq
Mpf_ENSMPUP00000017721 ---------..-----------------------vslkmayvsrrctpsdpepryleicsadgqdtlflrakdeasa
Mpf_ENSMPUP00000001109 ---------..-----------------------mcfvtrslasadpenrqleihspdakhtvilrskdsataqawf
Mpf_ENSMPUP00000001935 ACHVFVSQE..S-MRPVAQSVGRAFLEYYQQHL-...........................................
Mpf_ENSMPUP00000006252 ---------..-----------------------eksiritamdtedqgvkvflisasskdtgqlyaalhhrilalr
Mpf_ENSMPUP00000005676 KCHVFRCEA..P-AKNIATSLHEICSKIMA----e..........................................
Mpf_ENSMPUP00000005196 ---------..-----------------------paqnfslvppgtnphcfeivtanvtyfvgetpggapggpsgqg
Mpf_ENSMPUP00000012589 ---------..-----------------------qmsrdlsiqlprpdqnvarsrsk....................
Mpf_ENSMPUP00000010571 ---------..-----------------------eekkiiltyfaptpeackhlwkcgienqafyklekssqvrtvs
Mpf_ENSMPUP00000011589 ---------..-----------------------sdnisrkhtfkvttcwvdeagagpthclspqaehagvrtyffs
Mpf_ENSMPUP00000005676 CCHMFWCEP..N-AASLSEAVQAACMLRYQK---...........................................
Mpf_ENSMPUP00000002533 ---V-----..-----------------------mqvltqdaagvlhttylqcknvnelnqwlsalrkasapnpdkl
Mpf_ENSMPUP00000004215 ---------..----E------------------ifsaleeaisaqknsthpgppsqpatvpavlprpespys....
Mpf_ENSMPUP00000013399 ---AFKCSR..--AEEI-----------------fnllqdlmqcnsinvmeepvivtrnshpaelglp.........
Mpf_ENSMPUP00000010530 ---------..-----------------------sasprmsgfiyqgklpttgmtitkledsenhrnafeisgsmie
Mpf_ENSMPUP00000006089 ---------..-----------------------adlglteccgesnlrfeiwfrrrkardtfvlqaaslatkqawt
Mpf_ENSMPUP00000016498 ---------..-----------------------rdstwftfesgrmcdtgeglftfqtregemiyqkvhsatlaia
Mpf_ENSMPUP00000007327 ---------..-----------------------rscknlwkscvehhtffqakkllpqeknvlaqywtmgsrnpkk
Mpf_ENSMPUP00000001749 ---------..-----------------------ivqapnvdvkmtwlkeirsillkqqell...............
Mpf_ENSMPUP00000016475 ---------..-----------------------adgrvvegnhvvyrisapspeekeewmksirasisrdpfy...
Mpf_ENSMPUP00000013206 ---------..-----------------------spvapedrisrkysfkavhtgmraliynssaggsqaeqsgmrt
Mpf_ENSMPUP00000006140 KCHVFRCDT..P-AKAIATSLHEICSKIMA----e..........................................
Mpf_ENSMPUP00000005780 ---------..-----------------------avdqkpsvislqkliarevaneergmflisassagpemyeiht
Mpf_ENSMPUP00000001869 ---------..-----------------------qgkipvagmvvtrldeiegndntfeitgnierivihcnssqdf
Mpf_ENSMPUP00000012475 ---------..-----------------------ptpeekeewikcikaai..........................
Mpf_ENSMPUP00000008316 ---------..-----------------------rhynghytepytssq............................
Mpf_ENSMPUP00000001167 ---------..-----------------------nfffievgrsavtgpgefwmqvddsvvaqnmhetileamram.
Mpf_ENSMPUP00000008230 ---------..-----------------------epllfwpytllrrygrdkvmfsfeagrrcpsgpgtftfqtaqg
Mpf_ENSMPUP00000017717 ---------..-----------------------kttlectlrpglvynkvnpifhhwslgdckfgltfqspaeade
Mpf_ENSMPUP00000010272 ---------..-----------------------ydtytykqsfktaeigltenvgdsglrfeiwfrrrrksqdtyi
Mpf_ENSMPUP00000003964 ---------..-----------------------aptqeekeewiksiqaav.........................
Mpf_ENSMPUP00000017478 ---------..-----------------------kihntaknkwfvcmaktaeekqkwldaiirereq.........
Mpf_ENSMPUP00000010168 ---------..-----------------------sqgsnphcfeiitdtmvyfvgenngdsshnpvlaatgvgvdva
Mpf_ENSMPUP00000009546 ---------..-----------------------tisyfkceqdreplrtiflkdvlktheclvksgdllmrdnlfe
Mpf_ENSMPUP00000002870 ---------..-----------------------qgavmknwkrryfqldentigyfkselekeplrviplkevhkv
Mpf_ENSMPUP00000000151 ---------..-----------------------tenigdsglcfelwfrrrrareaytlqaaspeiklkwtssiaq
Mpf_ENSMPUP00000000216 ---------..-----------------------sgkertlelqasseqdkeewikalqdtidafhqrhetfrnaia
Mpf_ENSMPUP00000007012 ---------..-----------------------gaqgyelffktrelkkkwmeqfemaisniypenatanghdfqm
Mpf_ENSMPUP00000012096 ---------..-----------------------qgfqffcktedmkrkwmeqfemamsnikpdkananhhsfqmyt
Mpf_ENSMPUP00000004281 ---------..-----------------------lgvtehvegdpckfalwsgrtpssdnktvlkasnietkqewik
Mpf_ENSMPUP00000004460 ---------..-----------------------trftfeagrmcdageglytfqtqegeqiyqrvhsatlaiaeqh
Mpf_ENSMPUP00000011499 ---------..-----------------------sat........................................
Mpf_ENSMPUP00000003498 ---------..-----------------------rlwkrrwfvlsghclfyykdsreesvlgsvllpsysirpdgpg
Mpf_ENSMPUP00000006723 ---------..-----------------------klrlsngsewlfhgkdeeemlswlqgvstainesq........
Mpf_ENSMPUP00000006149 ---------..-----------------------lrrygrdaawftfeagrmcetgeglfifqtrdgeaiyqkvhsa
Mpf_ENSMPUP00000011052 ---------..-----------------------ndpckfaltsrtggvvetfilhssspsvrqtwiheinqilenq
Mpf_ENSMPUP00000015653 ---------..-----------------------htlywyrqpqdekaeglinvsnyslesgqdqkkkyvfqlthdm
Mpf_ENSMPUP00000014937 ---------..-----------------------mrnqgslrlilnsklwaqmeiqranhknlritatdledysikv
Mpf_ENSMPUP00000006713 ---------..-----------------------lcftvthykhskqqyniqaktaeekrswthhikrlilenhhtt
Mpf_ENSMPUP00000005370 ---------..-----------------------spppnssvltsgvgadvarmwemaiqhalm.............
Mpf_ENSMPUP00000017142 ---------..-----------------------kkvpsaltevaasgegsaisgyltrckkgkrhwkklwfvikgk
Mpf_ENSMPUP00000011052 ---------..-----------------------nkivlkassienkqdwikhireviqe.................
Mpf_ENSMPUP00000000930 ---------..-----------------------rasvtrrtfghsgiavhtwyacpaliksiwamaisqhqfyldr
Mpf_ENSMPUP00000016865 ---------..-----------------------vhdprrisvsrrtfgqsglfvqtwyanpsliksiwvmaisqhq
Mpf_ENSMPUP00000000090 ---------..-----------------------sygfylihtqgqnglefycktkdlkkkwleqfemalsnirpdy
Mpf_ENSMPUP00000012035 ---------..-----------------------clidisysetkrknvfrlttpdceclfqaedrddmlawiktiq
Mpf_ENSMPUP00000009068 ---------..-----------------------rviwaplgggifgqrledtvhherkygprlapllveqcvdfir
Mpf_ENSMPUP00000000172 ---------..-----------------------ffykthqddyplaslpllgysvsvpkeadgvhkehvfklqfks
Mpf_ENSMPUP00000013402 ---------..----------------R------hkfykqnkicteqsnspppirrqptwsrsslprqqpyilppmh
Mpf_ENSMPUP00000012726 ---------..-----------------------titdvrtttalempdrentfvvkvegpseyvletadalhvkaw
Mpf_ENSMPUP00000010329 ---------..-----------------------eplsfsvfhyknpklqhtvqaksqqdkrlwvlhlkrlilenha
Mpf_ENSMPUP00000005886 VCYVFQCTNe.ALVDEIMLTLKQAFTVAA-----vq.........................................
Mpf_ENSMPUP00000011911 GLFAFSSPR..--APDLCRAVAAA----------iarqrerlpelagprpcplpratslp.................
Mpf_ENSMPUP00000013895 ---------..-----------------------tpiflnevlvklptdpssdepvfhishidrvytlrtdninert
Mpf_ENSMPUP00000009754 ---------..-----------------------krfisvacisrvaaigdqkfevitnnrtfafraesdaerkewm
Mpf_ENSMPUP00000017452 ---------..-----------------------tdilvflqekdqkyvfasldqkstvislkklivrevaheekgl
Mpf_ENSMPUP00000004281 ---------..-----------------------servilqaanadiqqawvqdinqvletqrdfl...........
Mpf_ENSMPUP00000017577 ---------..-----------------------tsevasdykkkkhvfklqtqdgsefllqakdeeemngwleava
Mpf_ENSMPUP00000004977 ---------..-----------------------fpaldkpsvvslqnlivrdianqekgmflisaappemyevhta
Mpf_ENSMPUP00000017884 ---------..-----------------------eeqaagigksakivvhlhpappnkepgpfqssknsyiklsfke
Mpf_ENSMPUP00000007027 ---------..-----------------------sgyllkmgsrvktwkrrwfvlrqgqimyykspsdvirkpqgqv
Mpf_ENSMPUP00000012725 ---------..-----------------------llkgwkprwfvldvtkhqlryydsgedtnckghidlaevemvi
Mpf_ENSMPUP00000000871 ---------..-----------------------clpleegqavlqlgiegapqslsiktsslaeaenmadlvdgyc
Mpf_ENSMPUP00000006220 ---------..-----------------------vesssdvrkseeenlfeiitadevhyflqaatpkertewikai
Mpf_ENSMPUP00000008418 QCAAFWCQP..H-AGGLSEAVQAACMVQYQK---...........................................
Mpf_ENSMPUP00000003932 ---------..-----------------------qyfflevgrstvigpgelwmqvddcvvaqnmhelflekmral.
Mpf_ENSMPUP00000001861 ---------..-----------------------eglhgkwmfseiravfsrryllqntalevfmanrtsvmfnfpd
Mpf_ENSMPUP00000008418 KCHVFRCDV..P-AKAIASALHGLCAQILS----ervgvn.....................................
Mpf_ENSMPUP00000006249 ---------..-----------------------ylpgstvkeiatnpeevgkfvfevipaswdqsrtgqdsyvlma
Mpf_ENSMPUP00000003836 FCF------..-----------------------catsnqemkrwlqamdkaa........................
Mpf_ENSMPUP00000015858 ---------..-----------------------sshvmqviyeddagkaqtmylqckcvnelnqwlsalrkvsisn
Mpf_ENSMPUP00000002835 ---------..-----------------------rkghrtegmekfardvpedrcfsvvfkdqrntldliapspaea
Mpf_ENSMPUP00000004473 ---------..-----------------------nsmilycvpklrlmgqkfsvrekmdisglqvqdivkpnaaptf
Mpf_ENSMPUP00000000137 ---------..-----------------------ywfvlkdaslywyineedekaegfislpefkidrasecrkkym
Mpf_ENSMPUP00000001907 QRYVLQ---..-----------------------sadpavsqawikqvaqilesqrdfl..................
Mpf_ENSMPUP00000014024 ---------..-----------------------etfkaavqgpegdtqeqeqlqseelglrapqwvrdkmvtmcmr
Mpf_ENSMPUP00000001742 ---------..-----------------------tpfrrlmlcaenrkemedwmsslksvqtrepyevaqfnvehfs
Mpf_ENSMPUP00000000172 ---------..-----------------------pvphcfticaaqktvvvaastrlekekwicdlntaidaak...
Mpf_ENSMPUP00000005480 ---------..-----------------------itpcrklilcadnrkemeewiaalktvqnrehfeptqysmdhf
Mpf_ENSMPUP00000018515 ---------..-----------------------plenvtidsikdegdlrngwliktptksfavyaatateksewm
Mpf_ENSMPUP00000009502 ---------..-----------------------rildltecsavqfdysqervncfclvfpfrtfylcaktgvead
Mpf_ENSMPUP00000013672 ---------..-----------------------iiflskgrdamqsfmmpfylmkdceikqpvfganyikgtvkae
Mpf_ENSMPUP00000011336 ---------..-----------------------rllgqkfsvraridvdgmelkessnlnlprtflvsgkqrslel
Mpf_ENSMPUP00000001410 ---------..-----------------------kntdifrsngisdqisedcafsviygenyesldlvantadvan
Mpf_ENSMPUP00000003424 ---------..-----------------------hgevpvslaraqgsvafdyrkrkhvfklglqdgkeylfqakde
Mpf_ENSMPUP00000007040 ---------..-----------------------lhgkwlfteirsifsrryllqntaleifmanrvavmfnfpdpa
Mpf_ENSMPUP00000019493 ---------..-----------------------lavvnvkdnppmkdmfkllmfpesrifqaenakikrewlevle
Mpf_ENSMPUP00000018830 ---------..-----------------------leevtleplpetpraknrwmiktarksfvvsaasaterqewis
Mpf_ENSMPUP00000003141 ICYVFQCASe.SLVDEVMLTLRQAFSTA------a..........................................
Mpf_ENSMPUP00000010983 ---------..-----------------------tleirtakeiidntskengidiimadrtfhliaespedasqwf
Mpf_ENSMPUP00000010498 ---------..-----------------------avpngfifeggtrcgywagvfflssaegeqisflfdcivrgis
Mpf_ENSMPUP00000012786 ---------..-----------------------vhhalaskatdyekkpnvlklktadwrvllfqaqspeemqgwi
Mpf_ENSMPUP00000014114 ---------..-----------------------cedierrfcfevvsptkscmlqadseklrqawvravqasiasa
Mpf_ENSMPUP00000007256 ----FVAIKtaQAAEPVILDLRDLFQLIYELKQ-reelekk....................................
Mpf_ENSMPUP00000005608 ---------..-----------------------yyksedeteygcrgsiclskavitphdfdecrfdisvndsvwy
Mpf_ENSMPUP00000002033 ---------..-----------------------ktkhqlryydhrvdteckgvidlaeveavapgtptmgapktvd
Mpf_ENSMPUP00000016751 VCYIFESNN..E-GEKICDSVGLAKQIA------lhaeldrr...................................
Mpf_ENSMPUP00000016435 ---------..-----------------------akptfsisdvesvregqesellrslaeelpleqgftivfhgrr
Mpf_ENSMPUP00000001167 ---------..-----------------------fninkradsknkhlvalytrdehfaiaadneaeqdswyqallq
Mpf_ENSMPUP00000001585 ---------..-----------------------ltcltdqnstvkncakftlvlpkeevqlktrnpttgkswtalc
Mpf_ENSMPUP00000002351 ---------..-----------------------fkksmklvtlsirqlgrgssrkfeiahrngpekyilqaaskei
Mpf_ENSMPUP00000011499 ---------..-----------------------phcltlrgqrqsvvvaassrsemekwvediqmaidla......
Mpf_ENSMPUP00000005375 ---------..-----------------------aypvvqmatqsgknvyltvtkesgnsvvllfkmistraasgly
Mpf_ENSMPUP00000015986 FCHLFVGNQp.GEVQILHLLLCRSFQLAY-----...........................................
Mpf_ENSMPUP00000004747 QIHVFSCEIk.EAVSRILYSFCTAFKRSSRQ---vtdv.......................................
Mpf_ENSMPUP00000009754 ---------..-----------------------efsrrwcvlsdgvlsyyeneravtpngeiraseivclavpppd
Mpf_ENSMPUP00000002257 ---------..-----------------------wretkkisfskkkitlqntsdgikhafqtdnskvcqyllhlcs
Mpf_ENSMPUP00000006734 ---------..-----------------------tkavkkaertkvirppllvdkivcrelrdpgsflliylnefhs
Mpf_ENSMPUP00000003502 RCNVFKSKKk.SQAMRIVRTVGQAFEVCHKLS--l..........................................
Mpf_ENSMPUP00000011019 ---------..-----------------------ieqivtvndhkrkqkvlgpnqklkfnpteliiyckdfrivrfr
Mpf_ENSMPUP00000003673 ---------..-----------------------clllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrv
Mpf_ENSMPUP00000000383 ---------..-----------------------gvgfdfkwphsqireihlrrynlrrsaleifhvdqsnyflnfk
Mpf_ENSMPUP00000008997 ---------..-----------------------latrasdyskksnvlklktadwrvflfqapskeemlswilrin
Mpf_ENSMPUP00000010040 ---------..-----------------------dlrlctvklcpdserrfcfevvspskscllqadserllhrwvs
Mpf_ENSMPUP00000007257 ---------..-----------------------yrskgnkkpwkhlwfviknkvlytyaasedvaalesqpllgft
Mpf_ENSMPUP00000016774 ---------..-----------------------ihhalatrasdyskrphvfylrtadwrvflfqapsleqmqswv
Mpf_ENSMPUP00000001960 ---------..-----------------------qwakqlcvikdtrllcyksskdhspqldvnllgssvihkekqv
Mpf_ENSMPUP00000007610 ---------..-----------------------iyhgshresldlvspsgdeartwvtglrylm............
Mpf_ENSMPUP00000017612 KGHIFCCN-..-----------------------lsvsesprdplgfkvsdltipkhrhllqaknqeekrlwihclq
Mpf_ENSMPUP00000007907 ---------..-----------------------keirlgkntetfrnngladqicedsafsilhgenyesldlvan
Mpf_ENSMPUP00000014021 RIHVFRCEIq.EAVSRILYSFATAFRR-------sak........................................
Mpf_ENSMPUP00000008982 ---------..-----------------------wreirkistcrkkftitssitgkkhtfvtdsaktckyllrlcs
Mpf_ENSMPUP00000005803 ---------..-----------------------plsaistvrvqgdnkfevvttqrtfvfrvekeeerndwisill
Mpf_ENSMPUP00000002728 ---------..-----------------------vtegrqseifhrqaeghfdpsccftiyhgnhmesldlitsnpe
Mpf_ENSMPUP00000007017 ---------..-----------------------ggfslrgslvsaledngvptgvkgnvqgnlfkvitkddthyyi
Mpf_ENSMPUP00000003752 ---------..-----------------------iqlfrenqgvarvetsimdakplvllmewpeatnfacliagyc
Mpf_ENSMPUP00000001306 ---------..-----------------------pkshllykmyktpiflnevlvklptdpsgdepifhishidrvy
Mpf_ENSMPUP00000005338 ---------..-----------------------ksftldfgdyqdgyysvqttegeqiaqliagyidii.......
Mpf_ENSMPUP00000001689 ---------..-----------------------ciyldacidvvqcpkmrrhafelkmldkyshylaaeteqemee
Mpf_ENSMPUP00000010415 ---------..-----------------------gqwskllcvvkdarllcyksskdqqpqmelplqgcnitytpkd
Mpf_ENSMPUP00000006220 ---------..-----------------------kkksdnspkgmiplkgstltspcqdfgkrmfvfkitttkqqdh
Mpf_ENSMPUP00000016350 ---------..-----------------------gylhfkeplysnwakhfvvvrrpyvfiynsdkdpvergvinls
Mpf_ENSMPUP00000018773 RCHAVLVSKp.EKAQAMALLLYQTSANALAEF--krlkrrd....................................
Mpf_ENSMPUP00000017599 ---------..-----------------------nslkq......................................
Mpf_ENSMPUP00000016349 ---------..-----------------------gylhfkeplysnwakhfvvvrrpyvfiynsdkdpvergvinls
Mpf_ENSMPUP00000015036 ---------..-----------------------tkrrhvfrlttadfceylfqaedrddmlgwirairensraege
Mpf_ENSMPUP00000007938 ---------..-----------------------fpkgvipltaiemtrsskdnkfqvitgqrvfvfrteseaqrdt
Mpf_ENSMPUP00000007257 ---------..-----------------------slagmkvrkptqeayqnelkiesversfilsassaterdewle
Mpf_ENSMPUP00000005203 ---------..-----------------------neekkqyresyisdsldldvdqlekrsrasgss..........
Mpf_ENSMPUP00000000650 ---------..-----------------------ksftldfgeyqesyysvqttegeqisqliagyidii.......
Mpf_ENSMPUP00000007937 ---------..-----------------------vyvvhdslfgrpncfqivvqhfseehyifyfagetpeqaedwm
Mpf_ENSMPUP00000007017 ---------..-----------------------ktrtsteyfleacsreerdawafeitgaihagqpgkvqqlhil
Mpf_ENSMPUP00000012780 ---------..-----------------------ahfdtedscgivltsgartyhlkasseverqqwitalelakak
Mpf_ENSMPUP00000002522 ---------..-----------------------fshvnriemfteedsfvrvelhvldvkpitllmessdamnlac
Mpf_ENSMPUP00000004905 ---------..-----------------------ltdevpwessgdpgiyfslvlrnqeikfkaeslesremwkgfi
Mpf_ENSMPUP00000011326 ---------..-----------------------rrfafelkmqdkssyllaadseaemeewitilnkilqlnfeaa
Mpf_ENSMPUP00000009449 ---------..-----------------------kkphvfqlrtadwrlylfqaptakemsswivrinlaaathsap
Mpf_ENSMPUP00000000014 ---------..-----------------------eypvqrnygfqihtkegeftlsamtsgirrnwiqtimkhvhpt
Mpf_ENSMPUP00000012737 ---------..-----------------------fqihtkdavytlsamtsgirrnwiealrktvrpt.........
Mpf_ENSMPUP00000002136 ---------..-----------------------glkrq......................................
Mpf_ENSMPUP00000017782 ---------..-----------------------gitivtperrfllacetemeqrawveafrkvvdrpmlpqeya.
Mpf_ENSMPUP00000013550 ---------..-----------------------kdkkcillrikggkqfvlqcesdpefvqwkkeltetfteaqrl
Mpf_ENSMPUP00000017362 ---------..-----------------------madwlkirgtlkswtklwcvlkpgvlliyktqkngqwvgtvll
Mpf_ENSMPUP00000006996 ---------..-----------------------eddstftitvdqktfhfqardaderekwihaleetilrhtlql
Mpf_ENSMPUP00000004785 ---------..-----------------------rsaakkrffsfsvvtespnpaltfcvkthdrlyymvapsaeam
Mpf_ENSMPUP00000014164 ---------..-----------------------lrkkrfgqwakqltvikedqllcyksskdrqphlrlaldvcsv
Mpf_ENSMPUP00000016592 ---------..-----------------------gwlykgnfnstvnntvtvrsfkkryfqltqlpdnsyimnfykd
Mpf_ENSMPUP00000000486 ---------..-----------------------ifpqdvlrlraetrqraeewmealktaanvarsteqnlqvtlr
Mpf_ENSMPUP00000003712 ---------..-----------------------edierrfcfevvsptkscmlqadseklrqawikavqtsiatay
Mpf_ENSMPUP00000006850 ---------..-----------------------vyydhlrcafkspnprltfcvktyerlfymvapspeamriwmd
Mpf_ENSMPUP00000015574 ---------..-----------------------sffflelgrsaptgpgelwlqapdalvaqsihetvlaamkrl.
Mpf_ENSMPUP00000014962 ---------..-----------------------gsaerveteegighdfrrplaqlrevhlrrfnlrrsalelffi
Mpf_ENSMPUP00000016814 ---------..-----------------------lnkakvirpplmleklvcrplrdpnsflvihltefdcvssali
Mpf_ENSMPUP00000000139 ---------..-----------------------staqveysedqqamlktpntfavctehrgillqansdkdmhdw
Mpf_ENSMPUP00000012020 YCF------..-----------------------qittpngksgiilqaesrkeneewicainni............
Mpf_ENSMPUP00000006069 ---------..-----------------------kvsmvkvylqdvkvltlllesnsakdlacliagyyrlfvdpdt
Mpf_ENSMPUP00000017142 ---------..-----------------------smkvsrpvmekvpyalkietsqscltlsasscaerdewhscls
Mpf_ENSMPUP00000013991 -CHSFC---..-----------------------vitpqrkvtlaapnrkdmeewinviktvqqgeirkipaaennp
Mpf_ENSMPUP00000010353 ---------..-----------------------psqlkrtcsifayedikevhkrryllqpiavevfsgdgrnyll
Mpf_ENSMPUP00000000014 ---------..-----------------------ltpekehfiraetkeiisgwlemlmvyprtnkqnqkkkrkvep
Mpf_ENSMPUP00000009546 ---------..-----------------------sqryflqandqkdlkdwvealnqaskitv..............
Mpf_ENSMPUP00000012020 STYVFESNS..E-GEKICYAIN------------lgk........................................
Mpf_ENSMPUP00000016751 YCF------..-----------------------qitsfdgkkssilqaeskkdheewictinni............
Mpf_ENSMPUP00000000216 ---------..-----------------------sgnsvvcsflqymekskpwqkawcvipkqdplvlymygapqdv
Mpf_ENSMPUP00000010854 ---------..-----------------------ettsnnvfpfkivhiskkhrtwffsassederkswmallrkei
Mpf_ENSMPUP00000016813 ---------..-----------------------kaepqellqldgytvdytdpqpgleggraffnavkegdtvifa
Mpf_ENSMPUP00000002870 ---------..-----------------------cfvmnagmrkyflqandqqdlvewvnvlnkaikitvp......
Mpf_ENSMPUP00000003651 ---------..-----------------------cgahiewakekssrknvfqittvsgnefllqsdidfiildwfh
Mpf_ENSMPUP00000002370 ---------..-----------------------khewfeailkerer.............................
Mpf_ENSMPUP00000006780 ---------..-----------------------elmqlegytvdytdphpglqggqmffnavkegdtvifasddeq
Mpf_ENSMPUP00000002802 -C-------..-----------------------nnpekatvvnqdgqpliegklkekqvrwkfikrwktryftlag
Mpf_ENSMPUP00000011336 ---------..-----------------------agerpdrrhvfkitqshlswyfspeteelqrrwmavlgra...
Mpf_ENSMPUP00000003120 ---------..-----------------------ntrmeliipgeqhfymkavnaaerqrwlvalgss.........
Mpf_ENSMPUP00000005803 ---------..-----------------------eiylpseraflfgaetsqaqrkwteaiakhfvpfvaenltead
Mpf_ENSMPUP00000004980 ---------..-----------------------eiqvhsvdntrmdliipgeqyfylkarsvaerqrwlvalgsak
Mpf_ENSMPUP00000015621 ---------..-----------------------rlqrq......................................
Mpf_ENSMPUP00000003141 ACHVFRATDp.NQVPDVISSIRQLSKAAMKE---d..........................................
Mpf_ENSMPUP00000013099 ---------..-----------------------ktnpeekkcfdlishdrtyhfqaedeqecqiwmsvlqnskeea
Mpf_ENSMPUP00000010983 ---------..-----------------------fketgywnvtvygrkhcyrlytkllneatrwssaiqnvtdtka
Mpf_ENSMPUP00000004910 ---------..-----------------------celierpskkdgfcfklfhpldqsvwavkgpkgesvgsitqpl
Mpf_ENSMPUP00000016233 ---------..-----------------------mmpfdlmsnctveqpvftpnfikgiiqaapdggwegqatfkla
Mpf_ENSMPUP00000002953 ---------..-----------------------yeeikevhkrwwqlrdnaveifltngrtlllafdntkvrddvy
Mpf_ENSMPUP00000011716 ---------..-----------------------vcrdgktislcaestddclawkftlqdsrtntgy.........
Mpf_ENSMPUP00000007767 ---------..-----------------------eerdlwmqklnqilv............................
Mpf_ENSMPUP00000014585 ---------..-----------------------neqgygvyedlpkgirgnrwkagltivtperrflftcpsekeq
Mpf_ENSMPUP00000014164 ---------..-----------------------kerwcrlkcntlyfhkdhtdlrthvnaialrgcevapgfgprh
Mpf_ENSMPUP00000005886 ICYVFKADDq.TKVPEIISSIRQAGKIARQE---...........................................
Mpf_ENSMPUP00000013797 ---------..-----------------------argskglafqgllplmelsvcplegsrehafqitgplpaplhv
Mpf_ENSMPUP00000004108 ---------..-----------------------asgeqyklratdakerqhwvsrlqictqhhteaigknnpplks
Mpf_ENSMPUP00000009167 ---------..-----------------------eikeirpgknskdferakvvhqkkdccftifygtqfvlstlsl
Mpf_ENSMPUP00000016226 ---------..-----------------------qypdrtdvtpllsvnmggeqcggcrranttdrphafqviladr
Mpf_ENSMPUP00000014024 ---------..-----------------------llgyqvtagtqadsrvfqlqqsgqlytfkaeteelrdrwvkam
Mpf_ENSMPUP00000008448 ---------..-----------------------tyfhitignlvrgskllcetslgykmddlltsyisqm......
Mpf_ENSMPUP00000010607 SCHVFMVDP..D----------------------lfshkihqgiarrfgfectadpdtngc................
Mpf_ENSMPUP00000015774 ---------..-----------------------ppvkltlltcqvrpnpeekkcfdlvthnrtyhfqaedehecea
Mpf_ENSMPUP00000008639 ---------..-----------------------iffvqhieavreghqseglrrfggafpparcltiafkgrrknl
Mpf_ENSMPUP00000012941 ---------..-----------------------skdksskknvfelktrqgtelliqsdndtvindwfkvlsstis
Mpf_ENSMPUP00000016218 ---------..-----------------------pvqelvledlqdgdvrmggsfrgafsnsdkaknifrvrfqdps
Mpf_ENSMPUP00000007001 ---------..-----------------------dhapfssirgekcemklhgphknlfrlfllhnaqgtqaeflfs
Mpf_ENSMPUP00000001986 ---------..-----------------------tygknsmdqssaprcalfaedsivqsvpehpkkenvfclsnsf
Mpf_ENSMPUP00000010415 ---------..-----------------------vsvplrgcdvipgldskhpltfrllrngqevavleasssedmg
Mpf_ENSMPUP00000003836 ---------..-----------------------sfkqsvieleppseefktfyfcaenktenqrwimalkasikk.
Mpf_ENSMPUP00000007027 ---------..-----------------------sdedyeaggsrrllsshctlvihppehsptylligtkhekdtw
Mpf_ENSMPUP00000002688 ---------..-----------------------nvndyslrdqllvescdneelnsspgknsstmlysrqssanhl
Mpf_ENSMPUP00000001373 ---------..-----------------------lnlltcqvkpnaedkksfdlishnrtyhfqaedeqdyvawisv
Mpf_ENSMPUP00000013700 ---------..-----------------------efllllnsptipfrihnrngksylfllssdyersewreaiqkl
Mpf_ENSMPUP00000016589 ---------..-----------------------tyfhmalgslargsrllcetslgykmddlltsyvqq.......
Mpf_ENSMPUP00000015325 ---------..-----------------------sgkeplekqhyftvnfshenqkalelrtedakdcdewvaaiah
Mpf_ENSMPUP00000001960 ---------..-----------------------evvpdpspdhlysfrilhrgeevakleaksseemghwlgllls
Mpf_ENSMPUP00000006310 ---------..-----------------------nvnweirqvaiefdqnvsiaftclsadckivheyiggyifls.
Mpf_ENSMPUP00000016747 --HVFLFQE..--VLVITRAVTHNEQLCYQLY--rqpipvkdllledlqdgevrlggslrgafsnneriknffrvsf
Mpf_ENSMPUP00000013323 ---------..-----------------------lkvkseeifdewvsklrhh........................
Mpf_ENSMPUP00000007350 ---------..-----------------------pkgviplggclveareepsmpyamkishqdfhgnillaaesef
Mpf_ENSMPUP00000017588 ---------..-----------------------idireikeirpgktsrdfdryqedpafrpdqshcfvilygmef
Mpf_ENSMPUP00000007745 ---------..-----------------------klpvadikavvtgkdcphmkekgalkqnkevlelafsilydsn
Mpf_ENSMPUP00000006409 ---------..-----------------------tfeiktpsrvitlkaatkqvmlywlqqlqtkrwefhss.....
Mpf_ENSMPUP00000015574 ---------..-----------------------iskrvdarqrhlivlytrdrslgvaaaceaeqqawysalle..
Mpf_ENSMPUP00000008365 ---------..-----------------------dkssrknvlelrsrdgseyliqhdseaiistwhkaigegiqel
Mpf_ENSMPUP00000001054 ---------..-----------------------tsqtelenwitaihsacaaavarhhhkedtlrllkseikkleq
Mpf_ENSMPUP00000017488 ---------..-----------------------pvadikaivtgkdcphmkeksalkqnkevlelafsilydpdet
Mpf_ENSMPUP00000005234 ---------..-----------------------lfndllvicrqipgdkyqvfdsaprgllrveeledqgqtlanv
Mpf_ENSMPUP00000013182 ---------..-----------------------nvsgqkfcikllvpspegmsevylrcqdekqyahwmagcrlas
Mpf_ENSMPUP00000011513 ---------..-----------------------eysqpeqklpktcssssdngknepleksgyllkmsgrvktwkr
Mpf_ENSMPUP00000005385 ---------..-----------------------qwnvnweikmvtvefadevrlsfictevdckvvhefiggyifl
Mpf_ENSMPUP00000009077 ---------..-----------------------nmcskdrssdhyscqshsygdlrelrqarfllqdialelffqn
Mpf_ENSMPUP00000001767 ---------..-----------------------idaidkrfvgplgtiiikckdfriiqldipgmeeclniassie
Mpf_ENSMPUP00000007827 ---------..-----------------------vtlksctrrktdsiekrfcfdveavdrpgvitmqalseedrrl
Mpf_ENSMPUP00000000541 ---------..-----------------------lrallkrkhrfilqrspgnkvsdikfqatsgeekeswikalne
Mpf_ENSMPUP00000001809 ---------..-----------------------svdlrgaalahgrhlssrrnvlhirtvpghefllqsdqeiewr
Mpf_ENSMPUP00000005803 ---------..-----------------------hwhiccdslqtqmewmanvfiaqhendirppagkerkrsitkn
Mpf_ENSMPUP00000013182 ---------..-----------------------qvaiefdehinvafscvsascrivheyiggyifls........
Mpf_ENSMPUP00000005315 ---------..-----------------------sksrskknhskftlahskqpgntapnliflavspeekeswisa
Mpf_ENSMPUP00000014585 ---------..-----------------------lnatfetekignphglqityrreghvrnlfvyhesgkeivdwf
Mpf_ENSMPUP00000015166 ---------..-----------------------vmsinkkaqridldtedniyhlkiksqdlfqswvaqlrahrlt
Mpf_ENSMPUP00000002409 ---------..-----------------------esdgsllleskinpntayqkqqdtlivwseaenydlalsfqek
Mpf_ENSMPUP00000005807 ---------..-----------------------ykdeeekekkymlpldnlkirdvekgfmsnkhvfaifnteqr.
Mpf_ENSMPUP00000013796 ---------..-----------------------fseeaeglcfkgelplstihvnleekekqirsfliegplinti
Mpf_ENSMPUP00000017782 ---------..-----------------------trnifvyhedgkeivdwfnalraar..................
Mpf_ENSMPUP00000019464 ---------..-----------------------apvseefafaicfdapgvrphllaadgpaaqeawvkalsrasf
Mpf_ENSMPUP00000012725 ---------..-----------------------tmqnqlqqnmqeglqitsasfqlikvafdeevspevveifkkq
Mpf_ENSMPUP00000010996 ---------..-----------------------npvagqavthifvadnredlqkwmeafwqhffdlsqwkhccee
Mpf_ENSMPUP00000007938 ---------..-----------------------kksskperewplegskvylgirkkfkpptpwgftlilekmqly
Mpf_ENSMPUP00000009654 ---------..-----------------------kigqechdvqppegrsrdglltvnlregsrlhlcaetkddaia
Mpf_ENSMPUP00000005385 ---------..-----------------------vnisgqkfnikllipvaegmneiwlrcdnekqyahwmaacrla
Mpf_ENSMPUP00000006310 ---------..-----------------------vvpdvnvagrkfgikllipvadgmnevylrcdhenqyaqwmaa
Mpf_ENSMPUP00000007963 ---------..-----------------------fylvaeteedmnkwvqsicqicgfnqaeestdslrnlssss..
Mpf_ENSMPUP00000002310 ---------..-----------------------skdmsslhispnsgnvtsasgsqmasgislgsfgsrpdgmqqr
Mpf_ENSMPUP00000000486 ---------..-----------------------gnqalyatyqlshfqsisvlgnlearlvdtvlydntqlqlkae
Mpf_ENSMPUP00000007805 ---------..-----------------------sllleskinpntayqkqqdtlivwseaenydlalsfqekagcd
Mpf_ENSMPUP00000010246 ---------..-----------------------rrhglmplglevfcteddlcsdiylkfyepqdrddlyfyi...
Mpf_ENSMPUP00000004460 TC-------..-----------------------dseleaeewyktlsv............................
Mpf_ENSMPUP00000014791 ---------..-----------------------fiasvalhrllvedipdskyiknafilhgpkcewicatevedd
Mpf_ENSMPUP00000003154 ---------..-----------------------arridldteehiyhlkvksqdwfdawvsklrhhrlyrqnei..
Mpf_ENSMPUP00000005214 ---------..-----------------------pcggllslsfpheklllmctdqeellhwhhsltlaissqk...
Mpf_ENSMPUP00000003932 ---------..-----------------------svsqradakyrhlialftqdeyfamvaeneseqeswylllsrl
Mpf_ENSMPUP00000008710 ---------..-----------------------pranglaserstsqlgggtgapysasnpawagprpeglhqrsc
Mpf_ENSMPUP00000005632 ---------..-----------------------eegaspptldslpeqlpvadikalltgkdcphvrekgsgkqnk
Mpf_ENSMPUP00000002828 ---------..-----------------------sqikndiqrekrankgskaierlkkklseqesllllmspsmaf
Mpf_ENSMPUP00000017859 ---------..-----------------------ekqattatgcpllircknfqllqliipqerdchdvyislirla
Mpf_ENSMPUP00000013754 ---------..-----------------------akslrgtdrkhykstpgkkvsvvgwmvqlpddpehpdifqlnn
Mpf_ENSMPUP00000004548 ---------..-----------------------vrrktesidkrfcfdietnerpgtitlqalseanrrlwmeamd
Mpf_ENSMPUP00000000646 ---------..-----------------------eklalttsgcplviqcknfrivhfivprerdchdiynsllqls
Mpf_ENSMPUP00000004473 ---------..-----------------------vldpverpdsrhvwrlqqaqqtlylstpsadlrqqwlealsaa
Mpf_ENSMPUP00000000402 ---------..-----------------------hpqiqkksqyikylccddmrtlhqwvngiriakygkql.....
Mpf_ENSMPUP00000007412 ---------..-----------------------vlvvtkkksedsfmvqdyaqvdhirvqkmepsdpgllggggtr
Mpf_ENSMPUP00000004935 ---------..------------A----------sqegsnesrivtihkqdgknleielsslkealsfvslidgyyr
Mpf_ENSMPUP00000011513 ---------..-----------------------yeasgrsllsthytivihpkdqgptylligskhekdtwlyhlt
Mpf_ENSMPUP00000001759 ---------..-----------------------pemfklkscirrktdsidkrfcfdievverhgiitlqafsean
Mpf_ENSMPUP00000008353 ---------..-----------------------edewvniqyp.................................
Mpf_ENSMPUP00000012083 ---------..-----------------------cfvlkhpqiqkesqyikylccddartlnqwvmgiriaky....
Mpf_ENSMPUP00000006956 ---------..-----------------------ctkrhtdsidrrfcfdveaadrpgaaltmqafseeerkqwlea
Mpf_ENSMPUP00000014860 ---------..-----------------------pnklrnghkglrvfcsedeqsrgcwlaafrlfkygaqly....
Mpf_ENSMPUP00000009647 ---------..-----------------------ilvtysfrqsfplvemhmqlfqnsyyqfgikllsavpggerkv
Mpf_ENSMPUP00000005803 ---------..---KQVDRTVKQSFEI-------itpyrsfsftaesekekqewieavqqsiaetlsdy........
Mpf_ENSMPUP00000005109 ---------..-----------------------vsvvgwmvmmaddpehpdlflltdsekgnsykfqagnrmnaml
Mpf_ENSMPUP00000006149 ---------..-----------------------varlpkstkkhaigiyfnddtsktfacesdleadewckvlqme
Mpf_ENSMPUP00000001981 ---------..-----------------------gkemdllrttvkvpgkrppraisafgpsasinglvkdmstvqm
Mpf_ENSMPUP00000017916 ---------..-----------------------sstytfcksvgllgmqfhlfeneyyshgitlvtplsgsekkqv
Mpf_ENSMPUP00000003318 ---------..-----------------------ascvdevgegntnalksfvlgwptvnfvatfsspeqkdkwlsl
Mpf_ENSMPUP00000017175 ---------..-------------F---------slygmqvllfenqyypngirltsavpgadikvlinfnapnpqd
Mpf_ENSMPUP00000016038 ---------..-----------------------ylvaktevemlvwvysisqvcnlgql.................
Mpf_ENSMPUP00000016192 ---------..-----------------------rrkelgkfavfvharmaelqvkdlsrklqgvpghvfllqllhg
Mpf_ENSMPUP00000015325 -------T-..-----------------------rgsggklhltkngvislidctlledpenteedakganqdidhl
Mpf_ENSMPUP00000000660 ---------..-----------------------nsdiyvslagkkkhgaptnygfcfkpnkaggprdlkmlcaeee
Mpf_ENSMPUP00000005493 ---------..-----------------------splkfipeeilihgrdfrllrvafeagglepqafqvtmaivra
Mpf_ENSMPUP00000009754 ---------..-----------------------etekhekqqwylccetqmelrewfatflfvqhdglvwpsepsr
Mpf_ENSMPUP00000013796 ---------..-----------------------rgskglafqgllplmelsvcplegsrehafqitgvwgawtvgr
Mpf_ENSMPUP00000010667 ---------..-----------------------raklfrfdaeskewkergiapasf...................
Mpf_ENSMPUP00000013126 ---------..-----------------------vlpdnyslnhlhewvssllpsppapscrnvykdyrqlelacet
Mpf_ENSMPUP00000018046 ---------..-----------------------kgaskeprhlqllggleessvfsliagkkqysaptdygfcikp
Mpf_ENSMPUP00000006359 ---------..-----------------------lnlvafqeevakewtnevfslatnllaqn..............
Mpf_ENSMPUP00000015086 ---------..-----------------------evkrivsgiihhtqvpkllkrlflfsy................
Mpf_ENSMPUP00000008387 -------T-..-----------------------rssggklhllktggvlsliectlieepdasdddskgsgqvfgh
Mpf_ENSMPUP00000015207 ---------..-----------------------ay.........................................
Mpf_ENSMPUP00000004217 DCHAVECESklE-AKKLAHAMMEAFKKT------fhsmk......................................
Mpf_ENSMPUP00000015689 ---------..-----------------------tvtrtdnqileaefpglpaalsfvalvdgyfrlisdsrhffck
Mpf_ENSMPUP00000015159 ---------..-----------------------rckdlrvlqldiegveatldiarsiealsslesvitsfpffyr
Mpf_ENSMPUP00000018833 ---------..-----------------------aalileskinsntpyqkqqetliiwsegenhgvalsfqdtegc
Mpf_ENSMPUP00000007866 ---------..-----------------------nrygedevthtlqtesrgalhswmealwqlffdmsqwkqccde
Mpf_ENSMPUP00000007938 RCFSFTAES..-----------------------ggarqswaaalqeavtetlsdyevaekiwsn............
Mpf_ENSMPUP00000010694 ---------..-----------------------nafqviavdgvcsgiiqclsaedcvdwlqaiatnis.......
Mpf_ENSMPUP00000013131 ---------..-----------------------ckvircqfstfeqcqewlkrlnnairppakiedlfsfay....
Mpf_ENSMPUP00000000312 ---------..-----------------------vsstpqektkwlraisqavdqalrgtsd...............
Mpf_ENSMPUP00000019132 ---------..-----------------------farikavecvestgrhiyftlvtegggeidfrcp.........
Mpf_ENSMPUP00000015959 ---------..-----------------------lrrhfqpsqdnlereetwlsvwvhe..................
Mpf_ENSMPUP00000012612 ---------..-----------------------gegkvvegkhesyrisassaeerdqwieairasitrvpfy...
Mpf_ENSMPUP00000007938 ---------..-----------------------isnkagpppprrgrdapprlwcvlraalemfasesspeplsli
Mpf_ENSMPUP00000007989 ---------..-----------------------rlqvldyahrslvqaqqvpdpsgpptfrlsllsnhqgrpthrl
Mpf_ENSMPUP00000016156 ---------..-----------------------kdnefkekgvgtlhlkptatqktqllvradtnlalla......
Mpf_ENSMPUP00000013721 ---------..-----------------------hpsarhyyfcmmteaeqdkwqavlqdcirhcn...........
Mpf_ENSMPUP00000005447 ---------..-----------------------ektnfqnhkghefiptlyhfpanceacakplwhvfkpppalec
Mpf_ENSMPUP00000015768 ---------..-----------------------ldtlcpvssgehtqeesdpllempvnfplflqhpfrrhlcfsa
Mpf_ENSMPUP00000004215 ---------..-----------------------irlsdclrvaeasgeassprdtsaffletkerqyqlaapaser
Mpf_ENSMPUP00000010108 ---------..-----------------------garrlrslvltslcsvtgperrpketglwsvtvsgrkhsvrlc
Mpf_ENSMPUP00000002188 ---------..-----------------------vgdeqqlnswmaelrectgq.......................
Mpf_ENSMPUP00000013446 ---------..-----------------------lyanegeskkeqefpvepvgeksnyichkghefiptlyhfptn
Mpf_ENSMPUP00000012407 ---------..-----------------------prlspasgalmqaldlrdpqfsatpvlasdvihaqsrdlpcif
Mpf_ENSMPUP00000017043 ---------..-----------------------acyrwskrwlivkdsfllymkpdsgaiafvllvdkefkikvgk
Mpf_ENSMPUP00000007898 ---------..-----------------------lylqsvklqegssedlkfcvlylaekaeclftleahsqeqkk.
Mpf_ENSMPUP00000017064 ---------..-----------------------lmplsqikkvldiretedchnafallvrppteranvllsfqmt
Mpf_ENSMPUP00000009754 ---------..-----------------------pyrifsfsaeselekeqwleamqgaiaealstse.........
Mpf_ENSMPUP00000016461 ---------..-----------------------lnevtvlvpvlnetkhsfalytpertrqrwpvrlaaateqdmn
Mpf_ENSMPUP00000008230 ---------..-----------------------cvsvvpvsvesppepgaaafrldtaqrshllaadapssaawvq
Mpf_ENSMPUP00000001993 ---------..-----------------------clpdevmsirttnreyfligqdrekikdwvsfvssfclgget.
Mpf_ENSMPUP00000014500 ---------..-----------------------aqtyhlkasseverqrwvtalelakakavkml...........
Mpf_ENSMPUP00000002405 ---------..-----------------------ravkpnkdnsrrvdnvl..........................
Mpf_ENSMPUP00000002933 ---------..-----------------------pveefelclpdgdvsihgavgaselantakadvpyvlkmeshp
Mpf_ENSMPUP00000007268 ---------..-----------------------avhpnkdnsrrv...............................
Mpf_ENSMPUP00000010983 ---VLH---..-----------------------cnadtpeemhhwitllqrsk.......................
Mpf_ENSMPUP00000010498 ---------..-----------------------ahtlailclsqavmlgfesreamcawdtriryalgevhrfhva
Mpf_ENSMPUP00000018101 ---------..-----------------------saprnrysvpiladsenekwewvrvlrdlhktl..........
Mpf_ENSMPUP00000002033 ---------..-----------------------vaaltkekrisvqtpvdqllqdglqlrsctfqllkmafdeevg
Mpf_ENSMPUP00000010694 HCFTVQSES..--GEDLYFSV-------------elesdlaqwerafqtat..........................
Mpf_ENSMPUP00000008353 ---------..-----------------------pdtslggpsffkiitakavlklqagsaeeaalwrdlvrkvlas
Mpf_ENSMPUP00000009754 ---------..-----------------------qgerrldftgwlgaiqkaaassgdtlseqqlgdsdipvivyrc
Mpf_ENSMPUP00000015718 ---------..-----------------------ssvlasdvihasrkdipcifrvtasqlsasdsrcsvlmlaese
Mpf_ENSMPUP00000002358 ---------..-----------------------kkgwqrayavvcdcklflydlpegkstqpgvvasqvldlrdee
Mpf_ENSMPUP00000005077 ---------..-----------------------erdkwmenlrrtvqpnkdncrraen..................
Mpf_ENSMPUP00000009107 ---------..-----------------------erpghqhgrkhafslrlssrvetpwaapsegqaesripalssa
Mpf_ENSMPUP00000016101 ---------..-----------------------lalqrlmrvkeeeihsankcrlrlllpgkpdksgrpisfmvvf
Mpf_ENSMPUP00000011911 ---------..-----------------------rgerrvirladcvsvlpadgescpkdtsaflltttershllaa
Mpf_ENSMPUP00000007938 ---------..-----------------------adtpdkkehlvlvetgrtlylqgegrldfsawntaiegaaggg
Mpf_ENSMPUP00000009676 ---------..-----------------------ttlkrksgslrrssmslytaasvidtaskykllwklpledadi
Mpf_ENSMPUP00000005809 ---------..-----------------------khltqavctvkstdsclffikcfddtihg..............
Mpf_ENSMPUP00000016410 H--------..-----------------------clafsssgpqsqtyyicfdtfteylrwlrqvskvasqrissv.
Mpf_ENSMPUP00000006638 ---V-----..-----------------------svhsqdnksleltlpsramalslvslvdgyfrltadsshylcr
Mpf_ENSMPUP00000005803 ---------..-----------------------ekgrtlyihghskldftvwhtaiekaagtdgn...........
Mpf_ENSMPUP00000010983 ---------..-----------------------lkdetflwfrskqe.............................
Mpf_ENSMPUP00000000717 ---------..-----------------------melklssheealsfvslidgyfrltadahhylct.........
Mpf_ENSMPUP00000002793 ---------..-----------------------gssdgagenrcppvhppeslavvanakpnqvyvgpgqlyqdlq
Mpf_ENSMPUP00000007833 ---------..-----------------------ilplvggkveevkrrqhslafssagaqaqtyhvsfetlaecqr
Mpf_ENSMPUP00000002271 ---------..-----------------------fgggifg....................................
Mpf_ENSMPUP00000010974 ---------..-----------------------elacdsqedvdswkasflragvy....................
Mpf_ENSMPUP00000010755 ---------..-----------------------llymcletgaisfvqlfdpgfevrvgkrstearygvridtshr
Mpf_ENSMPUP00000013112 SLWVYQCSSl.EQAQAICKVLSTAFD--------s..........................................


                                                                                                    
                                                                                                    
d1shca_                .............................................................................
Mpf_ENSMPUP00000000236 ttrsfdfeietkqgtqytfssiereeygklfdfvnakklnikn..................................
Mpf_ENSMPUP00000001054 hlccsspesrkdflkavhsilrdkhrrq.................................................
Mpf_ENSMPUP00000001986 etvfqlccsdsesktnivkvirsilrenfrrh.............................................
Mpf_ENSMPUP00000006133 .............................................................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 flnaenaqkfktkfeecrkeieerek...................................................
Mpf_ENSMPUP00000012215 .............................................................................
Mpf_ENSMPUP00000016175 fnvalqdhfkwvkq...............................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 dafdfnvslqdhfkwvkq...........................................................
Mpf_ENSMPUP00000018612 lnaenaqkfktkfeecrkeieerek....................................................
Mpf_ENSMPUP00000018966 lnaenaqkfktkfeecrkeieerek....................................................
Mpf_ENSMPUP00000004660 dgkkdccfeisapdkriyqftaaspkdaeewvqqlnfvlq.....................................
Mpf_ENSMPUP00000002149 csqtaknamgcqil...............................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 iaelmknltqye.................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 antvyglgfssehhlskfaekfqefkeaarlakeksqekmeltstpsqesaggdlqsplt.................
Mpf_ENSMPUP00000011363 .............................................................................
Mpf_ENSMPUP00000015445 glgfsseqqltkfaekfqevkeaarlardksqekietssnhsqvs................................
Mpf_ENSMPUP00000015195 mapylrkdskkescfeltsqdrrsyeftaanpaeardwvdqisfl................................
Mpf_ENSMPUP00000011751 rwlkafakereqvrldqetgfsitelqrkqamlna..........................................
Mpf_ENSMPUP00000009831 ekigfeisenqkrqaam............................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 nimikyhpkfwadgsyqccrqteklapgceky.............................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 saylnghwlccrassdtapgcspct....................................................
Mpf_ENSMPUP00000005832 nfgskedaaqfaaamasaleale......................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 egphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdpsgnahkwckkiqevwrhryqshpd....
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 kpdtievqqmkaqareekhqkqlerqqletekkrretverekeqmmrek............................
Mpf_ENSMPUP00000010667 avrfklqdvadsfkkifdeak........................................................
Mpf_ENSMPUP00000000642 emgmeisenqkklamln............................................................
Mpf_ENSMPUP00000015373 lgfaseqhltqfaekfqevkeaarlareksqdggeltspalglaahqvppspl........................
Mpf_ENSMPUP00000003213 .............................................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 lmkyafpvsnnlplfafeyk.........................................................
Mpf_ENSMPUP00000003212 .............................................................................
Mpf_ENSMPUP00000001158 rkpdtievqqmkaqareekhqkqmerallenekkkremaekekeki...............................
Mpf_ENSMPUP00000010667 kemadcfkkkfeecqqnllk.........................................................
Mpf_ENSMPUP00000013386 etrnnnslvpmyhpnfwmdgrwrccaqqeklavgcaqy.......................................
Mpf_ENSMPUP00000016712 riaklmadvveee................................................................
Mpf_ENSMPUP00000003302 kpdtievqqmkaqareekhqkqleraqlenekkkreiaekeker.................................
Mpf_ENSMPUP00000003768 .............................................................................
Mpf_ENSMPUP00000008012 iqgalhdy.....................................................................
Mpf_ENSMPUP00000002625 phllikyhsgffvdgkflccqqsckaapgctl.............................................
Mpf_ENSMPUP00000010667 pelaeefkqkfeecq..............................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 fvsykenvgkswaedvlalvkhpltan..................................................
Mpf_ENSMPUP00000017573 .............................................................................
Mpf_ENSMPUP00000012859 nfmavqddtakvwteelfklamnilaqn.................................................
Mpf_ENSMPUP00000012131 fyhpsaylngnwlccletsenalgckpct................................................
Mpf_ENSMPUP00000000172 wkicveyhtffrlldqpkakakavffsrgssfrysgrtqkqlvdyvrdsgvkrvpyerrhsk...............
Mpf_ENSMPUP00000013200 rrkadslevqqmkaqareekarkqmerqrlarekqmreeaertrdel..............................
Mpf_ENSMPUP00000003522 tssdkntwmelleeavr............................................................
Mpf_ENSMPUP00000011499 cksfwkicvehhaffrlfeepkpkpkpvlfsrgssfrfsgrtqkqvldyvkegghkkvqferkhsk...........
Mpf_ENSMPUP00000011494 eiltryafplahslpifafln........................................................
Mpf_ENSMPUP00000012716 illdenccveslpdkdgkkclflikcfdktfeisasdkkkkqewiqaihsti.........................
Mpf_ENSMPUP00000002913 amlfalnimnsqeggpstqrqvqngpspeemdiqrrqv.......................................
Mpf_ENSMPUP00000003504 qewtaaiqtairl................................................................
Mpf_ENSMPUP00000004361 anvfasammhalevlnsqetaq.......................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 tglqralee....................................................................
Mpf_ENSMPUP00000006376 wveglrsiihnfrann.............................................................
Mpf_ENSMPUP00000014536 stlidrpaphfertsskr...........................................................
Mpf_ENSMPUP00000011501 nklafplsngqilfafsyk..........................................................
Mpf_ENSMPUP00000017670 alidrpapfferssskr............................................................
Mpf_ENSMPUP00000006727 lgrr.........................................................................
Mpf_ENSMPUP00000000961 .............................................................................
Mpf_ENSMPUP00000004942 rrasalidrpapyferssskr........................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 elvaqtvsektvwqdlicrm.........................................................
Mpf_ENSMPUP00000011333 hvnrkyafkaahpnmrtyyfctdtgkemelwmkamld........................................
Mpf_ENSMPUP00000000969 frysgkteyqttktnkprrstsferrpsk................................................
Mpf_ENSMPUP00000010395 stlermldvtmlqeekeeqmrlpsad...................................................
Mpf_ENSMPUP00000015361 frysgrtqaqtrqasalidrpaphfertaskr.............................................
Mpf_ENSMPUP00000001991 easskiqreppevhrtsmtq.........................................................
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 rsdfirlgsrfrfsgrteyqathgsr...................................................
Mpf_ENSMPUP00000008193 disq.........................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 qlqacreasqhr.................................................................
Mpf_ENSMPUP00000010611 ssaissdk.....................................................................
Mpf_ENSMPUP00000007161 aihtnim......................................................................
Mpf_ENSMPUP00000006134 rkaiedlie....................................................................
Mpf_ENSMPUP00000004983 lislhyrstldrmldsvllkeeneqplrlpspd............................................
Mpf_ENSMPUP00000001920 sfiirp.......................................................................
Mpf_ENSMPUP00000013542 ekiqkr.......................................................................
Mpf_ENSMPUP00000008337 twmahirravesc................................................................
Mpf_ENSMPUP00000013626 krkan........................................................................
Mpf_ENSMPUP00000001949 emsvwlnklgfav................................................................
Mpf_ENSMPUP00000017721 kswaaaiqaqvn.................................................................
Mpf_ENSMPUP00000001109 saihsnvs.....................................................................
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 s............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000005196 aeaargwetairqalm.............................................................
Mpf_ENSMPUP00000012589 .............................................................................
Mpf_ENSMPUP00000010571 ssnlffkgsrfrysgrvakevmessakikreppeih.........................................
Mpf_ENSMPUP00000011589 aesseeqeawiqamgeaar..........................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 aschpgafrssrwtcclqaersaagcsrth...............................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 rilvscsnqqdlhewvdhlqkqtk.....................................................
Mpf_ENSMPUP00000006089 adisrllwrqaihn...............................................................
Mpf_ENSMPUP00000016498 eqherlmlemeqkarlqtsltepmtlsksislp............................................
Mpf_ENSMPUP00000007327 svnnqyckkviggmvwnpalrrslsve..................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 yyfsadtqedmnawvramnqaaq......................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 nskeernnwmrriqqavesc.........................................................
Mpf_ENSMPUP00000001869 qewleqlcrli..................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 ndifqavetaihrqkv.............................................................
Mpf_ENSMPUP00000017717 fqksllaalaal.................................................................
Mpf_ENSMPUP00000010272 lqassaevksawthvigqilwrqalr...................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 qswekairqalm.................................................................
Mpf_ENSMPUP00000009546 iitssrtfyiqadspedmhswikeigaavq...............................................
Mpf_ENSMPUP00000002870 qeckqsdimmrdnlfeivtssrtfyvqadspeemhswikavsgaivaq.............................
Mpf_ENSMPUP00000000151 llwrqaahn....................................................................
Mpf_ENSMPUP00000000216 kdndmqsevstaelgkrap..........................................................
Mpf_ENSMPUP00000007012 fsfeettscracqmllrgtfyq.......................................................
Mpf_ENSMPUP00000012096 fdkttnckacrmflrgtfyq.........................................................
Mpf_ENSMPUP00000004281 nireviqeriihl................................................................
Mpf_ENSMPUP00000004460 krvllem......................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 aprgrrftftaehpgmrtyvlaadtledlrgwlralgras.....................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 alaiaeqherllqsvkns...........................................................
Mpf_ENSMPUP00000011052 rnfl.........................................................................
Mpf_ENSMPUP00000015653 ykpfifaadtledlsmwvrhlitcis...................................................
Mpf_ENSMPUP00000014937 fliqasakdtgclyaaihhrllalr....................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 vlytymasedtvamesmpllgftiapekeegssevgpifhlyhkktlfysfkaednnsaqrwikamedas.......
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 kqskskihaarslseiaidltetgtlktsklanmgskgkiis...................................
Mpf_ENSMPUP00000016865 fyldrkqskakipsarslddiamdltetgtprvskmvtleaksqfimasn...........................
Mpf_ENSMPUP00000000090 adsnfhefkmhtfnrvtsckvcqmllrgtfyq.............................................
Mpf_ENSMPUP00000012035 esstlneedtgvtnrdlisrr........................................................
Mpf_ENSMPUP00000009068 erglteeg.....................................................................
Mpf_ENSMPUP00000000172 hvyffraeskytfgrwmeviera......................................................
Mpf_ENSMPUP00000013402 vqcgehysethtsqd..............................................................
Mpf_ENSMPUP00000012726 vsdiqeclspgpcp...............................................................
Mpf_ENSMPUP00000010329 akipakakqailemdaihyp.........................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 awvqkikaaseqyidtekkk.........................................................
Mpf_ENSMPUP00000009754 qalqqava.....................................................................
Mpf_ENSMPUP00000017452 flismgmkdpemvevhasskeernswihiiqdtin..........................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 asvg.........................................................................
Mpf_ENSMPUP00000004977 srddrstwirviqqsvr............................................................
Mpf_ENSMPUP00000017884 hgqiefyrrlseemtqrrw..........................................................
Mpf_ENSMPUP00000007027 elnsrcqivrgegaqtfqlisekktyyltadspglleewiralqsllkv............................
Mpf_ENSMPUP00000012725 pagpsmgapkhtsdkaffdlktskrvynfcaqdgqsaqqwmdriqsci.............................
Mpf_ENSMPUP00000000871 rlqgehkgsliihp...............................................................
Mpf_ENSMPUP00000006220 qvasr........................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 qatvkkvvyslprvg..............................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 ssqaemeewvkflkrva............................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 pgllgsyhpgvfrgdkwscchqkdksdlgcdkt............................................
Mpf_ENSMPUP00000002835 qhwvqglrkii..................................................................
Mpf_ENSMPUP00000004473 iitgrrrclelqtrteeekkewiqvieatierhkqn.........................................
Mpf_ENSMPUP00000000137 akalykkkkrfffskvhfkdmnrwlnrinmlt.............................................
Mpf_ENSMPUP00000001907 .............................................................................
Mpf_ENSMPUP00000014024 cr...........................................................................
Mpf_ENSMPUP00000001742 gmhnwyacsharpt...............................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 sgmhnwyacsharpt..............................................................
Mpf_ENSMPUP00000018515 nhinkcvtd....................................................................
Mpf_ENSMPUP00000009502 ewikilr......................................................................
Mpf_ENSMPUP00000013672 agggwegaasykltftaggaiefgqrm..................................................
Mpf_ENSMPUP00000011336 qarteeekkdwvqainstllkheqt....................................................
Mpf_ENSMPUP00000001410 iwvtglryli...................................................................
Mpf_ENSMPUP00000003424 et...........................................................................
Mpf_ENSMPUP00000007040 tvkkvvnylprv.................................................................
Mpf_ENSMPUP00000019493 etkralsek....................................................................
Mpf_ENSMPUP00000018830 hieecvrrq....................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000010983 svlsqv.......................................................................
Mpf_ENSMPUP00000010498 ptkgpfglrpvlpdps.............................................................
Mpf_ENSMPUP00000012786 nkincvaavfsappfpaaigsqkkfsrpllp..............................................
Mpf_ENSMPUP00000014114 yr...........................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 lraqdpdhrqqwidaieqh..........................................................
Mpf_ENSMPUP00000002033 ekaffdvkttrrvynfcaqdvpsaqqwvdqiqscl..........................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 snldlvansaeeakiwmqglqllv.....................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 rlvfklsvpqhvsllpgqvirlrevlererkrr............................................
Mpf_ENSMPUP00000002351 rdcwfseiskllmeqqns...........................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 raitethafyrcdtvtsavmmqysrdlkghlaslflnenin....................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 .............................................................................
Mpf_ENSMPUP00000009754 thgfehtfevytegerlylfglesaelarewvkciaka.......................................
Mpf_ENSMPUP00000002257 sqhkfqlqmrarqsnqdaq..........................................................
Mpf_ENSMPUP00000006734 avgaytfqasgqalcrgwvdaiynaqnq.................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 fdesgpesakkvclaiahysqptdlqllfafey............................................
Mpf_ENSMPUP00000003673 pkm..........................................................................
Mpf_ENSMPUP00000000383 kevrnkvysrllsl...............................................................
Mpf_ENSMPUP00000008997 lvaaifsapsfpaavssmkkfcrpllp..................................................
Mpf_ENSMPUP00000010040 avqssiasa....................................................................
Mpf_ENSMPUP00000007257 vtqvkdensesrvfqllhknmlfyvfkaddahsaqkwieafqe..................................
Mpf_ENSMPUP00000016774 trinvvaamf...................................................................
Mpf_ENSMPUP00000001960 rkkehklkitpmnadvivlglqsrdqaeqwlrviqevs.......................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 rlffenhpas...................................................................
Mpf_ENSMPUP00000007907 sadvaniwvsglrylv.............................................................
Mpf_ENSMPUP00000014021 .............................................................................
Mpf_ENSMPUP00000008982 aqhgfnaqmsslpvaav............................................................
Mpf_ENSMPUP00000005803 nal..........................................................................
Mpf_ENSMPUP00000002728 eartwitglkylm................................................................
Mpf_ENSMPUP00000007017 qasskaeraewieaikk............................................................
Mpf_ENSMPUP00000003752 rllldsrkmvfsr................................................................
Mpf_ENSMPUP00000001306 tlraesiner...................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 wlltlkkiiqintdslvqekk........................................................
Mpf_ENSMPUP00000010415 skkkkhelkitqqgtdplvlavqskeqaeqwlkvird........................................
Mpf_ENSMPUP00000006220 ffqaafleerdawvrdikkaikc......................................................
Mpf_ENSMPUP00000016350 taqveysedqqamvktpnifavctkhrgvllqalndkdmndwlyafn..............................
Mpf_ENSMPUP00000018773 .............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 taqveysedqqamvktpnifavctkhrgvllqalndkdmndwlyafn..............................
Mpf_ENSMPUP00000015036 dpgcanqalis..................................................................
Mpf_ENSMPUP00000007938 wcstlqsclre..................................................................
Mpf_ENSMPUP00000007257 aisrsieeya...................................................................
Mpf_ENSMPUP00000005203 .............................................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 kglqafc......................................................................
Mpf_ENSMPUP00000007017 knsfklpphislhrivdkm..........................................................
Mpf_ENSMPUP00000012780 avrmmsshsddsgddd.............................................................
Mpf_ENSMPUP00000002522 ltagyyrllvdsrrsifnm..........................................................
Mpf_ENSMPUP00000004905 ltvvelrvpsnltllpghlymmaealakeearr............................................
Mpf_ENSMPUP00000011326 mqekrn.......................................................................
Mpf_ENSMPUP00000009449 pfpaavgsqrrfvrpilp...........................................................
Mpf_ENSMPUP00000000014 sa...........................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 lrrap........................................................................
Mpf_ENSMPUP00000017362 naceiierpskkdgfcfklfhpleqsiwavkgpkgeavgsitqplpssyliiratsesdgrcwmdalelalk.....
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 riwmdviv.....................................................................
Mpf_ENSMPUP00000014164 tyvpkdsrhkrhelrfsqgatevlvlalqsreqaeewlkvirevs................................
Mpf_ENSMPUP00000016592 ekiskepkgcifldsctgvvqnnrlrkyafelkmndltyfvlaaetesdmdewihtlnrilq...............
Mpf_ENSMPUP00000000486 skpkdqmgghelr................................................................
Mpf_ENSMPUP00000003712 r............................................................................
Mpf_ENSMPUP00000006850 vivtaad......................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 dqanyflnfpckvrnqvyslllrlr....................................................
Mpf_ENSMPUP00000016814 vqcpsatdraqwlektqqa..........................................................
Mpf_ENSMPUP00000000139 lyafn........................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 piflwp.......................................................................
Mpf_ENSMPUP00000017142 ralp.........................................................................
Mpf_ENSMPUP00000013991 fltgmhywysshss...............................................................
Mpf_ENSMPUP00000010353 afqkgirnkvyqrfl..............................................................
Mpf_ENSMPUP00000000014 ptpqepgpakvavtss.............................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 raqatipllgyvvddlpksadlphsfkltqsksvhsfaadseelkqkwlkiifla......................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 sddeqdrilwvqamyratgqshkpvpptqvqk.............................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 aiknaidrlpkdpsg..............................................................
Mpf_ENSMPUP00000002370 .............................................................................
Mpf_ENSMPUP00000006780 drvlwvqamyratgqsykpipviqtqkl.................................................
Mpf_ENSMPUP00000002802 nqllfqkgkskddpddspielskvqsvkvvarkrrdrslprafeiftdnktyvfkakdeknaeewlqcinvava...
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 ydligqlyykdchaldqwrkgwfsm....................................................
Mpf_ENSMPUP00000004980 a............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000013099 lnnafkgddn...................................................................
Mpf_ENSMPUP00000010983 pidtptqqli...................................................................
Mpf_ENSMPUP00000004910 pssylifraasesdgrcwldalelalr..................................................
Mpf_ENSMPUP00000016233 frkggaiefaqmm................................................................
Mpf_ENSMPUP00000002953 hsil.........................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 rewlesfqdvls.................................................................
Mpf_ENSMPUP00000014164 pfafrilrnrqevaileancsedmgrwlgll..............................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000013797 lcpsqaelghwlyhlekqialv.......................................................
Mpf_ENSMPUP00000004108 rs...........................................................................
Mpf_ENSMPUP00000009167 aadskedaskwlsglkilh..........................................................
Mpf_ENSMPUP00000016226 pclelsadseadmadwmqhlcqav.....................................................
Mpf_ENSMPUP00000014024 eraa.........................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 .............................................................................
Mpf_ENSMPUP00000015774 wvsvlqnskdeal................................................................
Mpf_ENSMPUP00000008639 dlaaataeeaqrwvrglak..........................................................
Mpf_ENSMPUP00000012941 nqtetdeaieeeip...............................................................
Mpf_ENSMPUP00000016218 pgqshtlqandvfhkqqwfnciraai...................................................
Mpf_ENSMPUP00000007001 tetqseklrwisalampreeldllecydspqvqclraykpr....................................
Mpf_ENSMPUP00000001986 gdvylfqassqtdlenwvtaihsacasl.................................................
Mpf_ENSMPUP00000010415 rwigilla.....................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 lyhltvaaggssatvgta...........................................................
Mpf_ENSMPUP00000002688 ftltilsnhasekvemllgaetqserarwitalghss........................................
Mpf_ENSMPUP00000001373 ltnskeealtmafrgeqstg.........................................................
Mpf_ENSMPUP00000013700 qkk..........................................................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 as...........................................................................
Mpf_ENSMPUP00000001960 e............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 kngsqsqthslqandtfnkqqwlncirqa................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 eqtqwlemlqesgkvtwknaql.......................................................
Mpf_ENSMPUP00000017588 rlktlslqatsedevnmwvkgltwlm...................................................
Mpf_ENSMPUP00000007745 cqlnfiapdkheyciwtdglnall.....................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 sadlppeeeses.................................................................
Mpf_ENSMPUP00000001054 kidmdekmk....................................................................
Mpf_ENSMPUP00000017488 lnfiapnkyeyciwidglsall.......................................................
Mpf_ENSMPUP00000005234 filrllenaddreatymlkatsqsemkrwmtslapnrrt......................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 rwfvlkggellyykspsdvirkpqghielsascgilrgdnk....................................
Mpf_ENSMPUP00000005385 s............................................................................
Mpf_ENSMPUP00000009077 gyskflvfhnndrnmvfksfcsfq.....................................................
Mpf_ENSMPUP00000001767 alstldsitlmypffyr............................................................
Mpf_ENSMPUP00000007827 wmeamd.......................................................................
Mpf_ENSMPUP00000000541 gi...........................................................................
Mpf_ENSMPUP00000001809 awhralravierldrenplel........................................................
Mpf_ENSMPUP00000005803 pkigglplipiqh................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 lnsaitraknrildevtvee.........................................................
Mpf_ENSMPUP00000014585 nalraa.......................................................................
Mpf_ENSMPUP00000015166 mpr..........................................................................
Mpf_ENSMPUP00000002409 agcdeiwekicqvq...............................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 rvlcasyedyshwllclqtis........................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 symrlvvreles.................................................................
Mpf_ENSMPUP00000012725 lmkfrypqsifttfafaa...........................................................
Mpf_ENSMPUP00000010996 lmkieimsprkppl...............................................................
Mpf_ENSMPUP00000007938 lsctnedemwdwttsil............................................................
Mpf_ENSMPUP00000009654 wktalleanstp.................................................................
Mpf_ENSMPUP00000005385 sk...........................................................................
Mpf_ENSMPUP00000006310 cilask.......................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 sysvssadqwseatviansaissdtglgdsvcsspsissttspkldpppsphanrkkhrrkkstsnfkadglsgtae
Mpf_ENSMPUP00000000486 spwealdwgqklwevvhaavpgyvgr...................................................
Mpf_ENSMPUP00000007805 eiwekicqvq...................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 kflwlsvlqsaikssm.............................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 svssadqwsdalppasgpaevlssspklepppsphsnrkkhrrkkstgtprpdgpssaaeeaeesfefvvvsltgqt
Mpf_ENSMPUP00000005632 dlyelafsisydhgeaeaylnfiapskrefhlwtdglsall....................................
Mpf_ENSMPUP00000002828 rvhnrngksytflissdyeraewrenireqqkkc...........................................
Mpf_ENSMPUP00000017859 rpvkyeelycfsf................................................................
Mpf_ENSMPUP00000013754 pdkgnvykfqtgsrfhailwhkhlddacksnrpqvp.........................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 kqakyedlyafsy................................................................
Mpf_ENSMPUP00000004473 a............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 sssvphpfqvtllhnseglqekillssdsasdrarwitalt....................................
Mpf_ENSMPUP00000004935 ltadahhylcke.................................................................
Mpf_ENSMPUP00000011513 vaagsnn......................................................................
Mpf_ENSMPUP00000001759 rklwleamd....................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 lg...........................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 liifnapslqdrlrftsdlresiaevqemek..............................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 wfkhlsaacqsnkqqvp............................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 gegpeattptpspspspsslqpppdqtskhllkpdrnlaralstdctpsgdlsplsrepppspmvkkqrrkklttps
Mpf_ENSMPUP00000017916 lhfcalgsdemqkfvedlkesiae.....................................................
Mpf_ENSMPUP00000003318 lqryi........................................................................
Mpf_ENSMPUP00000017175 rkkftddlresiaevqemek.........................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 phakhqfllrartesekqrwisalcps..................................................
Mpf_ENSMPUP00000015325 dfkigvepkdspsftvilvassrqekaawtsdisqcvdni.....................................
Mpf_ENSMPUP00000000660 qsrtcwvtairllkyg.............................................................
Mpf_ENSMPUP00000005493 raqssqaqqya..................................................................
Mpf_ENSMPUP00000009754 vsraapevrlgsvsliplrgsenem....................................................
Mpf_ENSMPUP00000013796 gypepaggqwsrmvpagpahspplppgplpaplhvlcpsqaelghwlyhlekqialv....................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 qeevdswkasflragvyp...........................................................
Mpf_ENSMPUP00000018046 nkvrnetkelrllcaedeqgrtcwmtacrllkygmll........................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 .............................................................................
Mpf_ENSMPUP00000008387 ldfkivveppdsapftvvllapsrqekaawmsdisqcvdni....................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 e............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 hkiweeichiq..................................................................
Mpf_ENSMPUP00000007866 imkietpapr...................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 .............................................................................
Mpf_ENSMPUP00000007938 qpqdvvclgvsppptdpgdldrfpfsfeliltggriqhfgtdgadsleawtsavg......................
Mpf_ENSMPUP00000007989 lqasslsdmqrwlgaf.............................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 rrchvkchrdhldkkedlispckvsydvtsardmlllacsqdeqkkwvthlvkkipknp..................
Mpf_ENSMPUP00000015768 atgeaqrawrlalqggi............................................................
Mpf_ENSMPUP00000004215 sdwiqaic.....................................................................
Mpf_ENSMPUP00000010108 sprqaeaerwglalrevi...........................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 ceacmkplwhmfkpppalecrrchikchkdhmdkkeeiiapckvyydistaknllllansteeqqkwvsrlvkkipk
Mpf_ENSMPUP00000012407 rvtasqltvppavctvlllaeseaererwlqvlgelqrllldtrprp..............................
Mpf_ENSMPUP00000017043 ketetkyglridnlsrtlilkcnsyrharwwggaieefiq.....................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 seelpkenwlkmlcrhvan..........................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 dwlallnlsccesrr..............................................................
Mpf_ENSMPUP00000008230 tlcrnafpkgswalap.............................................................
Mpf_ENSMPUP00000001993 .............................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 httcwpgrtlyllapsfpdkqrwvtalesvvag............................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 v............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 sdsaelfrkqlhklryppdirgtfafs..................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 yletae.......................................................................
Mpf_ENSMPUP00000009754 vdyitqcgltsegiy..............................................................
Mpf_ENSMPUP00000015718 nernkwvgvlselhki.............................................................
Mpf_ENSMPUP00000002358 fsvssvlasdvihasrrdipcifrvtasllgtpsktsslliltenenekrkwvgileglq.................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 aaqslslehp...................................................................
Mpf_ENSMPUP00000016101 itpnplskiswvnrlhlakiglreenqpgwlcp............................................
Mpf_ENSMPUP00000011911 qhrqewmgpicqlafqgtgesss......................................................
Mpf_ENSMPUP00000007938 gtalqeqqms...................................................................
Mpf_ENSMPUP00000009676 v............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 e............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 nllhdlnvvgqisqlvgslrgnyqnlnqsvahdwtsglqrlilkkeeairaadccriqlqlpgkqdksgrptfftav
Mpf_ENSMPUP00000007833 wqrq.........................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 slilkcgsyrqarwwgqeitelaq.....................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                                                              
                                                                              
d1shca_                .......................................................
Mpf_ENSMPUP00000000236 .......................................................
Mpf_ENSMPUP00000001054 .......................................................
Mpf_ENSMPUP00000001986 .......................................................
Mpf_ENSMPUP00000006133 .......................................................
Mpf_ENSMPUP00000009494 .......................................................
Mpf_ENSMPUP00000004093 .......................................................
Mpf_ENSMPUP00000012215 .......................................................
Mpf_ENSMPUP00000016175 .......................................................
Mpf_ENSMPUP00000009909 .......................................................
Mpf_ENSMPUP00000010977 .......................................................
Mpf_ENSMPUP00000016638 .......................................................
Mpf_ENSMPUP00000018612 .......................................................
Mpf_ENSMPUP00000018966 .......................................................
Mpf_ENSMPUP00000004660 .......................................................
Mpf_ENSMPUP00000002149 .......................................................
Mpf_ENSMPUP00000018066 .......................................................
Mpf_ENSMPUP00000017958 .......................................................
Mpf_ENSMPUP00000011450 .......................................................
Mpf_ENSMPUP00000016402 .......................................................
Mpf_ENSMPUP00000004951 .......................................................
Mpf_ENSMPUP00000011363 .......................................................
Mpf_ENSMPUP00000015445 .......................................................
Mpf_ENSMPUP00000015195 .......................................................
Mpf_ENSMPUP00000011751 .......................................................
Mpf_ENSMPUP00000009831 .......................................................
Mpf_ENSMPUP00000004111 .......................................................
Mpf_ENSMPUP00000005349 .......................................................
Mpf_ENSMPUP00000006137 .......................................................
Mpf_ENSMPUP00000009095 .......................................................
Mpf_ENSMPUP00000005832 .......................................................
Mpf_ENSMPUP00000014567 .......................................................
Mpf_ENSMPUP00000015198 .......................................................
Mpf_ENSMPUP00000008441 .......................................................
Mpf_ENSMPUP00000005146 .......................................................
Mpf_ENSMPUP00000010667 .......................................................
Mpf_ENSMPUP00000000642 .......................................................
Mpf_ENSMPUP00000015373 .......................................................
Mpf_ENSMPUP00000003213 .......................................................
Mpf_ENSMPUP00000012196 .......................................................
Mpf_ENSMPUP00000012194 .......................................................
Mpf_ENSMPUP00000003212 .......................................................
Mpf_ENSMPUP00000001158 .......................................................
Mpf_ENSMPUP00000010667 .......................................................
Mpf_ENSMPUP00000013386 .......................................................
Mpf_ENSMPUP00000016712 .......................................................
Mpf_ENSMPUP00000003302 .......................................................
Mpf_ENSMPUP00000003768 .......................................................
Mpf_ENSMPUP00000008012 .......................................................
Mpf_ENSMPUP00000002625 .......................................................
Mpf_ENSMPUP00000010667 .......................................................
Mpf_ENSMPUP00000006140 .......................................................
Mpf_ENSMPUP00000015670 .......................................................
Mpf_ENSMPUP00000008341 .......................................................
Mpf_ENSMPUP00000017573 .......................................................
Mpf_ENSMPUP00000012859 .......................................................
Mpf_ENSMPUP00000012131 .......................................................
Mpf_ENSMPUP00000000172 .......................................................
Mpf_ENSMPUP00000013200 .......................................................
Mpf_ENSMPUP00000003522 .......................................................
Mpf_ENSMPUP00000011499 .......................................................
Mpf_ENSMPUP00000011494 .......................................................
Mpf_ENSMPUP00000012716 .......................................................
Mpf_ENSMPUP00000002913 .......................................................
Mpf_ENSMPUP00000003504 .......................................................
Mpf_ENSMPUP00000004361 .......................................................
Mpf_ENSMPUP00000017389 .......................................................
Mpf_ENSMPUP00000015829 .......................................................
Mpf_ENSMPUP00000003644 .......................................................
Mpf_ENSMPUP00000006376 .......................................................
Mpf_ENSMPUP00000014536 .......................................................
Mpf_ENSMPUP00000011501 .......................................................
Mpf_ENSMPUP00000017670 .......................................................
Mpf_ENSMPUP00000006727 .......................................................
Mpf_ENSMPUP00000000961 .......................................................
Mpf_ENSMPUP00000004942 .......................................................
Mpf_ENSMPUP00000002151 .......................................................
Mpf_ENSMPUP00000014680 .......................................................
Mpf_ENSMPUP00000005563 .......................................................
Mpf_ENSMPUP00000011333 .......................................................
Mpf_ENSMPUP00000000969 .......................................................
Mpf_ENSMPUP00000010395 .......................................................
Mpf_ENSMPUP00000015361 .......................................................
Mpf_ENSMPUP00000001991 .......................................................
Mpf_ENSMPUP00000005637 .......................................................
Mpf_ENSMPUP00000007307 .......................................................
Mpf_ENSMPUP00000008193 .......................................................
Mpf_ENSMPUP00000007177 .......................................................
Mpf_ENSMPUP00000010360 .......................................................
Mpf_ENSMPUP00000010611 .......................................................
Mpf_ENSMPUP00000007161 .......................................................
Mpf_ENSMPUP00000006134 .......................................................
Mpf_ENSMPUP00000004983 .......................................................
Mpf_ENSMPUP00000001920 .......................................................
Mpf_ENSMPUP00000013542 .......................................................
Mpf_ENSMPUP00000008337 .......................................................
Mpf_ENSMPUP00000013626 .......................................................
Mpf_ENSMPUP00000001949 .......................................................
Mpf_ENSMPUP00000017721 .......................................................
Mpf_ENSMPUP00000001109 .......................................................
Mpf_ENSMPUP00000001935 .......................................................
Mpf_ENSMPUP00000006252 .......................................................
Mpf_ENSMPUP00000005676 .......................................................
Mpf_ENSMPUP00000005196 .......................................................
Mpf_ENSMPUP00000012589 .......................................................
Mpf_ENSMPUP00000010571 .......................................................
Mpf_ENSMPUP00000011589 .......................................................
Mpf_ENSMPUP00000005676 .......................................................
Mpf_ENSMPUP00000002533 .......................................................
Mpf_ENSMPUP00000004215 .......................................................
Mpf_ENSMPUP00000013399 .......................................................
Mpf_ENSMPUP00000010530 .......................................................
Mpf_ENSMPUP00000006089 .......................................................
Mpf_ENSMPUP00000016498 .......................................................
Mpf_ENSMPUP00000007327 .......................................................
Mpf_ENSMPUP00000001749 .......................................................
Mpf_ENSMPUP00000016475 .......................................................
Mpf_ENSMPUP00000013206 .......................................................
Mpf_ENSMPUP00000006140 .......................................................
Mpf_ENSMPUP00000005780 .......................................................
Mpf_ENSMPUP00000001869 .......................................................
Mpf_ENSMPUP00000012475 .......................................................
Mpf_ENSMPUP00000008316 .......................................................
Mpf_ENSMPUP00000001167 .......................................................
Mpf_ENSMPUP00000008230 .......................................................
Mpf_ENSMPUP00000017717 .......................................................
Mpf_ENSMPUP00000010272 .......................................................
Mpf_ENSMPUP00000003964 .......................................................
Mpf_ENSMPUP00000017478 .......................................................
Mpf_ENSMPUP00000010168 .......................................................
Mpf_ENSMPUP00000009546 .......................................................
Mpf_ENSMPUP00000002870 .......................................................
Mpf_ENSMPUP00000000151 .......................................................
Mpf_ENSMPUP00000000216 .......................................................
Mpf_ENSMPUP00000007012 .......................................................
Mpf_ENSMPUP00000012096 .......................................................
Mpf_ENSMPUP00000004281 .......................................................
Mpf_ENSMPUP00000004460 .......................................................
Mpf_ENSMPUP00000011499 .......................................................
Mpf_ENSMPUP00000003498 .......................................................
Mpf_ENSMPUP00000006723 .......................................................
Mpf_ENSMPUP00000006149 .......................................................
Mpf_ENSMPUP00000011052 .......................................................
Mpf_ENSMPUP00000015653 .......................................................
Mpf_ENSMPUP00000014937 .......................................................
Mpf_ENSMPUP00000006713 .......................................................
Mpf_ENSMPUP00000005370 .......................................................
Mpf_ENSMPUP00000017142 .......................................................
Mpf_ENSMPUP00000011052 .......................................................
Mpf_ENSMPUP00000000930 .......................................................
Mpf_ENSMPUP00000016865 .......................................................
Mpf_ENSMPUP00000000090 .......................................................
Mpf_ENSMPUP00000012035 .......................................................
Mpf_ENSMPUP00000009068 .......................................................
Mpf_ENSMPUP00000000172 .......................................................
Mpf_ENSMPUP00000013402 .......................................................
Mpf_ENSMPUP00000012726 .......................................................
Mpf_ENSMPUP00000010329 .......................................................
Mpf_ENSMPUP00000005886 .......................................................
Mpf_ENSMPUP00000011911 .......................................................
Mpf_ENSMPUP00000013895 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000017452 .......................................................
Mpf_ENSMPUP00000004281 .......................................................
Mpf_ENSMPUP00000017577 .......................................................
Mpf_ENSMPUP00000004977 .......................................................
Mpf_ENSMPUP00000017884 .......................................................
Mpf_ENSMPUP00000007027 .......................................................
Mpf_ENSMPUP00000012725 .......................................................
Mpf_ENSMPUP00000000871 .......................................................
Mpf_ENSMPUP00000006220 .......................................................
Mpf_ENSMPUP00000008418 .......................................................
Mpf_ENSMPUP00000003932 .......................................................
Mpf_ENSMPUP00000001861 .......................................................
Mpf_ENSMPUP00000008418 .......................................................
Mpf_ENSMPUP00000006249 .......................................................
Mpf_ENSMPUP00000003836 .......................................................
Mpf_ENSMPUP00000015858 .......................................................
Mpf_ENSMPUP00000002835 .......................................................
Mpf_ENSMPUP00000004473 .......................................................
Mpf_ENSMPUP00000000137 .......................................................
Mpf_ENSMPUP00000001907 .......................................................
Mpf_ENSMPUP00000014024 .......................................................
Mpf_ENSMPUP00000001742 .......................................................
Mpf_ENSMPUP00000000172 .......................................................
Mpf_ENSMPUP00000005480 .......................................................
Mpf_ENSMPUP00000018515 .......................................................
Mpf_ENSMPUP00000009502 .......................................................
Mpf_ENSMPUP00000013672 .......................................................
Mpf_ENSMPUP00000011336 .......................................................
Mpf_ENSMPUP00000001410 .......................................................
Mpf_ENSMPUP00000003424 .......................................................
Mpf_ENSMPUP00000007040 .......................................................
Mpf_ENSMPUP00000019493 .......................................................
Mpf_ENSMPUP00000018830 .......................................................
Mpf_ENSMPUP00000003141 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000010498 .......................................................
Mpf_ENSMPUP00000012786 .......................................................
Mpf_ENSMPUP00000014114 .......................................................
Mpf_ENSMPUP00000007256 .......................................................
Mpf_ENSMPUP00000005608 .......................................................
Mpf_ENSMPUP00000002033 .......................................................
Mpf_ENSMPUP00000016751 .......................................................
Mpf_ENSMPUP00000016435 .......................................................
Mpf_ENSMPUP00000001167 .......................................................
Mpf_ENSMPUP00000001585 .......................................................
Mpf_ENSMPUP00000002351 .......................................................
Mpf_ENSMPUP00000011499 .......................................................
Mpf_ENSMPUP00000005375 .......................................................
Mpf_ENSMPUP00000015986 .......................................................
Mpf_ENSMPUP00000004747 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000002257 .......................................................
Mpf_ENSMPUP00000006734 .......................................................
Mpf_ENSMPUP00000003502 .......................................................
Mpf_ENSMPUP00000011019 .......................................................
Mpf_ENSMPUP00000003673 .......................................................
Mpf_ENSMPUP00000000383 .......................................................
Mpf_ENSMPUP00000008997 .......................................................
Mpf_ENSMPUP00000010040 .......................................................
Mpf_ENSMPUP00000007257 .......................................................
Mpf_ENSMPUP00000016774 .......................................................
Mpf_ENSMPUP00000001960 .......................................................
Mpf_ENSMPUP00000007610 .......................................................
Mpf_ENSMPUP00000017612 .......................................................
Mpf_ENSMPUP00000007907 .......................................................
Mpf_ENSMPUP00000014021 .......................................................
Mpf_ENSMPUP00000008982 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000002728 .......................................................
Mpf_ENSMPUP00000007017 .......................................................
Mpf_ENSMPUP00000003752 .......................................................
Mpf_ENSMPUP00000001306 .......................................................
Mpf_ENSMPUP00000005338 .......................................................
Mpf_ENSMPUP00000001689 .......................................................
Mpf_ENSMPUP00000010415 .......................................................
Mpf_ENSMPUP00000006220 .......................................................
Mpf_ENSMPUP00000016350 .......................................................
Mpf_ENSMPUP00000018773 .......................................................
Mpf_ENSMPUP00000017599 .......................................................
Mpf_ENSMPUP00000016349 .......................................................
Mpf_ENSMPUP00000015036 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000007257 .......................................................
Mpf_ENSMPUP00000005203 .......................................................
Mpf_ENSMPUP00000000650 .......................................................
Mpf_ENSMPUP00000007937 .......................................................
Mpf_ENSMPUP00000007017 .......................................................
Mpf_ENSMPUP00000012780 .......................................................
Mpf_ENSMPUP00000002522 .......................................................
Mpf_ENSMPUP00000004905 .......................................................
Mpf_ENSMPUP00000011326 .......................................................
Mpf_ENSMPUP00000009449 .......................................................
Mpf_ENSMPUP00000000014 .......................................................
Mpf_ENSMPUP00000012737 .......................................................
Mpf_ENSMPUP00000002136 .......................................................
Mpf_ENSMPUP00000017782 .......................................................
Mpf_ENSMPUP00000013550 .......................................................
Mpf_ENSMPUP00000017362 .......................................................
Mpf_ENSMPUP00000006996 .......................................................
Mpf_ENSMPUP00000004785 .......................................................
Mpf_ENSMPUP00000014164 .......................................................
Mpf_ENSMPUP00000016592 .......................................................
Mpf_ENSMPUP00000000486 .......................................................
Mpf_ENSMPUP00000003712 .......................................................
Mpf_ENSMPUP00000006850 .......................................................
Mpf_ENSMPUP00000015574 .......................................................
Mpf_ENSMPUP00000014962 .......................................................
Mpf_ENSMPUP00000016814 .......................................................
Mpf_ENSMPUP00000000139 .......................................................
Mpf_ENSMPUP00000012020 .......................................................
Mpf_ENSMPUP00000006069 .......................................................
Mpf_ENSMPUP00000017142 .......................................................
Mpf_ENSMPUP00000013991 .......................................................
Mpf_ENSMPUP00000010353 .......................................................
Mpf_ENSMPUP00000000014 .......................................................
Mpf_ENSMPUP00000009546 .......................................................
Mpf_ENSMPUP00000012020 .......................................................
Mpf_ENSMPUP00000016751 .......................................................
Mpf_ENSMPUP00000000216 .......................................................
Mpf_ENSMPUP00000010854 .......................................................
Mpf_ENSMPUP00000016813 .......................................................
Mpf_ENSMPUP00000002870 .......................................................
Mpf_ENSMPUP00000003651 .......................................................
Mpf_ENSMPUP00000002370 .......................................................
Mpf_ENSMPUP00000006780 .......................................................
Mpf_ENSMPUP00000002802 .......................................................
Mpf_ENSMPUP00000011336 .......................................................
Mpf_ENSMPUP00000003120 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000004980 .......................................................
Mpf_ENSMPUP00000015621 .......................................................
Mpf_ENSMPUP00000003141 .......................................................
Mpf_ENSMPUP00000013099 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000004910 .......................................................
Mpf_ENSMPUP00000016233 .......................................................
Mpf_ENSMPUP00000002953 .......................................................
Mpf_ENSMPUP00000011716 .......................................................
Mpf_ENSMPUP00000007767 .......................................................
Mpf_ENSMPUP00000014585 .......................................................
Mpf_ENSMPUP00000014164 .......................................................
Mpf_ENSMPUP00000005886 .......................................................
Mpf_ENSMPUP00000013797 .......................................................
Mpf_ENSMPUP00000004108 .......................................................
Mpf_ENSMPUP00000009167 .......................................................
Mpf_ENSMPUP00000016226 .......................................................
Mpf_ENSMPUP00000014024 .......................................................
Mpf_ENSMPUP00000008448 .......................................................
Mpf_ENSMPUP00000010607 .......................................................
Mpf_ENSMPUP00000015774 .......................................................
Mpf_ENSMPUP00000008639 .......................................................
Mpf_ENSMPUP00000012941 .......................................................
Mpf_ENSMPUP00000016218 .......................................................
Mpf_ENSMPUP00000007001 .......................................................
Mpf_ENSMPUP00000001986 .......................................................
Mpf_ENSMPUP00000010415 .......................................................
Mpf_ENSMPUP00000003836 .......................................................
Mpf_ENSMPUP00000007027 .......................................................
Mpf_ENSMPUP00000002688 .......................................................
Mpf_ENSMPUP00000001373 .......................................................
Mpf_ENSMPUP00000013700 .......................................................
Mpf_ENSMPUP00000016589 .......................................................
Mpf_ENSMPUP00000015325 .......................................................
Mpf_ENSMPUP00000001960 .......................................................
Mpf_ENSMPUP00000006310 .......................................................
Mpf_ENSMPUP00000016747 .......................................................
Mpf_ENSMPUP00000013323 .......................................................
Mpf_ENSMPUP00000007350 .......................................................
Mpf_ENSMPUP00000017588 .......................................................
Mpf_ENSMPUP00000007745 .......................................................
Mpf_ENSMPUP00000006409 .......................................................
Mpf_ENSMPUP00000015574 .......................................................
Mpf_ENSMPUP00000008365 .......................................................
Mpf_ENSMPUP00000001054 .......................................................
Mpf_ENSMPUP00000017488 .......................................................
Mpf_ENSMPUP00000005234 .......................................................
Mpf_ENSMPUP00000013182 .......................................................
Mpf_ENSMPUP00000011513 .......................................................
Mpf_ENSMPUP00000005385 .......................................................
Mpf_ENSMPUP00000009077 .......................................................
Mpf_ENSMPUP00000001767 .......................................................
Mpf_ENSMPUP00000007827 .......................................................
Mpf_ENSMPUP00000000541 .......................................................
Mpf_ENSMPUP00000001809 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000013182 .......................................................
Mpf_ENSMPUP00000005315 .......................................................
Mpf_ENSMPUP00000014585 .......................................................
Mpf_ENSMPUP00000015166 .......................................................
Mpf_ENSMPUP00000002409 .......................................................
Mpf_ENSMPUP00000005807 .......................................................
Mpf_ENSMPUP00000013796 .......................................................
Mpf_ENSMPUP00000017782 .......................................................
Mpf_ENSMPUP00000019464 .......................................................
Mpf_ENSMPUP00000012725 .......................................................
Mpf_ENSMPUP00000010996 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000009654 .......................................................
Mpf_ENSMPUP00000005385 .......................................................
Mpf_ENSMPUP00000006310 .......................................................
Mpf_ENSMPUP00000007963 .......................................................
Mpf_ENSMPUP00000002310 eqeenfefiivsltgqtwhfeattyeerdawvqaiesqilaslqscess......
Mpf_ENSMPUP00000000486 .......................................................
Mpf_ENSMPUP00000007805 .......................................................
Mpf_ENSMPUP00000010246 .......................................................
Mpf_ENSMPUP00000004460 .......................................................
Mpf_ENSMPUP00000014791 .......................................................
Mpf_ENSMPUP00000003154 .......................................................
Mpf_ENSMPUP00000005214 .......................................................
Mpf_ENSMPUP00000003932 .......................................................
Mpf_ENSMPUP00000008710 whfeastaeerelwvqsvqaqilaslqgcrsa.......................
Mpf_ENSMPUP00000005632 .......................................................
Mpf_ENSMPUP00000002828 .......................................................
Mpf_ENSMPUP00000017859 .......................................................
Mpf_ENSMPUP00000013754 .......................................................
Mpf_ENSMPUP00000004548 .......................................................
Mpf_ENSMPUP00000000646 .......................................................
Mpf_ENSMPUP00000004473 .......................................................
Mpf_ENSMPUP00000000402 .......................................................
Mpf_ENSMPUP00000007412 .......................................................
Mpf_ENSMPUP00000004935 .......................................................
Mpf_ENSMPUP00000011513 .......................................................
Mpf_ENSMPUP00000001759 .......................................................
Mpf_ENSMPUP00000008353 .......................................................
Mpf_ENSMPUP00000012083 .......................................................
Mpf_ENSMPUP00000006956 .......................................................
Mpf_ENSMPUP00000014860 .......................................................
Mpf_ENSMPUP00000009647 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000005109 .......................................................
Mpf_ENSMPUP00000006149 .......................................................
Mpf_ENSMPUP00000001981 ktegsagqaeeenfeflivsstgqtwhfeaasfeerdawvqaiesqilaslqcce
Mpf_ENSMPUP00000017916 .......................................................
Mpf_ENSMPUP00000003318 .......................................................
Mpf_ENSMPUP00000017175 .......................................................
Mpf_ENSMPUP00000016038 .......................................................
Mpf_ENSMPUP00000016192 .......................................................
Mpf_ENSMPUP00000015325 .......................................................
Mpf_ENSMPUP00000000660 .......................................................
Mpf_ENSMPUP00000005493 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000013796 .......................................................
Mpf_ENSMPUP00000010667 .......................................................
Mpf_ENSMPUP00000013126 .......................................................
Mpf_ENSMPUP00000018046 .......................................................
Mpf_ENSMPUP00000006359 .......................................................
Mpf_ENSMPUP00000015086 .......................................................
Mpf_ENSMPUP00000008387 .......................................................
Mpf_ENSMPUP00000015207 .......................................................
Mpf_ENSMPUP00000004217 .......................................................
Mpf_ENSMPUP00000015689 .......................................................
Mpf_ENSMPUP00000015159 .......................................................
Mpf_ENSMPUP00000018833 .......................................................
Mpf_ENSMPUP00000007866 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000010694 .......................................................
Mpf_ENSMPUP00000013131 .......................................................
Mpf_ENSMPUP00000000312 .......................................................
Mpf_ENSMPUP00000019132 .......................................................
Mpf_ENSMPUP00000015959 .......................................................
Mpf_ENSMPUP00000012612 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000007989 .......................................................
Mpf_ENSMPUP00000016156 .......................................................
Mpf_ENSMPUP00000013721 .......................................................
Mpf_ENSMPUP00000005447 .......................................................
Mpf_ENSMPUP00000015768 .......................................................
Mpf_ENSMPUP00000004215 .......................................................
Mpf_ENSMPUP00000010108 .......................................................
Mpf_ENSMPUP00000002188 .......................................................
Mpf_ENSMPUP00000013446 .......................................................
Mpf_ENSMPUP00000012407 .......................................................
Mpf_ENSMPUP00000017043 .......................................................
Mpf_ENSMPUP00000007898 .......................................................
Mpf_ENSMPUP00000017064 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000016461 .......................................................
Mpf_ENSMPUP00000008230 .......................................................
Mpf_ENSMPUP00000001993 .......................................................
Mpf_ENSMPUP00000014500 .......................................................
Mpf_ENSMPUP00000002405 .......................................................
Mpf_ENSMPUP00000002933 .......................................................
Mpf_ENSMPUP00000007268 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000010498 .......................................................
Mpf_ENSMPUP00000018101 .......................................................
Mpf_ENSMPUP00000002033 .......................................................
Mpf_ENSMPUP00000010694 .......................................................
Mpf_ENSMPUP00000008353 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000015718 .......................................................
Mpf_ENSMPUP00000002358 .......................................................
Mpf_ENSMPUP00000005077 .......................................................
Mpf_ENSMPUP00000009107 .......................................................
Mpf_ENSMPUP00000016101 .......................................................
Mpf_ENSMPUP00000011911 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000009676 .......................................................
Mpf_ENSMPUP00000005809 .......................................................
Mpf_ENSMPUP00000016410 .......................................................
Mpf_ENSMPUP00000006638 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000000717 .......................................................
Mpf_ENSMPUP00000002793 fntftpaikeswlnslqmaklaleeenhmgwfcv.....................
Mpf_ENSMPUP00000007833 .......................................................
Mpf_ENSMPUP00000002271 .......................................................
Mpf_ENSMPUP00000010974 .......................................................
Mpf_ENSMPUP00000010755 .......................................................
Mpf_ENSMPUP00000013112 .......................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0049397 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Synechococcus elongatus PCC 7942
NoYes   Rivularia sp. PCC 7116
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Enterococcus sp. 7L76
NoYes   Weissella koreensis KACC 15510
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria innocua Clip11262
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Geobacillus sp. JF8
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Pelobacter propionicus DSM 2379
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Mesorhizobium sp. BNC1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Photobacterium profundum SS9
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Pyrococcus yayanosii CH1
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechococcus elongatus PCC 6301
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. CBDB1
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus parasanguinis FW213
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus thermophilus MN-ZLW-002
NoYes   Streptococcus thermophilus JIM 8232
NoYes   Streptococcus thermophilus ND03
NoYes   Streptococcus thermophilus CNRZ1066
NoYes   Streptococcus thermophilus LMG 18311
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis TL13
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis D12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Streptococcus salivarius CCHSS3
NoYes   Streptococcus salivarius JIM8777
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Variovorax paradoxus B4
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Acinetobacter junii SH205
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Pyrococcus sp. NA2
NoYes   Natronobacterium gregoryi SP2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]