SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

PH domain-like alignments

These alignments are sequences aligned to the 0050517 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1wg7a_                .............................................................................
Mpf_ENSMPUP00000000236 atgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtry
Mpf_ENSMPUP00000001054 efgavfdqliaeqtgekkevadlsmgdlllhttviwpnppaslgkwkkepelaafvfktavvlvykdgskqkkklv.
Mpf_ENSMPUP00000001986 dygtvfdqlvaeqsgtekevtelsmgellmhsavswlnpflslgkarkdleltvfvfkravilvykencklkkklps
Mpf_ENSMPUP00000006133 qlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtqvtreaislvcdavpgakg
Mpf_ENSMPUP00000009494 edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevdlfi........
Mpf_ENSMPUP00000004093 nhdpqfepivslpeqeiktleedeeelfkmra.............................................
Mpf_ENSMPUP00000012215 pdacplpgpgeptpgsrqdrhflqhllgmgmnyyvrymgcievlqsmrsldfgmrtqvtreaisrlceavsgangai
Mpf_ENSMPUP00000016175 egeyesvlcvkpevhvyrippratnrgyraaewqldqpswsgrlritakgqvayikledrtsgelfaqapvdqfpgt
Mpf_ENSMPUP00000009909 fadadewirkgsfihkpahgwlhpdarvlgpgvsyivrymgcieilrsmrsldfntrtqvtreainrlheavpg...
Mpf_ENSMPUP00000010977 edlidgiifaanylgstqllsernpsknirmmqaqeavsrvknsegdaqtltevdlfis..................
Mpf_ENSMPUP00000016638 eleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikledkvsgelfaqapveqypgi
Mpf_ENSMPUP00000018612 nhdpqfepiaslpeqeiktleddeeelfkmraklfrfasennlpewkeqgtgdv.......................
Mpf_ENSMPUP00000018966 nhdpqfepiaslpeqeiktleddeeelfkmraklfrfasennlpewkeqgtgdv.......................
Mpf_ENSMPUP00000004660 peeirnlladvetfvadtlrgenlskkakekreslikkikdvksiylqdfqdkgdtedgeeyddpfagppdtvslas
Mpf_ENSMPUP00000002149 vi...........................................................................
Mpf_ENSMPUP00000018066 nsatellkqgaacnvwylnsvemesltghqaiqkalsltlvqeppplctvvhfkvsaqgitltdnqrklffrrhy..
Mpf_ENSMPUP00000017958 islaalqrhdpyinrivdvasqvalytfghranewektdvegtlfvytrsaspk.......................
Mpf_ENSMPUP00000011450 disqyrvehlttfvldrkdamitvddgirklklldakgkvwtqdmilqvddravslidlesknel............
Mpf_ENSMPUP00000016402 nsttdllkqgaacnvlfvnsvdmesltgpqaiskatsetlaadptpaativhfkvsaqgitltdnq...........
Mpf_ENSMPUP00000004951 mgeqpifstrahvfqidpntkknwvptskhavt............................................
Mpf_ENSMPUP00000011363 dwgepsitlrppneatastpvqywqhhpeklifqscdykafylgsmlikelrgtestqdacakmrancqksteqmkk
Mpf_ENSMPUP00000015445 eqpifttrahvfqidpstkknwvpaskqavtvs............................................
Mpf_ENSMPUP00000015195 peeirwlmedaeeflgeglrnenlsatardhrdhilrgfqqvktryywdsqpqggdqaesylgqdssddnqsgthgp
Mpf_ENSMPUP00000011751 nidkiaqwqssiedweg............................................................
Mpf_ENSMPUP00000009831 nidkiaqwqasvldwege...........................................................
Mpf_ENSMPUP00000004111 edlldgvifgakylgstqlvsernpppstrmaqareamdrvkapdgetqpmtevdlfv...................
Mpf_ENSMPUP00000005349 til..........................................................................
Mpf_ENSMPUP00000006137 taadllrqgaacsvlyltsvetesltgpqavarassaalscspratpaivhfkvsaqgitltdnqr...........
Mpf_ENSMPUP00000009095 l............................................................................
Mpf_ENSMPUP00000005832 msetvicsswatvmlyddsnkrwlpagtgpqafsrvqiyhnptansf..............................
Mpf_ENSMPUP00000014567 dsrasclkksagchalyltsvsvetlsgalavrkaisttferdvlptptvvhfkvtdqgitltdvqrkvffrrhypl
Mpf_ENSMPUP00000015198 lrahpffesitwenlqhqtppkltaylpamseddedcygnydnllsqfgcmqvsssssshslstadaglphtagsni
Mpf_ENSMPUP00000008441 mrsldfstrtqitreaisrvceavpgakgafrkrkppskmlssilgktnlqfagmsisltvstaslnlrtp......
Mpf_ENSMPUP00000005146 emyginyfeiknkkgtdlwlgvda.....................................................
Mpf_ENSMPUP00000010667 fepvvplpdlvevssgeeneqvvfshraklyrydkdvgqwke...................................
Mpf_ENSMPUP00000000642 idkiarwqvsivgwegl............................................................
Mpf_ENSMPUP00000015373 reqpifstrahvfqidpatkrnwipagkhal..............................................
Mpf_ENSMPUP00000003213 eqreakltlrppslaapyapvqswqhqpeklifescgyeanylgsmlikdlrgtestqdacakmrkstehmkkipti
Mpf_ENSMPUP00000012196 fnslftreflhgmeillqheikylrkflgsteveqpkgtevvrdavrklkfarhikksegqkipkvelq........
Mpf_ENSMPUP00000012194 eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvlda........................
Mpf_ENSMPUP00000003212 eqreakltlrppslaapyapvqswqhqpeklifescgyeanylgsmlikdlrgtestqdacakmrkstehmkkipti
Mpf_ENSMPUP00000001158 emygvnyfsiknkkgselwlgvdal....................................................
Mpf_ENSMPUP00000010667 nedihfepivslpevevksgeedeeilfkeraklyrwdrevsqwkergigdikil......................
Mpf_ENSMPUP00000013386 llee.........................................................................
Mpf_ENSMPUP00000016712 mslaalkqhdpyitsiadltgqvalytfcpkanqwektdieg...................................
Mpf_ENSMPUP00000003302 emygvnyfeiknkkgtel...........................................................
Mpf_ENSMPUP00000003768 lrqsfrrkkdvyvpeasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktg
Mpf_ENSMPUP00000008012 dvsqylvnhlvtfclgeedgvhtvedasrklavmdsqgriwaqemllrvspdhvtlldpiskeelelyp........
Mpf_ENSMPUP00000002625 sil..........................................................................
Mpf_ENSMPUP00000010667 hfepvvqmpekvelvtgeedekvlysqrvklfrfdaeisqwkerglgnlkilknevngk..................
Mpf_ENSMPUP00000006140 lqvdfptpktelvqkfhvqylgmlpvdkpvgmdtlnnaienlmtssnked...........................
Mpf_ENSMPUP00000015670 klpenwtdtretllegmlfslkylgmtlveqpkgeelsaaavkrivatakasgkklqkvtl................
Mpf_ENSMPUP00000008341 pkvkaylsqgerfikwddettiaspvil.................................................
Mpf_ENSMPUP00000017573 peasrphqwqadedavrkgtcsfpvrylghveveesrgmhvcedavkklkamgrksvksvlwvsadglrvvddktkd
Mpf_ENSMPUP00000012859 tvvetlrrgskfikwdeeassrnlvtlrvdsngfflywtgpnmevdtldissirdtrtg..................
Mpf_ENSMPUP00000012131 h............................................................................
Mpf_ENSMPUP00000000172 emygirfhtasdregarinlavshmgvlvfqgttkintfnwsrvrklsfkrk.........................
Mpf_ENSMPUP00000013200 emygvnyfairnkkgtelllgvdal....................................................
Mpf_ENSMPUP00000003522 lerasnplaae..................................................................
Mpf_ENSMPUP00000011499 emygirlhpakdregtkinlavantgilvfqgftkinafnwakvrklsfkrkrfliklrp.................
Mpf_ENSMPUP00000011494 vprlpgetritdkeviyicpfngpikgr.................................................
Mpf_ENSMPUP00000012716 dafkiwvifnflsedkypliivpeeieyllkklteamgggwqqeqfehykinfddskdglsvwelieligngqfskg
Mpf_ENSMPUP00000002913 geqsicqarasvmvyddtskkwvpikpgqqgfsriniyhntasntfrvvgvklqdqqvvinysivkglkynqatptf
Mpf_ENSMPUP00000003504 hfrddddgpvssqgympylnkyildkveegafvkehfdelcwtltakknyrvdsngnsmlsnedafrlwclfnflse
Mpf_ENSMPUP00000004361 seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgn...................................
Mpf_ENSMPUP00000017389 dkdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrk..................................
Mpf_ENSMPUP00000015829 rlrlsrtlaakvelvdiq...........................................................
Mpf_ENSMPUP00000003644 clqhrvehlmtcklgthkvqdprdalrklqemdaqgrvwsqdlllqvrdgwlqll......................
Mpf_ENSMPUP00000006376 evpsflqegavfdryeeesfvfepnclfkvdefgffltwrsegkegqvlecslinsirlgatpkdpkilaaleavgk
Mpf_ENSMPUP00000014536 mygvdlhhakdsegvdiklgvcanglliykdrlrinrfawpkilkisykrsnfy.......................
Mpf_ENSMPUP00000011501 etplfpgesikatvkdvmyicpfmgavsgtltvtdfkm.......................................
Mpf_ENSMPUP00000017670 mygvdlhhakdsegidimlgvcanglliyrdrlrinrfawpkilkisykrsnfyikirpgeyeqfestigfklpnhr
Mpf_ENSMPUP00000006727 lftflgkkcvtmssavvqlyaadrncmwskkcsgvaclvkdnpqr................................
Mpf_ENSMPUP00000000961 elygvefhyardqsnneimigvmsggiliyknrvrmnifpwlkivkisfkckqffiqlrkevhesretllgfnmvny
Mpf_ENSMPUP00000004942 mygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyik.....................
Mpf_ENSMPUP00000002151 dmygirphpasdgegtqihlavahmgvlvlrgntkintfnwakirk...............................
Mpf_ENSMPUP00000014680 ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqriwvnislsgikiidekt
Mpf_ENSMPUP00000005563 klseypn......................................................................
Mpf_ENSMPUP00000011333 ineasnynmtsdyaahpmspigrtsraskkvhnfgkrsnsik...................................
Mpf_ENSMPUP00000000969 emygvdmhvvkardgndyslgltptgvlvfegetkiglffwpkitrldfkknkltlv....................
Mpf_ENSMPUP00000010395 aikkmneiqknidgweg............................................................
Mpf_ENSMPUP00000015361 mygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffi......................
Mpf_ENSMPUP00000001991 etygvdphpckdstgtttflgftaagfvvfqgnkrihlikwpdvcklkfegktfyvigi..................
Mpf_ENSMPUP00000005637 edywyeaynmrtgargvfpayyaievtkepehmaaltknsdwvdqfrvkflgsvqvpyhkgndvlcaamqkiattrr
Mpf_ENSMPUP00000007307 emygvdmhvvrgrdgceyslgltptgilifegankiglffwpkitkmdfkkskltlvvveddd..............
Mpf_ENSMPUP00000008193 yarvravvmtrddssggwlplggsglscvtvfkvphqeengcadffirgerlrdkmvvle.................
Mpf_ENSMPUP00000007177 shlrqssdp....................................................................
Mpf_ENSMPUP00000010360 tgydgnlselgkllmqgsfsvwtdh....................................................
Mpf_ENSMPUP00000010611 rtqetps......................................................................
Mpf_ENSMPUP00000007161 evllevkfirevtpyikkpslvsdlpwegaspqspsfsgsedsgspkh.............................
Mpf_ENSMPUP00000006134 yivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgflihgerqkdklvv..................
Mpf_ENSMPUP00000004983 aikkmneiqknidgweg............................................................
Mpf_ENSMPUP00000001920 dkecfkcalgsswiisvelaigpeegisyltdkgcnpthla....................................
Mpf_ENSMPUP00000013542 lfemlgrkcwtlatavvqlylalppgaehwtkehcgavcfvkdnpqksyfi..........................
Mpf_ENSMPUP00000008337 dlkssskfkngltfrkedmlq........................................................
Mpf_ENSMPUP00000013626 matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyad............................
Mpf_ENSMPUP00000001949 rkktqgfftmsrrrisckd..........................................................
Mpf_ENSMPUP00000017721 evvlevkymkevspyfknsasgtsvgwdsppasplqrqpsspgppprdlsdakrv......................
Mpf_ENSMPUP00000001109 evllevkymreatpyvkkgspvseigwetpppesprlgagasdalsaaqpcsfhrd.....................
Mpf_ENSMPUP00000001935 eddfwfrgfnmrtgergvfpafyahavpgpakdllgskrspcwverfdvqflgsvevpchqgngilcaamqkiatar
Mpf_ENSMPUP00000006252 kcllekvevitgeeaesnvlqiqcklfvfdktsqswvergrgllrlndmasaddgtlqsrlvmrtqgslrlilntkl
Mpf_ENSMPUP00000005676 egtlpfpaqslspeplpqeeeklpprnanpgikcfavrslgwvemteeelapgrssvavnncirqlsyhknnlhdpm
Mpf_ENSMPUP00000005196 l............................................................................
Mpf_ENSMPUP00000012589 emygvdlhpvygenkseyflgltpvgvvvyknkkqvgkyfwpritkvhfketq........................
Mpf_ENSMPUP00000010571 etygvdphpckdvsgnaaflaftpfgfvvlqgnkrvhfikwnevtklk.............................
Mpf_ENSMPUP00000011589 hnmvsevpperpsvratrtsrkaiafgkr................................................
Mpf_ENSMPUP00000005676 fqvefpapknelvqkfqvyylgnvpvakpvgvdvingalesvlssssre............................
Mpf_ENSMPUP00000002533 i............................................................................
Mpf_ENSMPUP00000004215 aprkefvvtmrpteasercrlrgsytlragetalelwgghelgsklyewpyrflrrfgrdkvtfsfeagrrcisgeg
Mpf_ENSMPUP00000013399 hqvtnvddegvelgsgvmeltqselvlhlqrreavrwpylclrrygydsnlfsfesgrrcq................
Mpf_ENSMPUP00000010530 rkelelqilteairswegddittlgsvvymsqvmvqc........................................
Mpf_ENSMPUP00000006089 dvnlkeqgqlvrqdeflvr..........................................................
Mpf_ENSMPUP00000016498 vqreqnerfnvylmptpnldiygectmqitheniylwdihnakvklvmwplsslrrygrdstw..............
Mpf_ENSMPUP00000007327 dfygvelhsgrdlhnlelmigiasagiavyrkyictsfypwvnilkisfkrkkffihqrqkqtesre..........
Mpf_ENSMPUP00000001749 gnlnelgkmimqgafsvwtgh........................................................
Mpf_ENSMPUP00000016475 n............................................................................
Mpf_ENSMPUP00000013206 rnqrpssmvsetstagttstveakpgpkimkssnkvhsfgkrdqairrnpnv.........................
Mpf_ENSMPUP00000006140 yaslklrhaphaeeddscsinsdpeakcfavrslgwvemaeedlapgkssvavnncirqlsyckndirdtvgiwg..
Mpf_ENSMPUP00000005780 ienktytklknghvfrkqalisk......................................................
Mpf_ENSMPUP00000001869 rkqlelqilsepiqawegesiktlgnvlfmsqvmvqygtceek..................................
Mpf_ENSMPUP00000012475 p............................................................................
Mpf_ENSMPUP00000008316 dgygeesypakdsqgsdicigaclegifvkhkngrppvvfrwhdianmshnksf.......................
Mpf_ENSMPUP00000001167 fkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlql............................
Mpf_ENSMPUP00000008230 sqfwvtvqrteaaercglqgsyvlrveaerltlltmgtqsqilepllfwpytllrrygrdk................
Mpf_ENSMPUP00000017717 mvqvravvmarddssggwlpvgggglsqvsvcrvrgarpeggarqghyvihgerlrdqkttlectlrpglvynkvn.
Mpf_ENSMPUP00000010272 dvslkeqgplrcqdefivccg........................................................
Mpf_ENSMPUP00000003964 p............................................................................
Mpf_ENSMPUP00000017478 lealeqlqshiegwegs............................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 lekkpqvaykteiiggvvvhtpinqnggdgqegsepgshailrrsqsyipttgsr......................
Mpf_ENSMPUP00000002870 vsyrtdivggvpiitptqkeevnecgesidrnnlkrsqshlpyfapk..............................
Mpf_ENSMPUP00000000151 tdlkeqgqllhrdpftvicgrkkc.....................................................
Mpf_ENSMPUP00000000216 airkmenlkklleiy..............................................................
Mpf_ENSMPUP00000007012 lrqitnfqlsienldq.............................................................
Mpf_ENSMPUP00000012096 lkkisefqssienlqvkle..........................................................
Mpf_ENSMPUP00000004281 denldvqgelilqdafqvwd.........................................................
Mpf_ENSMPUP00000004460 vqceqtdrfnvfllpcpnldvygecklqitheniylwd.......................................
Mpf_ENSMPUP00000011499 nkspdeatvadqeseddlsasrtslerqapprgnttvhvcwhrntsvsmvdfsvavenq..................
Mpf_ENSMPUP00000003498 lslassastisslgslstkkppravskvhafgkrgnalrrdpnl.................................
Mpf_ENSMPUP00000006723 qrdhgys......................................................................
Mpf_ENSMPUP00000006149 ereqserfnvylmpspnldvhgecalqityehiclwdvqnprvkliswplsalrrygrdaa................
Mpf_ENSMPUP00000011052 dgkiva.......................................................................
Mpf_ENSMPUP00000015653 typagvaetqeapeqpdtspvsgrkkskgvatrlsrrrvscre..................................
Mpf_ENSMPUP00000014937 pkcllekidvvtgeeaehnvlkincklfifnkttqswtergrgalrlndtassdcgtfq..................
Mpf_ENSMPUP00000006713 havrlqeiqsllinwkgpdl.........................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 lrrhhchacgkivcrncsrnkyplkylkdrmakvcdgcygelkkrggdvpgllrerpvsmsfplssprfsssafssv
Mpf_ENSMPUP00000011052 egfdeniesqgelilqesfqvwdp.....................................................
Mpf_ENSMPUP00000000930 ptygvhyyavkdkqgipwwlglsykgifqydyhdkvkprkifqwrqlenlyfrekkfsvevhdprrasvtrrtfghs
Mpf_ENSMPUP00000016865 ptygvhyyavkdkqglpwwlgisykgigqydlqdkvkprklfqwkqlenlyfrekkfavevhdprrisvsrrtfgqs
Mpf_ENSMPUP00000000090 lreikqfqlsienlnqpvllfgrpqgdgeirit............................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 lg...........................................................................
Mpf_ENSMPUP00000000172 lpgsvvcmppsrcmeevspeqesedarssrgslegqgqpranttvrvcwyrntsvsradhsaavenq..........
Mpf_ENSMPUP00000013402 dgfgqeifsvkdnhgnsvhlgiffmgifvrnrigrqaviyrwndignithnkstilvelinkeetalfhtddien..
Mpf_ENSMPUP00000012726 gvgrgggaagptsg...............................................................
Mpf_ENSMPUP00000010329 havrlqeiqslltnwkgpdltsyge....................................................
Mpf_ENSMPUP00000005886 cpsefddtfakkfevlfcgrvtvahkkappalideciekfkhvsgrrraefdvgsprsesprpaagpslpervppgp
Mpf_ENSMPUP00000011911 ensiysswqeagefpvvvqrteaatrcqlkgpyllvlgqdtiqlreasspq..........................
Mpf_ENSMPUP00000013895 hvqcdglaeqlifnsltnc..........................................................
Mpf_ENSMPUP00000009754 ppspppsppeippkplrlppefddsdydevpeegpgapaglmtkkeelpvshipravrvasllsegeelsedddqgd
Mpf_ENSMPUP00000017452 dsksimrmksgqmfakedlkrkklvrdggvfl.............................................
Mpf_ENSMPUP00000004281 gtltaqgkllqqdtfyvieldtgmqsrt.................................................
Mpf_ENSMPUP00000017577 papp.........................................................................
Mpf_ENSMPUP00000004977 raqapvpgkgpfgreel............................................................
Mpf_ENSMPUP00000017884 kfdagtllls...................................................................
Mpf_ENSMPUP00000007027 tvpvytalkgratqistvpfvdessgsdddccsqasfrtsvpcsesrktsglgspraikrgvsmsslssegdyaipp
Mpf_ENSMPUP00000012725 eklehklnqtpekwqqlwekvtvdlkeepradrlqrhpsgspgivstnltscqkrsllhlpdssmgqehsasispsn
Mpf_ENSMPUP00000000871 dqetyrceliqgwnitvdlvigpkgirqltsqdakptclaefkqirs..............................
Mpf_ENSMPUP00000006220 g............................................................................
Mpf_ENSMPUP00000008418 prqvelldavsqaaqkyealymgtlpvnkamgmdvlneaigtltt................................
Mpf_ENSMPUP00000003932 ykdvwqvivkprglghrkelsgvfrlcltdeevvfvrlnte....................................
Mpf_ENSMPUP00000001861 pvvlstpaqliapvvvakgtlsittteiyfevdeddpa.......................................
Mpf_ENSMPUP00000008418 smepgakcfavhslgwvevpeedlvpgkssiavnnciqqlaqtrsrsrsqppdgawgegqnmlmilkkda.......
Mpf_ENSMPUP00000006249 pn...........................................................................
Mpf_ENSMPUP00000003836 nt...........................................................................
Mpf_ENSMPUP00000015858 p............................................................................
Mpf_ENSMPUP00000002835 qddedlqal....................................................................
Mpf_ENSMPUP00000004473 airkmekmhkllevyer............................................................
Mpf_ENSMPUP00000000137 fqqsslqhkskkknkgpiagkskrrisckdlg.............................................
Mpf_ENSMPUP00000001907 egkltaqgkllgqdtfwvtepeaggllssrgrerrvflfeqivifsealgggvrggsqagyvykssikvsclglegn
Mpf_ENSMPUP00000014024 nt...........................................................................
Mpf_ENSMPUP00000001742 kt...........................................................................
Mpf_ENSMPUP00000000172 enlqkltelqrdlvg..............................................................
Mpf_ENSMPUP00000005480 vvt..........................................................................
Mpf_ENSMPUP00000018515 ntrrinivencfgaag.............................................................
Mpf_ENSMPUP00000009502 pslg.........................................................................
Mpf_ENSMPUP00000013672 malnknhsegggvivnntesilmsydhveltfndmknvpea....................................
Mpf_ENSMPUP00000011336 irkmermhkllkvye..............................................................
Mpf_ENSMPUP00000001410 sdcinsmvegselkk..............................................................
Mpf_ENSMPUP00000003424 gpelsaqe.....................................................................
Mpf_ENSMPUP00000007040 vslstpaqlvapsvvvkgtlsvtsselyfevdeed..........................................
Mpf_ENSMPUP00000019493 gqylvyngdlveyeadhma..........................................................
Mpf_ENSMPUP00000018830 qriaavescfga.................................................................
Mpf_ENSMPUP00000003141 dnedafynsqkfevlycgkvtvthkkapssliddciekfslheqqrlkiqgeqrgadagddpgvfeatapcpaadil
Mpf_ENSMPUP00000010983 q............................................................................
Mpf_ENSMPUP00000010498 triryalgevhrfhvavapgtklesgpatlhlcndvlvlardvppavmgqwklsdlrrygavpngfifeggtrcgy.
Mpf_ENSMPUP00000012786 v............................................................................
Mpf_ENSMPUP00000014114 vd...........................................................................
Mpf_ENSMPUP00000007256 klkgvvagarskgehkqkifltisfggikifdektgalqhhhavheis.............................
Mpf_ENSMPUP00000005608 affpspspgplprvlgassgaaqgagagllidcrasmsdnqswnssgse............................
Mpf_ENSMPUP00000002033 hhrrslgvylqegpvgstlslsldsdqssgstasssrqaarrststlysqfqtaes.....................
Mpf_ENSMPUP00000016751 npfgesgggtksetedsilhqlfivrflgsmevksddnpdvvyetmrqilaaraihnifrmteshllv.........
Mpf_ENSMPUP00000016435 sedlllmq.....................................................................
Mpf_ENSMPUP00000001167 d............................................................................
Mpf_ENSMPUP00000001585 erlkitalpl...................................................................
Mpf_ENSMPUP00000002351 ddikklgkllmhgsfnvwtvhkdrykmkd................................................
Mpf_ENSMPUP00000011499 nfqklhelkkdligi..............................................................
Mpf_ENSMPUP00000005375 enygiewhsvrdsegqklligvgpegisickddfcpinriaypvvqmatqsgknvyltvtke...............
Mpf_ENSMPUP00000015986 hrprcitkfaqyvgsfpvddldtqesvwlvqqqlwalkdcprrravilkfslqglkiysg.................
Mpf_ENSMPUP00000004747 prpsspsglpeedsvlfnkltylgcmkvssprnevealramatmksssqhpfpvtlyvpnvpegsvriidqsnnvel
Mpf_ENSMPUP00000009754 etqallgcgagvncfsgdpeaptplalaeqagqilqmeflrnnrttevprldsvkplekhysv..............
Mpf_ENSMPUP00000002257 eygvhfhrvhpekksqtgillgvcskgvlvfevhngirtlvlrfpwretkkisfskkkitl................
Mpf_ENSMPUP00000006734 ggndevdkllkeflhldltapipgaspe.................................................
Mpf_ENSMPUP00000003502 lqyefkaknik..................................................................
Mpf_ENSMPUP00000011019 epvllpgeivvnevnfvrkciatdtsqydlwgklicsnfkisfitddpmplqkfhyrnlllgehdvpltcieqivtv
Mpf_ENSMPUP00000003673 al...........................................................................
Mpf_ENSMPUP00000000383 eklvlsedcelitiidvipgrleittqhvyfydcsidkedgvgfdfkwphsqireihlrrynl..............
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 eg...........................................................................
Mpf_ENSMPUP00000007257 rrhhcracgkivcqacssnkygldylknqparvcehcfqelqkldhqhspkigspgnhkspssalssvlhsipsgrk
Mpf_ENSMPUP00000016774 tp...........................................................................
Mpf_ENSMPUP00000001960 qkslpdlpppkiiperkqlsipkiespegyyeeaepydaslnedgeavsssyesydeeenskgksaphqwp......
Mpf_ENSMPUP00000007610 vercmsamqagtqmvklrggskglv....................................................
Mpf_ENSMPUP00000017612 haarlqevqrrlggwtgpelsafgelvlegafrggggggprlrgg................................
Mpf_ENSMPUP00000007907 sdcisfmqagcelkkv.............................................................
Mpf_ENSMPUP00000014021 pgqgdsegsspftpaadedsvvfskltylgcasvnaprsevealrmmsilrsqcqisldvtlsvpnvsegtvrlldp
Mpf_ENSMPUP00000008982 peygvlvhrvlpekarvegemalgictkgvivyevtnnsriatlrfqwreirkistcr...................
Mpf_ENSMPUP00000005803 plsstsgnaessivssnaispy.......................................................
Mpf_ENSMPUP00000002728 vercmsvmqsgtqmiklkrgskgl.....................................................
Mpf_ENSMPUP00000007017 slst.........................................................................
Mpf_ENSMPUP00000003752 lfntvgldekqsattllvgprhgishvidlktnlttvlsefskis................................
Mpf_ENSMPUP00000001306 vqceglseqlvfnsvtnc...........................................................
Mpf_ENSMPUP00000005338 gvsfflvkekmkgknklvprllgitkecvmrv.............................................
Mpf_ENSMPUP00000001689 s............................................................................
Mpf_ENSMPUP00000010415 msssyesydeeeedgkgkktrhqwp....................................................
Mpf_ENSMPUP00000006220 kr...........................................................................
Mpf_ENSMPUP00000016350 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000018773 skrkklhitsedptytvlylgnattiqargdgctdlavgkiwskseagrqgtkmkltvsaqgirmvhaeeralrrpg
Mpf_ENSMPUP00000017599 nevs.........................................................................
Mpf_ENSMPUP00000016349 sisdcklsdvspigrdpsvssfssatltpsstcpslvdarsnsleqktpeansrasspctefeqfqivppvetpyla
Mpf_ENSMPUP00000015036 r............................................................................
Mpf_ENSMPUP00000007938 lpgdsnlslptldvetnddlispyasfssta..............................................
Mpf_ENSMPUP00000007257 nfqklmqiqys..................................................................
Mpf_ENSMPUP00000005203 dvavhyyrlykdkreieasltlgltmrgiqifqnldeekqllydfpwtnvgklvfvgkkfeil..............
Mpf_ENSMPUP00000000650 gvsfflvkekmkgknklvprllgitkdsvmrvd............................................
Mpf_ENSMPUP00000007937 dafy.........................................................................
Mpf_ENSMPUP00000007017 g............................................................................
Mpf_ENSMPUP00000012780 f............................................................................
Mpf_ENSMPUP00000002522 grvfkatlvqaekrsevtllvgprygishvintktnlvalladfshvnriemfteedsfvrve..............
Mpf_ENSMPUP00000004905 psh..........................................................................
Mpf_ENSMPUP00000011326 asl..........................................................................
Mpf_ENSMPUP00000009449 y............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 msdva........................................................................
Mpf_ENSMPUP00000017782 vdwfnalraarfhylqvafpgasdadlv.................................................
Mpf_ENSMPUP00000013550 al...........................................................................
Mpf_ENSMPUP00000017362 tvvansdesqlltpgkmnqrqgkeayptptkdlyqpffspasphsqgfergkedisqnkdesslsmsksksesklyn
Mpf_ENSMPUP00000006996 slaap........................................................................
Mpf_ENSMPUP00000004785 k............................................................................
Mpf_ENSMPUP00000014164 eefdcdlsdlrdmpeddgepckgaspepakspslrhsadlppplpqrpppedyyeealplgpgkspeyisshsaaps
Mpf_ENSMPUP00000016592 fstatvswdirtlystvpedaehkaenllvkeackfyssqwyvvnykyeqysgdirqlpraeykpeklpshsfevdh
Mpf_ENSMPUP00000000486 pkq..........................................................................
Mpf_ENSMPUP00000003712 nvda.........................................................................
Mpf_ENSMPUP00000006850 c............................................................................
Mpf_ENSMPUP00000015574 fqdvwpvtlrpkglgrtqglgsgry....................................................
Mpf_ENSMPUP00000014962 eklvlsaecqlvtvvavipglleittqhvyfydgsaerveteegighdfrrplaqlrev..................
Mpf_ENSMPUP00000016814 lepsseevqknlrpfctldltspmlgvaseyi.............................................
Mpf_ENSMPUP00000000139 vsp..........................................................................
Mpf_ENSMPUP00000012020 i............................................................................
Mpf_ENSMPUP00000006069 gkifnatlmlqdresyiallvgakygisqiissklnimstlaefanisrve..........................
Mpf_ENSMPUP00000017142 nlqklvhiehs..................................................................
Mpf_ENSMPUP00000013991 pvlfs........................................................................
Mpf_ENSMPUP00000010353 ekiqhmyrcarvqgldtseglllfgkehfyvidgftmtatreirdietlppnmhepiiprgarqgpsqlkrtcsifa
Mpf_ENSMPUP00000000014 k............................................................................
Mpf_ENSMPUP00000009546 pyv..........................................................................
Mpf_ENSMPUP00000012020 fgetedetfpeaedsllqqmfivrflgsmavktdntteviyeamrqvlaaraihnifrtteshlmvtsqtlrli...
Mpf_ENSMPUP00000016751 t............................................................................
Mpf_ENSMPUP00000000216 rrrhhcracghvvcwkcsdykaqleydggklnkvckdcyqiisgftdseekkrkgileiesaev.............
Mpf_ENSMPUP00000010854 mp...........................................................................
Mpf_ENSMPUP00000016813 mdk..........................................................................
Mpf_ENSMPUP00000002870 pyv..........................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 levleewqshiegwedlniialcyklslhsfmlnlvshfpfeerliflidsvvmlcvattrrlknskastdghryif
Mpf_ENSMPUP00000006780 mdkpa........................................................................
Mpf_ENSMPUP00000002802 ssvshssimhtesenlpetvkencqeetpettaspveyqdklylhlkenfskvkayameigkkipvpdqctiedsvr
Mpf_ENSMPUP00000011336 v............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 msdvt........................................................................
Mpf_ENSMPUP00000003141 pgdkrfrlwyvggscldrrttlpmlpwlmaeirrrsqkpeaggcgapaarevllvlsapflrcvpapgvgaaggvgp
Mpf_ENSMPUP00000013099 nkehg........................................................................
Mpf_ENSMPUP00000010983 q............................................................................
Mpf_ENSMPUP00000004910 dp...........................................................................
Mpf_ENSMPUP00000016233 vltqcqdvelsfphqpegssvfcg.....................................................
Mpf_ENSMPUP00000002953 esirvnrrcisvapsretagelllgkcgmyfvednasdtvessslqgelepasfswtyeeik...............
Mpf_ENSMPUP00000011716 f............................................................................
Mpf_ENSMPUP00000007767 vnss.........................................................................
Mpf_ENSMPUP00000014585 it...........................................................................
Mpf_ENSMPUP00000014164 kksslaelkgsvsraagrkitriisfskkkp..............................................
Mpf_ENSMPUP00000005886 pnepsvdfslqlvgslpvhslttmpmlpwvvaevrrlsgqsskkepgarqvrlcvspsglrcepepgksqqwdplic
Mpf_ENSMPUP00000013797 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfqhsqdvs.................................
Mpf_ENSMPUP00000004108 vy...........................................................................
Mpf_ENSMPUP00000009167 sqikralelgtvmtvfsfrkstperrtvqvimetrqvawsktadk................................
Mpf_ENSMPUP00000016226 pe...........................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 gsaffevkqttepnfpeilliainkygislidprtkdiltthpftk...............................
Mpf_ENSMPUP00000010607 nhedfaldasilnvamvvgylgsielpstscnlesdslqairgclrrlraeqkihslvtmrvlhdrvqlctdqaavl
Mpf_ENSMPUP00000015774 kqfgt........................................................................
Mpf_ENSMPUP00000008639 ededvramlqgsrlck.............................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 skvllchgel...................................................................
Mpf_ENSMPUP00000007001 eeliylsqkiefeckifplisq.......................................................
Mpf_ENSMPUP00000001986 v............................................................................
Mpf_ENSMPUP00000010415 t............................................................................
Mpf_ENSMPUP00000003836 aik..........................................................................
Mpf_ENSMPUP00000007027 lpr..........................................................................
Mpf_ENSMPUP00000002688 emmytinsqlefkikpfplv.........................................................
Mpf_ENSMPUP00000001373 smhqlqgnkeyg.................................................................
Mpf_ENSMPUP00000013700 tr...........................................................................
Mpf_ENSMPUP00000016589 gsaffevkqtsetsypdiiliainrhgvllihpktke........................................
Mpf_ENSMPUP00000015325 qdg..........................................................................
Mpf_ENSMPUP00000001960 ssyl.........................................................................
Mpf_ENSMPUP00000006310 gltyylvrfkgskkddilgvsynrliridaatgipmttwr.....................................
Mpf_ENSMPUP00000016747 qkdslidnsrvlcchgelknnrgvklhvflfqevlvitravthneqlcyqlyrqpipvkdllledlq..........
Mpf_ENSMPUP00000013323 spsrstsscsskqgsrqdswevveglrgem...............................................
Mpf_ENSMPUP00000007350 sdald........................................................................
Mpf_ENSMPUP00000017588 crslevgtvmtlfyskksqrperktfqvk................................................
Mpf_ENSMPUP00000007745 ikqqrlnrl....................................................................
Mpf_ENSMPUP00000006409 k............................................................................
Mpf_ENSMPUP00000015574 d............................................................................
Mpf_ENSMPUP00000008365 d............................................................................
Mpf_ENSMPUP00000001054 r............................................................................
Mpf_ENSMPUP00000017488 ikqqrlnrlcegssfrkig..........................................................
Mpf_ENSMPUP00000005234 eqmisiqkkmefkiksvpiis........................................................
Mpf_ENSMPUP00000013182 rpr..........................................................................
Mpf_ENSMPUP00000011513 ttpvyttlkgkatqissspflddssgseeedssrsssrtsesdtrnrsgpgspramkrgvslssvasesdyaippda
Mpf_ENSMPUP00000005385 githfiarfqggkkeeligiaynrlirmdastgdaiktwrfsnm.................................
Mpf_ENSMPUP00000009077 ekvtqkyslvivqghlvsegvllfghqhfyicenftlspvgdvy.................................
Mpf_ENSMPUP00000001767 eliktprvdnvvlhrpfypavegtlc...................................................
Mpf_ENSMPUP00000007827 py...........................................................................
Mpf_ENSMPUP00000000541 ad...........................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 e............................................................................
Mpf_ENSMPUP00000013182 gisyivvrfkgsrkdeilgiannrliridlavgdvvktwrfsnmrq...............................
Mpf_ENSMPUP00000005315 gnh..........................................................................
Mpf_ENSMPUP00000014585 gn...........................................................................
Mpf_ENSMPUP00000015166 r............................................................................
Mpf_ENSMPUP00000002409 rrvkvytlnedrqwddrgtghvsstyveelkgmsllvraesdgsl................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 elpwtlqrrlirlraasghrtagsavcasrvklqhlp........................................
Mpf_ENSMPUP00000017782 pdkq.........................................................................
Mpf_ENSMPUP00000019464 sd...........................................................................
Mpf_ENSMPUP00000012725 rpallpgeeivceglrvlldpdgreeatggllggpqllpaegalflttyrilfrgtphdqlvgeqtvvrsfpias..
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 elerplhpkervleqalqwcqlpepcsaslllrkvslaqagclftgirresp.........................
Mpf_ENSMPUP00000009654 v............................................................................
Mpf_ENSMPUP00000005385 kp...........................................................................
Mpf_ENSMPUP00000006310 rp...........................................................................
Mpf_ENSMPUP00000007963 p............................................................................
Mpf_ENSMPUP00000002310 rai..........................................................................
Mpf_ENSMPUP00000000486 qa...........................................................................
Mpf_ENSMPUP00000007805 rrvkvytlnedrqwddrgtghvssgyverlkgmsllvr.......................................
Mpf_ENSMPUP00000010246 eklhmeckaemvtplvtnpgh........................................................
Mpf_ENSMPUP00000004460 d............................................................................
Mpf_ENSMPUP00000014791 lhccdeavsfslrsyehtrdlslflfndallvssrgtvhtpfertsks.............................
Mpf_ENSMPUP00000003154 dk...........................................................................
Mpf_ENSMPUP00000005214 kndqhlrrvqallsgrqakglt.......................................................
Mpf_ENSMPUP00000003932 e............................................................................
Mpf_ENSMPUP00000008710 dckvdsigs....................................................................
Mpf_ENSMPUP00000005632 lirqqrllr....................................................................
Mpf_ENSMPUP00000002828 kgehrqllkdsfmvelvega.........................................................
Mpf_ENSMPUP00000017859 kvenvrlvdriss................................................................
Mpf_ENSMPUP00000013754 gssa.........................................................................
Mpf_ENSMPUP00000004548 p............................................................................
Mpf_ENSMPUP00000000646 kveqvklldrfstnnksltgtl.......................................................
Mpf_ENSMPUP00000004473 lcsslqvsds...................................................................
Mpf_ENSMPUP00000000402 p............................................................................
Mpf_ENSMPUP00000007412 eqmyelharldfgrvkslplisasr....................................................
Mpf_ENSMPUP00000004935 psgeeifatiiitgnggiqwsrgkhkesetlteqdlqlycdfpdiidvtikqasqegsnesri..............
Mpf_ENSMPUP00000011513 kvkh.........................................................................
Mpf_ENSMPUP00000001759 p............................................................................
Mpf_ENSMPUP00000008353 ls...........................................................................
Mpf_ENSMPUP00000012083 p............................................................................
Mpf_ENSMPUP00000006956 sq...........................................................................
Mpf_ENSMPUP00000014860 p............................................................................
Mpf_ENSMPUP00000009647 mivgkkpvlslphrrlvcccqlyevpdpnr...............................................
Mpf_ENSMPUP00000005803 aa...........................................................................
Mpf_ENSMPUP00000005109 v............................................................................
Mpf_ENSMPUP00000006149 qn...........................................................................
Mpf_ENSMPUP00000001981 rai..........................................................................
Mpf_ENSMPUP00000017916 yvtkveksivgmktvlsvphrrlvccsrlfevtdvnklqk.....................................
Mpf_ENSMPUP00000003318 ssrtllidgrvelkr..............................................................
Mpf_ENSMPUP00000017175 vlslphrrlvcycrlfevpdpnkpqkl..................................................
Mpf_ENSMPUP00000016038 s............................................................................
Mpf_ENSMPUP00000016192 ihfegkifplisqarwlvrhgelvelaplpaappaklkl......................................
Mpf_ENSMPUP00000015325 nirknlaiermiiegceilldtsqtfvrqgsliqvpmsekgkitrgrlgsls.........................
Mpf_ENSMPUP00000000660 lssst........................................................................
Mpf_ENSMPUP00000005493 tgclpgeqilgwapgvrkglepelpgtlictnlrvtfqpcgwqrsqetplsseydfvlvni................
Mpf_ENSMPUP00000009754 khgmmkfredrsll...............................................................
Mpf_ENSMPUP00000013796 penleqpflsvfkkgrrrvpvrdlgkvvhyakvqlrfqhsqdvs.................................
Mpf_ENSMPUP00000010667 hfepvvplpdkievktgeedeeeffcnra................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 nfl..........................................................................
Mpf_ENSMPUP00000006359 qdpklrelldvgnigrlehrmitvvygpdlvni............................................
Mpf_ENSMPUP00000015086 lhllpgeqllceastvlkyvqedscqrgiygklvctdfkiaflgddesaldndetqfknkvigenditlhcvdqiyg
Mpf_ENSMPUP00000008387 nirknlaiermivegcdilldtsqtfirqgsliqvpsvergklskvrlgsls.........................
Mpf_ENSMPUP00000015207 daliaisnyrlhikfkdsvinvplrmidtvesr............................................
Mpf_ENSMPUP00000004217 thsgckvtylgkvpttg............................................................
Mpf_ENSMPUP00000015689 gedakgllrvagdsgiawssggqealqpfcdfpeivdisikqapcvgpagehrlvtvtrtdnqi.............
Mpf_ENSMPUP00000015159 lrgpeapplrgtlcv..............................................................
Mpf_ENSMPUP00000018833 vkvyslnedqqwddlgtghvsstyvkrlqgvsllvrsdsqaalilesk.............................
Mpf_ENSMPUP00000007866 a............................................................................
Mpf_ENSMPUP00000007938 qp...........................................................................
Mpf_ENSMPUP00000010694 ntdtlscsswptsp...............................................................
Mpf_ENSMPUP00000013131 iialsnyrlhikfkeslvn..........................................................
Mpf_ENSMPUP00000000312 hagrfsv......................................................................
Mpf_ENSMPUP00000019132 at...........................................................................
Mpf_ENSMPUP00000015959 lseldlgaerdvrvwplhpsl........................................................
Mpf_ENSMPUP00000012612 n............................................................................
Mpf_ENSMPUP00000007938 lyrkphpqypdhsqllqalcaavagpnllknmtqllcveasegeepwspaaldgsfpglqlpdpspgvynevvv...
Mpf_ENSMPUP00000007989 eelirltqrlrfhkvkalplvswsrrlelqgeltelgcrrggvlftsrprftp........................
Mpf_ENSMPUP00000016156 deeasdeppkvvvtevkeedafys.....................................................
Mpf_ENSMPUP00000013721 r............................................................................
Mpf_ENSMPUP00000005447 pe...........................................................................
Mpf_ENSMPUP00000015768 e............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 eed..........................................................................
Mpf_ENSMPUP00000002188 mpd..........................................................................
Mpf_ENSMPUP00000013446 pes..........................................................................
Mpf_ENSMPUP00000012407 etgt.........................................................................
Mpf_ENSMPUP00000017043 egmimkrsgghripglnccgq........................................................
Mpf_ENSMPUP00000007898 vfpvfvqpldlcnpartlllseelllyegrnkaievtlfa.....................................
Mpf_ENSMPUP00000017064 qkqifdvvyevdgcpanllsshrslvqrvetislgehpcdrgeqvtlf.............................
Mpf_ENSMPUP00000009754 ha...........................................................................
Mpf_ENSMPUP00000016461 s............................................................................
Mpf_ENSMPUP00000008230 ga...........................................................................
Mpf_ENSMPUP00000001993 enevc........................................................................
Mpf_ENSMPUP00000014500 t............................................................................
Mpf_ENSMPUP00000002405 silg.........................................................................
Mpf_ENSMPUP00000002933 pglqs........................................................................
Mpf_ENSMPUP00000007268 ssilg........................................................................
Mpf_ENSMPUP00000010983 a............................................................................
Mpf_ENSMPUP00000010498 egqv.........................................................................
Mpf_ENSMPUP00000018101 ay...........................................................................
Mpf_ENSMPUP00000002033 rprllpgeecvldglrvyllpdgreegaggsgggpallpaegavflttyrviftgmptdplvgeqvvvrsfpvaalt
Mpf_ENSMPUP00000010694 pv...........................................................................
Mpf_ENSMPUP00000008353 da...........................................................................
Mpf_ENSMPUP00000009754 ferlgrlpyka..................................................................
Mpf_ENSMPUP00000015718 gta..........................................................................
Mpf_ENSMPUP00000002358 ay...........................................................................
Mpf_ENSMPUP00000005077 csavecldlgrgepvsvkplhssi.....................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 gqrqlllcetltetvygdrgqlikskerrvfllndmlvcaninfkpannrgqleisslvplgpkyvvkwntalpqvq
Mpf_ENSMPUP00000011911 pl...........................................................................
Mpf_ENSMPUP00000007938 gllrl........................................................................
Mpf_ENSMPUP00000009676 harvlqeieahiegmedlqaplrrflrqemvievkavggkkdrslflftdliicttlkrks................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 mqlp.........................................................................
Mpf_ENSMPUP00000006638 wtyfcdfqdi...................................................................
Mpf_ENSMPUP00000005803 dli..........................................................................
Mpf_ENSMPUP00000010983 tlpy.........................................................................
Mpf_ENSMPUP00000000717 nfsyfpeithivike..............................................................
Mpf_ENSMPUP00000002793 geivktkerrvfllsdvlmcatvsartadsnalaspgrkyllkwsvplgrvevveygssdgagenrcppvhppesla
Mpf_ENSMPUP00000007833 mdhldrill....................................................................
Mpf_ENSMPUP00000002271 an...........................................................................
Mpf_ENSMPUP00000010974 s............................................................................
Mpf_ENSMPUP00000010755 egvirkrsgghrvpgltccgr........................................................
Mpf_ENSMPUP00000013112 ldtcaefrikyvgaieklkfsegkslegpldlinyidvaqqdgklpfvpleeefimgvskygikvsssdqydvlhr.


                                                                                                    
                                                                                                    
d1wg7a_                .............................................................................
Mpf_ENSMPUP00000000236 hflillfskdedisltlnmneeevekrfegrltknmsgslyemvsrvmkalvnrkitvpgnfqghsgaqcitcsyka
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000001986 nsrpahnsadld.................................................................
Mpf_ENSMPUP00000006133 atrrrkpcsrpl.................................................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 .............................................................................
Mpf_ENSMPUP00000012215 kkrkppvkflstvlgksnlqf........................................................
Mpf_ENSMPUP00000016175 aves.........................................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 a............................................................................
Mpf_ENSMPUP00000018612 .............................................................................
Mpf_ENSMPUP00000018966 .............................................................................
Mpf_ENSMPUP00000004660 erydkddeahsegnqfppiaaq.......................................................
Mpf_ENSMPUP00000002149 .............................................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 .............................................................................
Mpf_ENSMPUP00000011363 vptiilsvsykgvkfidat..........................................................
Mpf_ENSMPUP00000015445 .............................................................................
Mpf_ENSMPUP00000015195 sltsdapflpdyqdegvedllkga.....................................................
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 ttlrf........................................................................
Mpf_ENSMPUP00000015198 eqyihdldtnsfeldlefsedekrlllekqasgnpwhqfvennl.................................
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000000642 .............................................................................
Mpf_ENSMPUP00000015373 .............................................................................
Mpf_ENSMPUP00000003213 ilsitykgvkfidasnknviaeh......................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 .............................................................................
Mpf_ENSMPUP00000003212 ilsitykgvkfidasnknviaeh......................................................
Mpf_ENSMPUP00000001158 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 .............................................................................
Mpf_ENSMPUP00000003768 kkavkavlwvsadglrvvdektkdlivdqtiek............................................
Mpf_ENSMPUP00000008012 .............................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 .............................................................................
Mpf_ENSMPUP00000017573 llvdqtiekvsfcapd.............................................................
Mpf_ENSMPUP00000012859 .............................................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013200 .............................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 mdrqtvsmainevfnelil..........................................................
Mpf_ENSMPUP00000002913 hqwrda.......................................................................
Mpf_ENSMPUP00000003504 dkyplimvpdeveyllkkvlssmslevglgeleellaqeaqaaqttgglsvwqflelfnsgrclrgvgrdtlsmaih
Mpf_ENSMPUP00000004361 .............................................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 .............................................................................
Mpf_ENSMPUP00000006376 sendlegrivcvcsgtdlvn.........................................................
Mpf_ENSMPUP00000014536 .............................................................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 sakrl........................................................................
Mpf_ENSMPUP00000006727 .............................................................................
Mpf_ENSMPUP00000000961 rackn........................................................................
Mpf_ENSMPUP00000004942 .............................................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 gviehehpvnkisfiardvtd........................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 .............................................................................
Mpf_ENSMPUP00000010395 .............................................................................
Mpf_ENSMPUP00000015361 .............................................................................
Mpf_ENSMPUP00000001991 .............................................................................
Mpf_ENSMPUP00000005637 ltvhfnppss...................................................................
Mpf_ENSMPUP00000007307 .............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 .............................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 .............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 .............................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 .............................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 kltvhlrppascd................................................................
Mpf_ENSMPUP00000006252 wa...........................................................................
Mpf_ENSMPUP00000005676 sggwgegkdlll.................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 .............................................................................
Mpf_ENSMPUP00000010571 .............................................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 nfefetrqgneif................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 .............................................................................
Mpf_ENSMPUP00000007327 .............................................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 .............................................................................
Mpf_ENSMPUP00000012096 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 fhsinpstfkkqkkvp.............................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 giavhtwyacpa.................................................................
Mpf_ENSMPUP00000016865 glfvqtwyanps.................................................................
Mpf_ENSMPUP00000000090 .............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013402 .............................................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 pagdgepgrgpmrksfsqpglrslafrkefqdgslrsrsffssfeendienhlisghnvvqptdmeenrtmlftigq
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 .............................................................................
Mpf_ENSMPUP00000009754 ededdhayegipnggwhtsslssslpssllipelpph........................................
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 .............................................................................
Mpf_ENSMPUP00000007027 daysldsdysepehklqrtssysae....................................................
Mpf_ENSMPUP00000012725 gvdrraatlysqyasrn............................................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 l............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 .............................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 aeegdgvpdilptlpatasqpglpssragfperiledsgfdeqqefrsrcssvtgvlqkkvhensqkplprrrhasa
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 .............................................................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 asfpiykvlfcarg...............................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 ndh..........................................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 qkkip........................................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 .............................................................................
Mpf_ENSMPUP00000014021 qtnteianypiykil..............................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 .............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 ragkneflnlvpdiee.............................................................
Mpf_ENSMPUP00000018773 h............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 ragkneflnlvpdiee.............................................................
Mpf_ENSMPUP00000015036 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 .............................................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 .............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 gsekdssasskltkkeslkvqkknyreekkratkel.........................................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 .............................................................................
Mpf_ENSMPUP00000014164 tnptdgcspahsimdgyyedadssypatrmngelknsyndsdpmsssyesydeeeeegkgpqpthqw..........
Mpf_ENSMPUP00000016592 edadkdedttshs................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 yedi.........................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 rgr..........................................................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 scvaklfftcslkghyclyskssfilisqepqpwiqimflfqqslfpeplsiqshsvqflralwektqaegahsfet
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 aaaqpnpavfifehkaqhisrfihnshdltyfayli.........................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 .............................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 ssifeckpqhvhklihnshdpsyfac...................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 .............................................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 .............................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 .............................................................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 ystdteysqpeqklpktcssssdngkn..................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 .............................................................................
Mpf_ENSMPUP00000001767 .............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 .............................................................................
Mpf_ENSMPUP00000005632 .............................................................................
Mpf_ENSMPUP00000002828 .............................................................................
Mpf_ENSMPUP00000017859 .............................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 .............................................................................
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 vfdekkkplfgqlkk..............................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 .............................................................................
Mpf_ENSMPUP00000015768 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 .............................................................................
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 .............................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 k............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 vvevgqesgsydkdnvliqhagakkasavgqaqnkvyfgpprlfqelqdlqkdlavveqitflistlhgtyqnlnmt
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 vvanakpnqvyvgpgqlyqdlqnllhdlnvvgqisqlvgslrgnyqnlnqsvahdwtsglqrlilkkeeairaadcc
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                                                                                    
                                                                                                    
d1wg7a_                .......................................................................GSSGSS
Mpf_ENSMPUP00000000236 ....................................ssgllyplergfiyvhkppvhirfdeisfvnfarg------
Mpf_ENSMPUP00000001054 .......................................................................------
Mpf_ENSMPUP00000001986 .......................................................................------
Mpf_ENSMPUP00000006133 .......................................................................------
Mpf_ENSMPUP00000009494 .......................................................................------
Mpf_ENSMPUP00000004093 .......................................................................------
Mpf_ENSMPUP00000012215 .......................................................................------
Mpf_ENSMPUP00000016175 .......................................................................------
Mpf_ENSMPUP00000009909 .......................................................................------
Mpf_ENSMPUP00000010977 .......................................................................------
Mpf_ENSMPUP00000016638 .......................................................................------
Mpf_ENSMPUP00000018612 .......................................................................------
Mpf_ENSMPUP00000018966 .......................................................................------
Mpf_ENSMPUP00000004660 .......................................................................------
Mpf_ENSMPUP00000002149 .......................................................................------
Mpf_ENSMPUP00000018066 .......................................................................------
Mpf_ENSMPUP00000017958 .......................................................................------
Mpf_ENSMPUP00000011450 .......................................................................------
Mpf_ENSMPUP00000016402 .......................................................................------
Mpf_ENSMPUP00000004951 .......................................................................------
Mpf_ENSMPUP00000011363 .......................................................................------
Mpf_ENSMPUP00000015445 .......................................................................------
Mpf_ENSMPUP00000015195 .......................................................................------
Mpf_ENSMPUP00000011751 .......................................................................------
Mpf_ENSMPUP00000009831 .......................................................................------
Mpf_ENSMPUP00000004111 .......................................................................------
Mpf_ENSMPUP00000005349 .......................................................................------
Mpf_ENSMPUP00000006137 .......................................................................------
Mpf_ENSMPUP00000009095 .......................................................................------
Mpf_ENSMPUP00000005832 .......................................................................------
Mpf_ENSMPUP00000014567 .......................................................................------
Mpf_ENSMPUP00000015198 .......................................................................------
Mpf_ENSMPUP00000008441 .......................................................................------
Mpf_ENSMPUP00000005146 .......................................................................------
Mpf_ENSMPUP00000010667 .......................................................................------
Mpf_ENSMPUP00000000642 .......................................................................------
Mpf_ENSMPUP00000015373 .......................................................................------
Mpf_ENSMPUP00000003213 .......................................................................------
Mpf_ENSMPUP00000012196 .......................................................................------
Mpf_ENSMPUP00000012194 .......................................................................------
Mpf_ENSMPUP00000003212 .......................................................................------
Mpf_ENSMPUP00000001158 .......................................................................------
Mpf_ENSMPUP00000010667 .......................................................................------
Mpf_ENSMPUP00000013386 .......................................................................------
Mpf_ENSMPUP00000016712 .......................................................................------
Mpf_ENSMPUP00000003302 .......................................................................------
Mpf_ENSMPUP00000003768 .......................................................................------
Mpf_ENSMPUP00000008012 .......................................................................------
Mpf_ENSMPUP00000002625 .......................................................................------
Mpf_ENSMPUP00000010667 .......................................................................------
Mpf_ENSMPUP00000006140 .......................................................................------
Mpf_ENSMPUP00000015670 .......................................................................------
Mpf_ENSMPUP00000008341 .......................................................................------
Mpf_ENSMPUP00000017573 .......................................................................------
Mpf_ENSMPUP00000012859 .......................................................................------
Mpf_ENSMPUP00000012131 .......................................................................------
Mpf_ENSMPUP00000000172 .......................................................................------
Mpf_ENSMPUP00000013200 .......................................................................------
Mpf_ENSMPUP00000003522 .......................................................................------
Mpf_ENSMPUP00000011499 .......................................................................------
Mpf_ENSMPUP00000011494 .......................................................................------
Mpf_ENSMPUP00000012716 .......................................................................------
Mpf_ENSMPUP00000002913 .......................................................................------
Mpf_ENSMPUP00000003504 ..................................................................evyqe------
Mpf_ENSMPUP00000004361 .......................................................................------
Mpf_ENSMPUP00000017389 .......................................................................------
Mpf_ENSMPUP00000015829 .......................................................................------
Mpf_ENSMPUP00000003644 .......................................................................------
Mpf_ENSMPUP00000006376 .......................................................................------
Mpf_ENSMPUP00000014536 .......................................................................------
Mpf_ENSMPUP00000011501 .......................................................................------
Mpf_ENSMPUP00000017670 .......................................................................------
Mpf_ENSMPUP00000006727 .......................................................................------
Mpf_ENSMPUP00000000961 .......................................................................------
Mpf_ENSMPUP00000004942 .......................................................................------
Mpf_ENSMPUP00000002151 .......................................................................------
Mpf_ENSMPUP00000014680 .......................................................................------
Mpf_ENSMPUP00000005563 .......................................................................----VE
Mpf_ENSMPUP00000011333 .......................................................................------
Mpf_ENSMPUP00000000969 .......................................................................------
Mpf_ENSMPUP00000010395 .......................................................................------
Mpf_ENSMPUP00000015361 .......................................................................------
Mpf_ENSMPUP00000001991 .......................................................................------
Mpf_ENSMPUP00000005637 .......................................................................------
Mpf_ENSMPUP00000007307 .......................................................................------
Mpf_ENSMPUP00000008193 .......................................................................------
Mpf_ENSMPUP00000007177 .......................................................................---MLS
Mpf_ENSMPUP00000010360 .......................................................................------
Mpf_ENSMPUP00000010611 .......................................................................------
Mpf_ENSMPUP00000007161 .......................................................................------
Mpf_ENSMPUP00000006134 .......................................................................------
Mpf_ENSMPUP00000004983 .......................................................................------
Mpf_ENSMPUP00000001920 .......................................................................------
Mpf_ENSMPUP00000013542 .......................................................................------
Mpf_ENSMPUP00000008337 .......................................................................------
Mpf_ENSMPUP00000013626 .......................................................................------
Mpf_ENSMPUP00000001949 .......................................................................------
Mpf_ENSMPUP00000017721 .......................................................................------
Mpf_ENSMPUP00000001109 .......................................................................------
Mpf_ENSMPUP00000001935 .......................................................................------
Mpf_ENSMPUP00000006252 .......................................................................------
Mpf_ENSMPUP00000005676 .......................................................................------
Mpf_ENSMPUP00000005196 .......................................................................------
Mpf_ENSMPUP00000012589 .......................................................................------
Mpf_ENSMPUP00000010571 .......................................................................------
Mpf_ENSMPUP00000011589 .......................................................................------
Mpf_ENSMPUP00000005676 .......................................................................------
Mpf_ENSMPUP00000002533 .......................................................................------
Mpf_ENSMPUP00000004215 .......................................................................------
Mpf_ENSMPUP00000013399 .......................................................................------
Mpf_ENSMPUP00000010530 .......................................................................------
Mpf_ENSMPUP00000006089 .......................................................................------
Mpf_ENSMPUP00000016498 .......................................................................------
Mpf_ENSMPUP00000007327 .......................................................................------
Mpf_ENSMPUP00000001749 .......................................................................------
Mpf_ENSMPUP00000016475 .......................................................................------
Mpf_ENSMPUP00000013206 .......................................................................------
Mpf_ENSMPUP00000006140 .......................................................................------
Mpf_ENSMPUP00000005780 .......................................................................------
Mpf_ENSMPUP00000001869 .......................................................................------
Mpf_ENSMPUP00000012475 .......................................................................------
Mpf_ENSMPUP00000008316 .......................................................................------
Mpf_ENSMPUP00000001167 .......................................................................------
Mpf_ENSMPUP00000008230 .......................................................................------
Mpf_ENSMPUP00000017717 .......................................................................------
Mpf_ENSMPUP00000010272 .......................................................................------
Mpf_ENSMPUP00000003964 .......................................................................------
Mpf_ENSMPUP00000017478 .......................................................................------
Mpf_ENSMPUP00000010168 .......................................................................------
Mpf_ENSMPUP00000009546 .......................................................................------
Mpf_ENSMPUP00000002870 .......................................................................------
Mpf_ENSMPUP00000000151 .......................................................................------
Mpf_ENSMPUP00000000216 .......................................................................--EMLG
Mpf_ENSMPUP00000007012 .......................................................................------
Mpf_ENSMPUP00000012096 .......................................................................------
Mpf_ENSMPUP00000004281 .......................................................................------
Mpf_ENSMPUP00000004460 .......................................................................------
Mpf_ENSMPUP00000011499 .......................................................................------
Mpf_ENSMPUP00000003498 .......................................................................------
Mpf_ENSMPUP00000006723 .......................................................................------
Mpf_ENSMPUP00000006149 .......................................................................------
Mpf_ENSMPUP00000011052 .......................................................................------
Mpf_ENSMPUP00000015653 .......................................................................------
Mpf_ENSMPUP00000014937 .......................................................................------
Mpf_ENSMPUP00000006713 .......................................................................------
Mpf_ENSMPUP00000005370 .......................................................................------
Mpf_ENSMPUP00000017142 .......................................................................-----S
Mpf_ENSMPUP00000011052 .......................................................................------
Mpf_ENSMPUP00000000930 .......................................................................------
Mpf_ENSMPUP00000016865 .......................................................................------
Mpf_ENSMPUP00000000090 .......................................................................------
Mpf_ENSMPUP00000012035 .......................................................................------
Mpf_ENSMPUP00000009068 .......................................................................------
Mpf_ENSMPUP00000000172 .......................................................................------
Mpf_ENSMPUP00000013402 .......................................................................------
Mpf_ENSMPUP00000012726 .......................................................................------
Mpf_ENSMPUP00000010329 .......................................................................------
Mpf_ENSMPUP00000005886 .....................sevylispdtkkialeknfkeisfcsqgirhvdhfgficressggggfhf------
Mpf_ENSMPUP00000011911 .......................................................................------
Mpf_ENSMPUP00000013895 .......................................................................------
Mpf_ENSMPUP00000009754 .......................................................................---PMD
Mpf_ENSMPUP00000017452 .......................................................................------
Mpf_ENSMPUP00000004281 .......................................................................------
Mpf_ENSMPUP00000017577 .......................................................................------
Mpf_ENSMPUP00000004977 .......................................................................------
Mpf_ENSMPUP00000017884 .......................................................................------
Mpf_ENSMPUP00000007027 .......................................................................------
Mpf_ENSMPUP00000012725 .......................................................................------
Mpf_ENSMPUP00000000871 .......................................................................------
Mpf_ENSMPUP00000006220 .......................................................................------
Mpf_ENSMPUP00000008418 .......................................................................------
Mpf_ENSMPUP00000003932 .......................................................................------
Mpf_ENSMPUP00000001861 .......................................................................------
Mpf_ENSMPUP00000008418 .......................................................................------
Mpf_ENSMPUP00000006249 .......................................................................------
Mpf_ENSMPUP00000003836 .......................................................................------
Mpf_ENSMPUP00000015858 .......................................................................------
Mpf_ENSMPUP00000002835 .......................................................................------
Mpf_ENSMPUP00000004473 .......................................................................----LG
Mpf_ENSMPUP00000000137 .......................................................................------
Mpf_ENSMPUP00000001907 .......................................................................------
Mpf_ENSMPUP00000014024 .......................................................................------
Mpf_ENSMPUP00000001742 .......................................................................------
Mpf_ENSMPUP00000000172 .......................................................................------
Mpf_ENSMPUP00000005480 .......................................................................------
Mpf_ENSMPUP00000018515 .......................................................................------
Mpf_ENSMPUP00000009502 .......................................................................------
Mpf_ENSMPUP00000013672 .......................................................................------
Mpf_ENSMPUP00000011336 .......................................................................---LLG
Mpf_ENSMPUP00000001410 .......................................................................------
Mpf_ENSMPUP00000003424 .......................................................................------
Mpf_ENSMPUP00000007040 .......................................................................------
Mpf_ENSMPUP00000019493 .......................................................................------
Mpf_ENSMPUP00000018830 .......................................................................------
Mpf_ENSMPUP00000003141 pshvqpsdseknrtmlfqvgrfeinlispdtksvvleknfkdisscsqgikhvdhfgficresaepglgqy------
Mpf_ENSMPUP00000010983 .......................................................................------
Mpf_ENSMPUP00000010498 .......................................................................------
Mpf_ENSMPUP00000012786 .......................................................................------
Mpf_ENSMPUP00000014114 .......................................................................------
Mpf_ENSMPUP00000007256 .......................................................................------
Mpf_ENSMPUP00000005608 .......................................................................------
Mpf_ENSMPUP00000002033 .......................................................................------
Mpf_ENSMPUP00000016751 .......................................................................------
Mpf_ENSMPUP00000016435 .......................................................................------
Mpf_ENSMPUP00000001167 .......................................................................------
Mpf_ENSMPUP00000001585 .......................................................................------
Mpf_ENSMPUP00000002351 .......................................................................------
Mpf_ENSMPUP00000011499 .......................................................................------
Mpf_ENSMPUP00000005375 .......................................................................------
Mpf_ENSMPUP00000015986 .......................................................................------
Mpf_ENSMPUP00000004747 .......................................................................------
Mpf_ENSMPUP00000009754 .......................................................................------
Mpf_ENSMPUP00000002257 .......................................................................------
Mpf_ENSMPUP00000006734 .......................................................................------
Mpf_ENSMPUP00000003502 .......................................................................------
Mpf_ENSMPUP00000011019 .......................................................................------
Mpf_ENSMPUP00000003673 .......................................................................------
Mpf_ENSMPUP00000000383 .......................................................................------
Mpf_ENSMPUP00000008997 .......................................................................------
Mpf_ENSMPUP00000010040 .......................................................................------
Mpf_ENSMPUP00000007257 .......................................................................-----A
Mpf_ENSMPUP00000016774 .......................................................................------
Mpf_ENSMPUP00000001960 .......................................................................-----S
Mpf_ENSMPUP00000007610 .......................................................................------
Mpf_ENSMPUP00000017612 .......................................................................------
Mpf_ENSMPUP00000007907 .......................................................................------
Mpf_ENSMPUP00000014021 .......................................................................------
Mpf_ENSMPUP00000008982 .......................................................................------
Mpf_ENSMPUP00000005803 .......................................................................------
Mpf_ENSMPUP00000002728 .......................................................................------
Mpf_ENSMPUP00000007017 .......................................................................------
Mpf_ENSMPUP00000003752 .......................................................................------
Mpf_ENSMPUP00000001306 .......................................................................------
Mpf_ENSMPUP00000005338 .......................................................................------
Mpf_ENSMPUP00000001689 .......................................................................------
Mpf_ENSMPUP00000010415 .......................................................................-----S
Mpf_ENSMPUP00000006220 .......................................................................------
Mpf_ENSMPUP00000016350 .......................................................................------
Mpf_ENSMPUP00000018773 .......................................................................------
Mpf_ENSMPUP00000017599 .......................................................................------
Mpf_ENSMPUP00000016349 .......................................................................------
Mpf_ENSMPUP00000015036 .......................................................................------
Mpf_ENSMPUP00000007938 .......................................................................------
Mpf_ENSMPUP00000007257 .......................................................................----LN
Mpf_ENSMPUP00000005203 .......................................................................------
Mpf_ENSMPUP00000000650 .......................................................................------
Mpf_ENSMPUP00000007937 .......................................................................------
Mpf_ENSMPUP00000007017 .......................................................................------
Mpf_ENSMPUP00000012780 .......................................................................------
Mpf_ENSMPUP00000002522 .......................................................................------
Mpf_ENSMPUP00000004905 .......................................................................------
Mpf_ENSMPUP00000011326 .......................................................................------
Mpf_ENSMPUP00000009449 .......................................................................------
Mpf_ENSMPUP00000000014 .......................................................................------
Mpf_ENSMPUP00000012737 .......................................................................------
Mpf_ENSMPUP00000002136 .......................................................................------
Mpf_ENSMPUP00000017782 .......................................................................------
Mpf_ENSMPUP00000013550 .......................................................................------
Mpf_ENSMPUP00000017362 .......................................................................------
Mpf_ENSMPUP00000006996 .......................................................................------
Mpf_ENSMPUP00000004785 .......................................................................------
Mpf_ENSMPUP00000014164 .......................................................................----PS
Mpf_ENSMPUP00000016592 .......................................................................-----S
Mpf_ENSMPUP00000000486 .......................................................................------
Mpf_ENSMPUP00000003712 .......................................................................------
Mpf_ENSMPUP00000006850 .......................................................................------
Mpf_ENSMPUP00000015574 .......................................................................------
Mpf_ENSMPUP00000014962 .......................................................................------
Mpf_ENSMPUP00000016814 .......................................................................------
Mpf_ENSMPUP00000000139 .......................................................................------
Mpf_ENSMPUP00000012020 .......................................................................------
Mpf_ENSMPUP00000006069 .......................................................................------
Mpf_ENSMPUP00000017142 .......................................................................----VR
Mpf_ENSMPUP00000013991 .......................................................................------
Mpf_ENSMPUP00000010353 .......................................................................------
Mpf_ENSMPUP00000000014 .......................................................................------
Mpf_ENSMPUP00000009546 .......................................................................------
Mpf_ENSMPUP00000012020 .......................................................................------
Mpf_ENSMPUP00000016751 .......................................................................------
Mpf_ENSMPUP00000000216 .......................................................................------
Mpf_ENSMPUP00000010854 .......................................................................------
Mpf_ENSMPUP00000016813 .......................................................................------
Mpf_ENSMPUP00000002870 .......................................................................------
Mpf_ENSMPUP00000003651 .......................................................................------
Mpf_ENSMPUP00000002370 .......................................................................------
Mpf_ENSMPUP00000006780 .......................................................................------
Mpf_ENSMPUP00000002802 .....................ammestfpqqkdldqvqlhleevrffdvfgfseaagawqcfmcnnpekat------
Mpf_ENSMPUP00000011336 .......................................................................------
Mpf_ENSMPUP00000003120 .......................................................................------
Mpf_ENSMPUP00000005803 .......................................................................------
Mpf_ENSMPUP00000004980 .......................................................................------
Mpf_ENSMPUP00000015621 .......................................................................------
Mpf_ENSMPUP00000003141 .......................................................................------
Mpf_ENSMPUP00000013099 .......................................................................------
Mpf_ENSMPUP00000010983 .......................................................................------
Mpf_ENSMPUP00000004910 .......................................................................------
Mpf_ENSMPUP00000016233 .......................................................................------
Mpf_ENSMPUP00000002953 .......................................................................------
Mpf_ENSMPUP00000011716 .......................................................................------
Mpf_ENSMPUP00000007767 .......................................................................------
Mpf_ENSMPUP00000014585 .......................................................................------
Mpf_ENSMPUP00000014164 .......................................................................----LA
Mpf_ENSMPUP00000005886 .......................................................................------
Mpf_ENSMPUP00000013797 .......................................................................------
Mpf_ENSMPUP00000004108 .......................................................................------
Mpf_ENSMPUP00000009167 .......................................................................------
Mpf_ENSMPUP00000016226 .......................................................................------
Mpf_ENSMPUP00000014024 .......................................................................------
Mpf_ENSMPUP00000008448 .......................................................................------
Mpf_ENSMPUP00000010607 .......................................................................------
Mpf_ENSMPUP00000015774 .......................................................................------
Mpf_ENSMPUP00000008639 .......................................................................------
Mpf_ENSMPUP00000012941 .......................................................................------
Mpf_ENSMPUP00000016218 .......................................................................------
Mpf_ENSMPUP00000007001 .......................................................................------
Mpf_ENSMPUP00000001986 .......................................................................------
Mpf_ENSMPUP00000010415 .......................................................................------
Mpf_ENSMPUP00000003836 .......................................................................------
Mpf_ENSMPUP00000007027 .......................................................................------
Mpf_ENSMPUP00000002688 .......................................................................------
Mpf_ENSMPUP00000001373 .......................................................................------
Mpf_ENSMPUP00000013700 .......................................................................------
Mpf_ENSMPUP00000016589 .......................................................................------
Mpf_ENSMPUP00000015325 .......................................................................------
Mpf_ENSMPUP00000001960 .......................................................................------
Mpf_ENSMPUP00000006310 .......................................................................------
Mpf_ENSMPUP00000016747 .......................................................................------
Mpf_ENSMPUP00000013323 .......................................................................------
Mpf_ENSMPUP00000007350 .......................................................................------
Mpf_ENSMPUP00000017588 .......................................................................------
Mpf_ENSMPUP00000007745 .......................................................................------
Mpf_ENSMPUP00000006409 .......................................................................------
Mpf_ENSMPUP00000015574 .......................................................................------
Mpf_ENSMPUP00000008365 .......................................................................------
Mpf_ENSMPUP00000001054 .......................................................................------
Mpf_ENSMPUP00000017488 .......................................................................------
Mpf_ENSMPUP00000005234 .......................................................................------
Mpf_ENSMPUP00000013182 .......................................................................------
Mpf_ENSMPUP00000011513 .......................................................................------
Mpf_ENSMPUP00000005385 .......................................................................------
Mpf_ENSMPUP00000009077 .......................................................................------
Mpf_ENSMPUP00000001767 .......................................................................------
Mpf_ENSMPUP00000007827 .......................................................................------
Mpf_ENSMPUP00000000541 .......................................................................------
Mpf_ENSMPUP00000001809 .......................................................................------
Mpf_ENSMPUP00000005803 .......................................................................------
Mpf_ENSMPUP00000013182 .......................................................................------
Mpf_ENSMPUP00000005315 .......................................................................------
Mpf_ENSMPUP00000014585 .......................................................................------
Mpf_ENSMPUP00000015166 .......................................................................------
Mpf_ENSMPUP00000002409 .......................................................................------
Mpf_ENSMPUP00000005807 .......................................................................------
Mpf_ENSMPUP00000013796 .......................................................................------
Mpf_ENSMPUP00000017782 .......................................................................------
Mpf_ENSMPUP00000019464 .......................................................................------
Mpf_ENSMPUP00000012725 .......................................................................------
Mpf_ENSMPUP00000010996 .......................................................................------
Mpf_ENSMPUP00000007938 .......................................................................------
Mpf_ENSMPUP00000009654 .......................................................................------
Mpf_ENSMPUP00000005385 .......................................................................------
Mpf_ENSMPUP00000006310 .......................................................................------
Mpf_ENSMPUP00000007963 .......................................................................------
Mpf_ENSMPUP00000002310 .......................................................................------
Mpf_ENSMPUP00000000486 .......................................................................------
Mpf_ENSMPUP00000007805 .......................................................................------
Mpf_ENSMPUP00000010246 .......................................................................------
Mpf_ENSMPUP00000004460 .......................................................................------
Mpf_ENSMPUP00000014791 .......................................................................------
Mpf_ENSMPUP00000003154 .......................................................................------
Mpf_ENSMPUP00000005214 .......................................................................------
Mpf_ENSMPUP00000003932 .......................................................................------
Mpf_ENSMPUP00000008710 .......................................................................------
Mpf_ENSMPUP00000005632 .......................................................................------
Mpf_ENSMPUP00000002828 .......................................................................------
Mpf_ENSMPUP00000017859 .......................................................................------
Mpf_ENSMPUP00000013754 .......................................................................------
Mpf_ENSMPUP00000004548 .......................................................................------
Mpf_ENSMPUP00000000646 .......................................................................------
Mpf_ENSMPUP00000004473 .......................................................................------
Mpf_ENSMPUP00000000402 .......................................................................------
Mpf_ENSMPUP00000007412 .......................................................................------
Mpf_ENSMPUP00000004935 .......................................................................------
Mpf_ENSMPUP00000011513 .......................................................................------
Mpf_ENSMPUP00000001759 .......................................................................------
Mpf_ENSMPUP00000008353 .......................................................................------
Mpf_ENSMPUP00000012083 .......................................................................------
Mpf_ENSMPUP00000006956 .......................................................................------
Mpf_ENSMPUP00000014860 .......................................................................------
Mpf_ENSMPUP00000009647 .......................................................................------
Mpf_ENSMPUP00000005803 .......................................................................------
Mpf_ENSMPUP00000005109 .......................................................................------
Mpf_ENSMPUP00000006149 .......................................................................------
Mpf_ENSMPUP00000001981 .......................................................................------
Mpf_ENSMPUP00000017916 .......................................................................------
Mpf_ENSMPUP00000003318 .......................................................................------
Mpf_ENSMPUP00000017175 .......................................................................------
Mpf_ENSMPUP00000016038 .......................................................................------
Mpf_ENSMPUP00000016192 .......................................................................------
Mpf_ENSMPUP00000015325 .......................................................................------
Mpf_ENSMPUP00000000660 .......................................................................------
Mpf_ENSMPUP00000005493 .......................................................................------
Mpf_ENSMPUP00000009754 .......................................................................------
Mpf_ENSMPUP00000013796 .......................................................................------
Mpf_ENSMPUP00000010667 .......................................................................------
Mpf_ENSMPUP00000013126 .......................................................................------
Mpf_ENSMPUP00000018046 .......................................................................------
Mpf_ENSMPUP00000006359 .......................................................................------
Mpf_ENSMPUP00000015086 .......................................................................------
Mpf_ENSMPUP00000008387 .......................................................................------
Mpf_ENSMPUP00000015207 .......................................................................------
Mpf_ENSMPUP00000004217 .......................................................................------
Mpf_ENSMPUP00000015689 .......................................................................------
Mpf_ENSMPUP00000015159 .......................................................................------
Mpf_ENSMPUP00000018833 .......................................................................------
Mpf_ENSMPUP00000007866 .......................................................................------
Mpf_ENSMPUP00000007938 .......................................................................------
Mpf_ENSMPUP00000010694 .......................................................................------
Mpf_ENSMPUP00000013131 .......................................................................------
Mpf_ENSMPUP00000000312 .......................................................................------
Mpf_ENSMPUP00000019132 .......................................................................------
Mpf_ENSMPUP00000015959 .......................................................................------
Mpf_ENSMPUP00000012612 .......................................................................------
Mpf_ENSMPUP00000007938 .......................................................................------
Mpf_ENSMPUP00000007989 .......................................................................------
Mpf_ENSMPUP00000016156 .......................................................................------
Mpf_ENSMPUP00000013721 .......................................................................------
Mpf_ENSMPUP00000005447 .......................................................................------
Mpf_ENSMPUP00000015768 .......................................................................------
Mpf_ENSMPUP00000004215 .......................................................................------
Mpf_ENSMPUP00000010108 .......................................................................------
Mpf_ENSMPUP00000002188 .......................................................................------
Mpf_ENSMPUP00000013446 .......................................................................------
Mpf_ENSMPUP00000012407 .......................................................................------
Mpf_ENSMPUP00000017043 .......................................................................------
Mpf_ENSMPUP00000007898 .......................................................................------
Mpf_ENSMPUP00000017064 .......................................................................------
Mpf_ENSMPUP00000009754 .......................................................................------
Mpf_ENSMPUP00000016461 .......................................................................------
Mpf_ENSMPUP00000008230 .......................................................................------
Mpf_ENSMPUP00000001993 .......................................................................------
Mpf_ENSMPUP00000014500 .......................................................................------
Mpf_ENSMPUP00000002405 .......................................................................------
Mpf_ENSMPUP00000002933 .......................................................................------
Mpf_ENSMPUP00000007268 .......................................................................------
Mpf_ENSMPUP00000010983 .......................................................................------
Mpf_ENSMPUP00000010498 .......................................................................------
Mpf_ENSMPUP00000018101 .......................................................................------
Mpf_ENSMPUP00000002033 .......................................................................------
Mpf_ENSMPUP00000010694 .......................................................................------
Mpf_ENSMPUP00000008353 .......................................................................------
Mpf_ENSMPUP00000009754 .......................................................................------
Mpf_ENSMPUP00000015718 .......................................................................------
Mpf_ENSMPUP00000002358 .......................................................................------
Mpf_ENSMPUP00000005077 .......................................................................------
Mpf_ENSMPUP00000009107 .......................................................................------
Mpf_ENSMPUP00000016101 .........................vaqdwclalqrlmrvkeeeihsankcrlrlllpgkpdksgrpisfm------
Mpf_ENSMPUP00000011911 .......................................................................------
Mpf_ENSMPUP00000007938 .......................................................................------
Mpf_ENSMPUP00000009676 .......................................................................------
Mpf_ENSMPUP00000005809 .......................................................................------
Mpf_ENSMPUP00000016410 .......................................................................------
Mpf_ENSMPUP00000006638 .......................................................................------
Mpf_ENSMPUP00000005803 .......................................................................------
Mpf_ENSMPUP00000010983 .......................................................................------
Mpf_ENSMPUP00000000717 .......................................................................------
Mpf_ENSMPUP00000002793 ....................................................riqlqlpgkqdksgrptff------
Mpf_ENSMPUP00000007833 .......................................................................------
Mpf_ENSMPUP00000002271 .......................................................................------
Mpf_ENSMPUP00000010974 .......................................................................------
Mpf_ENSMPUP00000010755 .......................................................................------
Mpf_ENSMPUP00000013112 .......................................................................------


                         10        20            30               40                  50            
                          |         |             |                |                   |            
d1wg7a_                GAASLGSQKGGITKHGWLYKGN....MNS...AIS...VTMR.SFK.......R.RFFHLIQ..LGD....GS..YN
Mpf_ENSMPUP00000000236 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001054 ----------------------....---...---...----.---.......-.-------..---....GS..HR
Mpf_ENSMPUP00000001986 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006133 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009494 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004093 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012215 --------------S-------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016175 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009909 ----------------------....---...---...-I--.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010977 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016638 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000018612 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000018966 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004660 -------DLPFVLKAGYLEKRR....--K...DHS...FLGF.EWQ.......K.RWCAL--..---....SK..TV
Mpf_ENSMPUP00000002149 -------------LESIFLKRS....-QQ...KKK...TSPL.NFK.......K.RLFLL--..---....TV..HK
Mpf_ENSMPUP00000018066 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017958 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011450 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016402 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004951 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011363 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015445 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015195 ------QELDNIIKQGYLEKKS....--K...DHS...FFGS.EWQ.......K.RWCVV--..---....SR..GL
Mpf_ENSMPUP00000011751 --EDILVRSSELIYSGELTRVT....---...---...QPQA.KSQ.......Q.RMFFL--..---....FD..HQ
Mpf_ENSMPUP00000009831 ---DILDRSSELIYTGEMAWIY....---...---...QPYG.RNQ.......Q.RVFFL--..---....FD..HQ
Mpf_ENSMPUP00000004111 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005349 --------------EEILIKRS....-QQ...KKK...TSPL.NYK.......E.RLFVL--..---....TK..SM
Mpf_ENSMPUP00000006137 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009095 ------------LKEGFMIKRA....-QG...RKR...FGMK.NFK.......K.RWFRL--..---....TN..HE
Mpf_ENSMPUP00000005832 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000014567 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015198 -----------ILKMGPVDKRK....---...---...--GL.FAR.......R.RQLLLT-..---....EG..PH
Mpf_ENSMPUP00000008441 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005146 ----------------------....---...---...----.---.......-.-------..---....--..LG
Mpf_ENSMPUP00000010667 ----------------------....---...---...----.---.......-.R------..---....--..--
Mpf_ENSMPUP00000000642 ---DILDRSSELIHSGELTKVT....---...---...-RHG.KSQ.......Q.RTFFL--..---....FD..HQ
Mpf_ENSMPUP00000015373 ----------------------....---...---...----.---.......-.-------..---....--..-T
Mpf_ENSMPUP00000003213 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012196 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012194 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003212 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001158 ----------------------....---...---...----.---.......-.-------..---....--..-G
Mpf_ENSMPUP00000010667 ----------------------....---...---...--W-.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013386 ----------------QLIKKS....-QQ...KRR...TSPS.NFK.......V.RFFVL--..---....TK..TS
Mpf_ENSMPUP00000016712 ----------------TLFVYR....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003302 ----------------------....---...---...----.---.......-.-WLGV--..---....DA..LG
Mpf_ENSMPUP00000003768 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008012 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002625 --------------EELLLKRS....-QQ...KKK...MSPS.NYK.......E.RLFVL--..---....TK..TN
Mpf_ENSMPUP00000010667 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006140 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015670 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008341 ----------------------....---...---...----.---.......-.------R..VDP....KG..YY
Mpf_ENSMPUP00000017573 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012859 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012131 ------------LKEGEMYKRA....-QG...RTR...IGKK.NFK.......K.RWFCL--..---....TS..RE
Mpf_ENSMPUP00000000172 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013200 ----------------------....---...---...----.---.......-.-------..---....--..-G
Mpf_ENSMPUP00000003522 -FKSLDLTARRMVHEGPLSWRI....---...---...SKDK.SLD.......L.HVLLL--..---....ED..LL
Mpf_ENSMPUP00000011499 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011494 ----------------------....---...---...----.---.......-.--VYI--..---....TN..YR
Mpf_ENSMPUP00000012716 ----------DVLKQGYMMKKG....---...---...HKRK.NWT.......E.RWFVL--..---....KP..NI
Mpf_ENSMPUP00000002913 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003504 -------LIQDVLKQGYLWKRG....---...---...HLRR.NWA.......E.RWFQL--..---....QP..SS
Mpf_ENSMPUP00000004361 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017389 ----------------------....---...---...--RD.SVK.......W.HYLCLR-..---....--..--
Mpf_ENSMPUP00000015829 -------------REGALRFMVad..DAA...AGS...GGTA.QWQ.......K.CRLLLRRa.VAG....ER..FR
Mpf_ENSMPUP00000003644 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006376 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000014536 ----------------------....---...---...----.---.......-.----I--..---....--..--
Mpf_ENSMPUP00000011501 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017670 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006727 ----------------------....---...---...----.SYF.......L.RIFDI--..---....KD..GK
Mpf_ENSMPUP00000000961 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004942 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002151 ----------------------....---...---...---L.SFK.......R.KHFLIKL..---....HA..NI
Mpf_ENSMPUP00000014680 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005563 ELRNLDLTKRKMIHEGPLVWKV....---...---...N-RD.KTI.......D.LYTLL--..---....LE..DI
Mpf_ENSMPUP00000011333 -----RNPNAPVVRRGWLYKQD....---...--S...TGMK.LWK.......K.RWFVL--..---....SD..LC
Mpf_ENSMPUP00000000969 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010395 --KDIGQCCNEFIMEGTLTRVG....---...---...----.AKH.......E.RHIFL--..---....FD..GL
Mpf_ENSMPUP00000015361 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001991 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005637 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000007307 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008193 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000007177 EFKNLDITKKKLVHEGPLTWRV....---...---...TKDK.AVE.......V.HVLLL--..---....DD..LL
Mpf_ENSMPUP00000010360 -------------------KKG....HSK...VKD...LARF.KPM.......Q.RHLFL--..---....HE..KA
Mpf_ENSMPUP00000010611 -----------AQMEGFLNRKHew..EAH...NKK...ASSR.SWH.......N.VYCVI--..---....NN..QE
Mpf_ENSMPUP00000007161 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006134 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004983 --KDIGQCCNEFIMEGPLTRIG....---...---...----.AKH.......E.RHIFL--..---....FD..GL
Mpf_ENSMPUP00000001920 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013542 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008337 ---------RQLQLEGPLCWKT....---...---...-TSG.RLK.......D.VLAVL--..---....LT..DV
Mpf_ENSMPUP00000013626 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001949 --------LGHADCQGWLYKKK....--E...KGT...FLSN.KWK.......K.FWVVL--..---....KG..TS
Mpf_ENSMPUP00000017721 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001109 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001935 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006252 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005676 ----------------------....---...---...----.---.......-.---Q---..---....--..--
Mpf_ENSMPUP00000005196 -------------REGWVVHYS....---...---...NKDT.LRK.......R.HYWRL--..---....DC..KC
Mpf_ENSMPUP00000012589 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010571 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011589 SHSMKRNLSAPVTKAGWLFKQA....---...--S...SGVK.QWN.......K.RWFVL--..---....VD..RC
Mpf_ENSMPUP00000005676 ----------------------....---...---...----.QWT.......-.-------..---....--..--
Mpf_ENSMPUP00000002533 ------------VREGYLLKRK....EEP...ASL...TTRF.AFK.......K.RYFWL--..---....SG..EA
Mpf_ENSMPUP00000004215 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013399 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010530 ----------------------....---...---...AGSE.EKN.......E.RYLLL--..---....FP..NI
Mpf_ENSMPUP00000006089 ----------------------....---...---...-TGR.RKS.......L.RRVFL--..---....FE..EL
Mpf_ENSMPUP00000016498 ----------------------....---...---...----.---.......-.--F----..---....--..--
Mpf_ENSMPUP00000007327 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001749 -------------------KKG....ATK...MKD...FARF.KPM.......Q.RHLFL--..---....YE..KA
Mpf_ENSMPUP00000016475 -----------PDREGWLLKLG....---...---...GRVK.TWK.......R.RWFIL--..---....TD..NC
Mpf_ENSMPUP00000013206 ----------PVVVRGWLHKQD....---...--S...SGMR.LWK.......R.RWFVL--..---....AD..YC
Mpf_ENSMPUP00000006140 ----------------------....---...---...----.EGK.......D.MYLIL--..---....EN..DT
Mpf_ENSMPUP00000005780 --------ERTLLHDGLVYWKT....---...---...-ATG.RFK.......D.ILALL--..---....LT..DV
Mpf_ENSMPUP00000001869 ----------------------....---...---...----.--E.......E.RYLLL--..---....FS..SV
Mpf_ENSMPUP00000012475 ------------DREGWLLKLA....---...--G...GRVK.TWK.......R.RWFIL--..---....TD..NC
Mpf_ENSMPUP00000008316 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001167 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008230 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017717 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010272 ----------------------....---...---...---R.RKH.......L.RHVFL--..---....FE..DL
Mpf_ENSMPUP00000003964 ------------DREGWLLKLE....---...--G...GRVK.TWK.......R.RWFIL--..---....TD..NC
Mpf_ENSMPUP00000017478 ---NLTDICTQLLLQGTLLKIS....---...---...--AG.NIQ.......E.RAFFL--..---....FD..NL
Mpf_ENSMPUP00000010168 ------------VKEGWMVHYS....---...---...SRDT.LRK.......R.HYWRL--..---....DS..KC
Mpf_ENSMPUP00000009546 -----VPSGPPLIKSGYCVKQG....---...---...NVRK.SWK.......R.RFFVL--..---....DD..FT
Mpf_ENSMPUP00000002870 -----PPPDSAVIKAGYCVKQG....---...---...AVMK.NWK.......R.RYFQL--..---....DE..NT
Mpf_ENSMPUP00000000151 ----------------------....---...---...----.---.......L.RHVFL--..---....FE..HL
Mpf_ENSMPUP00000000216 EEEDIVNPSNELIKEGQILKLA....---...---...ARNT.SAQ.......E.RYLFL--..---....FN..NM
Mpf_ENSMPUP00000007012 ----SLAHYGRPKIDGELKITS....---...---...VERR.SKM.......D.RYAFL--..---....LD..KA
Mpf_ENSMPUP00000012096 -------EYGRPKIDGELKVRS....---...---...IVNH.TKQ.......D.RYLFL--..---....FD..KV
Mpf_ENSMPUP00000004281 ----------------------....---...-PK...SLIR.KGR.......E.RHLFL--..---....FE..IS
Mpf_ENSMPUP00000004460 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011499 -------------LSGNLLRKF....---...---...KNSN.GWQ.......K.LWVVF--..---....TN..FC
Mpf_ENSMPUP00000003498 ----------PVHIRGWLHKQD....---...--S...SGLR.LWK.......R.RWFVL--..---....SG..HC
Mpf_ENSMPUP00000006723 -----------VQMEGYLGRKHdl..EGP...NKK...ASNR.SWN.......N.LYCVL--..---....RN..SE
Mpf_ENSMPUP00000006149 ----------------------....---...---...----.---.......-.-W-----..---....--..--
Mpf_ENSMPUP00000011052 --------------QGKLLLQDtfl.VTD...QDS...GLLP.RCK.......E.RRVFL--..---....FE..QI
Mpf_ENSMPUP00000015653 --------LGQPDCDGWLLLRK....--V...PGG...FMGP.RWR.......R.CWFVL--..---....KR..HT
Mpf_ENSMPUP00000014937 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006713 ------------TIYGELVLEG....---...-TF...RVHR.VRN.......E.RTFFL--..---....FD..KA
Mpf_ENSMPUP00000005370 -----------VLKEGWMVHYT....---...---...SKDT.LRK.......R.HYWRL--..---....DS..KC
Mpf_ENSMPUP00000017142 ALTEVAASGEGSAISGYLTRCK....---...---...KGKR.HWK.......K.LWFVI--..---....KG..KV
Mpf_ENSMPUP00000011052 ----------------------....---...--K...TLIR.KGR.......E.RHLFL--..---....FE..MS
Mpf_ENSMPUP00000000930 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016865 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000000090 ---------------------T....---...---...LDKH.TKQ.......E.RHIFL--..---....FD..LA
Mpf_ENSMPUP00000012035 -------------KEGWLHFRPlitdKGK...RVG...GSIR.PWK.......Q.MYVVL--..---....RG..HS
Mpf_ENSMPUP00000009068 ----------PVLKEGWLKRQR....---...---...SIMK.NWQ.......Q.RWFVL--..---....RG..DQ
Mpf_ENSMPUP00000000172 -------------LSGYLLRKF....---...---...KNSN.GWQ.......K.LWVVF--..---....TN..FC
Mpf_ENSMPUP00000013402 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012726 ----------------------....---...--G...GGQP.QWQ.......K.CRLLLRSegEGG....GG..SR
Mpf_ENSMPUP00000010329 -----------LVLEGTFRIQR....---...---...----.AKN.......E.RTLFL--..---....FD..KL
Mpf_ENSMPUP00000005886 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011911 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013895 ------LGPRKLLHSGKLYKTK....---...---...----.SNK.......E.LHGFL--..---....FN..DF
Mpf_ENSMPUP00000009754 GHPVGPAPITPVIKAGWLDKNP....---...--P...QGSY.IYQ.......K.RWVRL--..---....DA..DH
Mpf_ENSMPUP00000017452 --------------------KS....---...---...-ATG.RLK.......E.VQAVL--..---....LT..DI
Mpf_ENSMPUP00000004281 ----------------------....---...---...----.--K.......E.RRVFL--..---....FE..QI
Mpf_ENSMPUP00000017577 -----PPPTHTVQHEGFLLRKRe...LDA...NRK...SSNR.SWV.......S.LYCVL--..---....SK..GE
Mpf_ENSMPUP00000004977 -------LRRRLIHDGCLLWKT....---...---...-ATG.RFK.......D.VLMLL--..---....MT..DV
Mpf_ENSMPUP00000017884 ----------------------....---...---...----.---.......-.-------..---....-T..HR
Mpf_ENSMPUP00000007027 ---GPGLAGESLEKSGYLLKMG....---...---...SRVK.TWK.......R.RWFVL--..---....RQ..GQ
Mpf_ENSMPUP00000012725 --------DENRSFEGTLYKRG....---...---...ALLK.GWK.......P.RWFVLDV..---....TK..HQ
Mpf_ENSMPUP00000000871 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006220 ----------VIIKQGCLLKQG....---...---...HRRK.NWK.......V.RKFILRE..---....DP..AY
Mpf_ENSMPUP00000008418 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003932 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001861 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008418 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006249 -------PLERPIKMGWLKKQR....---...---...SIVK.NWQ.......Q.RYFVL--..---....RA..QQ
Mpf_ENSMPUP00000003836 ---------PRPTCRGYLHKRT....---...-HS...GFVK.GWR.......K.RWFVLK-..---....HD..GC
Mpf_ENSMPUP00000015858 -----------PVKEGPLFIHR....-TK...GKG...HLMS.SFK.......K.LHFSL--..---....TT..EA
Mpf_ENSMPUP00000002835 ------------LKGSQLLKVK....---...---...--SN.SWR.......ReRFYKL--..---....QE..DC
Mpf_ENSMPUP00000004473 GEEDIVNPANELIKEGPIQKLS....---...---...AKNG.TAQ.......D.RHLFL--..---....FN..SM
Mpf_ENSMPUP00000000137 ----------RGDCEGWLWKKK....--D...AKS...YFSQ.KWK.......K.YWFVL--..---....KD..AS
Mpf_ENSMPUP00000001907 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000014024 -----------LLREGPVLKIS....---...---...FRRS.DPM.......E.RYLFL--..---....FN..NM
Mpf_ENSMPUP00000001742 -----------SIKEGQLLKQT....---...---...SSFQ.RWK.......K.RYFKL--..---....RG..RT
Mpf_ENSMPUP00000000172 -IENLITPGREFIREGCLHKLT....---...---...--KK.GLQ.......Q.RMFFL--..---....FS..DM
Mpf_ENSMPUP00000005480 ------SPAETVIKEGMLTKQN....---...---...NSFQ.RSK.......R.RYFKL--..---....RG..RT
Mpf_ENSMPUP00000018515 --QPLTIPGRVLIGEGVLTKLC....---...---...--RK.KPK.......A.RQFFL--..---....FN..DI
Mpf_ENSMPUP00000009502 ------------TKEGYLTKQG....---...---...GLVK.TWK.......T.RWFTL--..---....HR..NE
Mpf_ENSMPUP00000013672 ----------------------....---...---...--FK.GTK.......K.GTVYL--..---....TP..YR
Mpf_ENSMPUP00000011336 GEEDIVSPTKELIKEGHILKLS....---...---...AKNG.TTQ.......D.RYLIL--..---....FN..DR
Mpf_ENSMPUP00000001410 ---------------------V....---...---...RSNS.RIY.......H.RYFLLDA..---....DM..QS
Mpf_ENSMPUP00000003424 ------------QMEGMLCRKQem..EAF...GKK...AANR.SWQ.......N.VYCVL--..---....RR..GS
Mpf_ENSMPUP00000007040 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000019493 ----------------------....---...---...----.QLQ.......R.VHGFL--..---....MN..DC
Mpf_ENSMPUP00000018830 SGQPLALPGRVLLGEGVLTKEC....---...---...--RK.KAK.......P.RIFFL--..---....FN..DI
Mpf_ENSMPUP00000003141 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010983 ----------EALKQGWLHKKG....-GG...SST...LSRR.NWK.......K.RWFVL--..---....RQ..SR
Mpf_ENSMPUP00000010498 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012786 ------------YKSGFLARKIhadmDGK...KTP...RGKR.GWK.......T.FYAVL--..---....KG..TV
Mpf_ENSMPUP00000014114 -------APSGVVMEGYLFKRA....---...--S...NAFK.TWN.......R.RWFSI--..---....QN..SQ
Mpf_ENSMPUP00000007256 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005608 -EDPETESGPPVERCGVLSKWT....---...---...NYIH.GWQ.......D.RWVVL--..---....KN..NT
Mpf_ENSMPUP00000002033 ---------ENRSYEGTLYKKG....---...---...AFMK.PWK.......A.RWFVLDK..---....TK..HQ
Mpf_ENSMPUP00000016751 ----------------------....---...---...----.---.......-.-------..---....TC..DC
Mpf_ENSMPUP00000016435 --------------KGTLMRKV....---...---...-RSK.SWK.......KlRYFRL--..---....QD..DG
Mpf_ENSMPUP00000001167 -----------VRKVGYLRKPK....---...---...----.SMH.......K.RFFVLRA..ASE....AGgpAR
Mpf_ENSMPUP00000001585 ------------YFEGFLLVKR....---...---...SEYQ.EYK.......H.YWTEL--..---....RG..TT
Mpf_ENSMPUP00000002351 ----------------------....---...---...FIRF.KPS.......Q.RQIYL--..---....FE..RG
Mpf_ENSMPUP00000011499 --DNLVIPGREFIRLGSLSKLS....---...---...--GK.GLQ.......Q.RMFFL--..---....FN..DV
Mpf_ENSMPUP00000005375 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015986 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004747 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009754 -------VLPTVSHSGFLYKTA....SAGkllQDR...RARE.EFS.......R.RWCVL--..---....SD..GV
Mpf_ENSMPUP00000002257 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006734 -------ETRQLLLEGSLRMKE....---...---...-GKD.GKM.......D.VYCFL--..---....FT..DL
Mpf_ENSMPUP00000003502 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011019 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003673 --------GKDCIMHGYMSKMG....---...--N...PFLT.QWQ.......R.RYFYL--..---....FP..NR
Mpf_ENSMPUP00000000383 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008997 -------------KHGVLTRKThadmDGK...RTP...RGRR.GWK.......K.FYAVL--..---....KG..TI
Mpf_ENSMPUP00000010040 --------PSGLLMEGHLFKRA....---...--S...NAFK.TWS.......R.RWFTI--..---....QS..NQ
Mpf_ENSMPUP00000007257 ALKEVSANTEDSSMSGYLYRSK....---...---...GNKK.PWK.......H.LWFVI--..---....KN..KV
Mpf_ENSMPUP00000016774 ------EPGAAVYKHGALVRKVhadpDCR...KTP...RGKR.GWK.......S.FHGIL--..---....KG..MI
Mpf_ENSMPUP00000001960 PEASIEL-MRDARICAFLWRKK....---...---...-WLG.QWA.......K.QLCVI--..---....KD..TR
Mpf_ENSMPUP00000007610 ----------------------....---...---...----.---.......-.RFYFLDE..---....HR..SC
Mpf_ENSMPUP00000017612 ----------------------....---...---...----.---.......E.RLLFL--..---....FS..RM
Mpf_ENSMPUP00000007907 ----------------------....---...---...RPNS.RIY.......N.RFFTLDT..---....-Dl.QA
Mpf_ENSMPUP00000014021 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008982 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005803 --ACFYGSSARKVKSGWLDKLS....---...--P...QGKR.MFQ.......K.RWVKF--..---....DG..LS
Mpf_ENSMPUP00000002728 ----------------------....---...---...----.---.......V.RLFYLDE..---....HR..TR
Mpf_ENSMPUP00000007017 -----VELSGTVVKQGYLAKQG....---...---...HKRK.NWK.......V.RRFVLRK..---....DP..AF
Mpf_ENSMPUP00000003752 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001306 ------LGPRKFLHSGKLYKAK....---...---...----.SNK.......E.LYGFL--..---....FN..DF
Mpf_ENSMPUP00000005338 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001689 ---SLCSQKGGVIKQGWLHKAN....VNS...TIT...VTMK.VFK.......R.RYFYLTQ..LPD....GS..YI
Mpf_ENSMPUP00000010415 EEASMDLVKDAKI-CAFLLRKK....---...---...-RFG.QWS.......K.LLCVV--..---....KD..AR
Mpf_ENSMPUP00000006220 ------------IREGYLVKRG....---...---...SMFN.TWK.......P.MWVVL--..---....LE..DG
Mpf_ENSMPUP00000016350 -----IRPGSVVSKKGYLHFKE....---...---...PLYS.NWA.......K.HFVVV--..---....RR..PY
Mpf_ENSMPUP00000018773 -----------------L----....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017599 -----------VIKEGWLHKRG....---...---...EYIK.TWR.......P.RYFLLK-..---....SD..GS
Mpf_ENSMPUP00000016349 -----IRPGSVVSKKGYLHFKE....---...---...PLYS.NWA.......K.HFVVV--..---....RR..PY
Mpf_ENSMPUP00000015036 -------------REGWLYYKQvltkKGK...KAG...GGLR.QWK.......R.VYAAL--..---....RA..RS
Mpf_ENSMPUP00000007938 -------DRPSPLLSGWLDKLS....---...--P...QGNY.VFQ.......R.RFVQF--..---....NG..RS
Mpf_ENSMPUP00000007257 GHHEIVQPGRVFLKEGTLMKLS....---...---...--RK.VMQ.......P.RVFFL--..---....FN..DA
Mpf_ENSMPUP00000005203 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000000650 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000007937 ---------KNIVKKGYLLKKG....---...---...-KGK.RWK.......N.LYFILEG..---....SD..AQ
Mpf_ENSMPUP00000007017 -----------VLKEGFLVKRG....---...---...HIVH.NWK.......A.RWFIL--..---....RQ..NT
Mpf_ENSMPUP00000012780 --------------KGWLLKWT....---...---...NYLK.GYQ.......R.RWFVL--..---....SN..GL
Mpf_ENSMPUP00000002522 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004905 ------------YYESFLQKKG....---...---...PHDQ.DYK.......K.FWAGL--..---....QG..CT
Mpf_ENSMPUP00000011326 -----GSQKGGITKHGWLYKGN....MNS...AIS...VTMR.SFK.......R.RFFHLLQ..LGD....GS..YN
Mpf_ENSMPUP00000009449 -------------KQGILARKMhhdaDGK...KTP...WGKR.GWK.......M.FHTLL--..---....RG..MV
Mpf_ENSMPUP00000000014 -------------KKGWLTKQY....---...---...-EDG.QWK.......K.HWFVL--..---....AD..QS
Mpf_ENSMPUP00000012737 -------------KKGWMSILD....---...---...-EPG.EWK.......K.HWFVL--..---....TD..SS
Mpf_ENSMPUP00000002136 -----------IVKEGWLHKRG....---...---...EYIK.TWR.......P.RYFLLK-..---....SD..GS
Mpf_ENSMPUP00000017782 -----PKLSRNYLKEGYMEKTG....---...--P...KQTE.GFR.......K.RWFTM--..---....DD..RR
Mpf_ENSMPUP00000013550 --------GRDCIMHGYMLKLG....---...--N...PFLT.QWQ.......R.RYFYL--..---....FP..NR
Mpf_ENSMPUP00000017362 --LSTITDPSVIVMADWLKIRG....---...---...-TLK.SWT.......K.LWCVL--..---....KP..GV
Mpf_ENSMPUP00000006996 --------KMASIMEGPLSKWT....---...---...NVMK.GWQ.......Y.RWFVLDY..---....NA..GL
Mpf_ENSMPUP00000004785 ------------VCRGYLVKMG....---...---...GKIK.SWK.......K.RWFVFDR..---....LK..RT
Mpf_ENSMPUP00000014164 EEASMHLVR-DCRICAFLLRKK....---...---...-RFG.QWA.......K.QLTVI--..---....KE..DQ
Mpf_ENSMPUP00000016592 SKGGGAAGGTGVFKSGWLYKGN....FNStv.NNT...VTVR.SFK.......K.RYFQLTQ..LPD....NS..YI
Mpf_ENSMPUP00000000486 --------YENIIKSGTLYRLT....---...---...-VQN.NWK.......A.FTFVL--..---....SR..TY
Mpf_ENSMPUP00000003712 --------ANGIVMEGYLFKRA....---...--S...NAFK.TWNrkkpdhiR.RWFSI--..---....QN..NQ
Mpf_ENSMPUP00000006850 -------------CRGSLVKMG....---...---...GRIK.TWK.......K.RWFCFDR..---....QA..RR
Mpf_ENSMPUP00000015574 ----------------------....---...---...----.---.......-.-RLCL--..---....GS..GV
Mpf_ENSMPUP00000014962 ----------------------....---...---...----.--H.......L.RRFNL--..---....RR..SA
Mpf_ENSMPUP00000016814 ---------RQLLLEGPVRVKE....---...---...-GRE.GKL.......D.VYLFL--..---....FS..DM
Mpf_ENSMPUP00000000139 ----------IVSKKGYLHFLE....---...---...PHTA.GWA.......K.RFVVV--..---....RR..PY
Mpf_ENSMPUP00000012020 ------------QKAGYLNLRS....---...KTG...LVTT.TWE.......R.LYFFT--..---....QG..GN
Mpf_ENSMPUP00000006069 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000017142 GQGDLLQPGREFLKEGTLMKVT....---...---...--GK.SRR.......P.RHLFL--..---....MS..DV
Mpf_ENSMPUP00000013991 -------SIKKILKEGPLLKNC....---...---...NSFK.RWK.......L.RYFLV--..---....RG..QR
Mpf_ENSMPUP00000010353 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000000014 -----------PIYGGWLLLAPdgt.DFD...NPV...HRSR.KWQ.......R.RFFILY-..---....EH..GL
Mpf_ENSMPUP00000009546 --------DRQNRICGFLDIEE....---...--H...ENSG.KFL.......R.RYFILDT..---....QA..NC
Mpf_ENSMPUP00000012020 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016751 ------------RKAGYLNARN....---...KTG...LVSS.TWD.......R.QFYFT--..---....QG..GN
Mpf_ENSMPUP00000000216 --------SGNSVVCSFLQYME....---...---...-KSK.PWQ.......K.AWCVI--..PKQ....DP..LV
Mpf_ENSMPUP00000010854 ---------GGVAKAGYLHKKG....---...GTQ...LQLL.KWP.......L.RFVII--..---....HK..RC
Mpf_ENSMPUP00000016813 --------PQNMKHSGYLWAIG....---...--K...NVWK.RWK.......K.RFFVLVQ..VSQ....YT..FA
Mpf_ENSMPUP00000002870 --------DRQNRICGFLDIEE....---...--N...ENSG.KFL.......R.RYFILDT..---....RE..DS
Mpf_ENSMPUP00000003651 -----------VEKEGYLQKAK....IAD...GGK...KLRK.NWS.......T.SWIVL--..---....SS..RK
Mpf_ENSMPUP00000002370 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000006780 ----------HMKHSGYLYALG....---...--Q...KVWK.RWK.......K.RYFVLVQ..VSQ....YT..FA
Mpf_ENSMPUP00000002802 ----VVNQDGQPLIEGKLKEKQ....---...VRW...KFIK.RWK.......T.RYFTL--..---....AG..NQ
Mpf_ENSMPUP00000011336 -------------ICSFLHYME....---...---...KGGK.GWH.......K.AWFVV--..PEN....EP..LV
Mpf_ENSMPUP00000003120 -------------MEGVLYKWT....---...---...NYLT.GWQ.......P.RWFVL--..---....DN..GI
Mpf_ENSMPUP00000005803 ----------------------....---...---...----.---.......K.KWCVL--..---....EG..GF
Mpf_ENSMPUP00000004980 -------------MEGVLYKWT....---...---...NYLS.GWQ.......P.RWFLL--..---....CG..GI
Mpf_ENSMPUP00000015621 -----------VVKEGWVQKRG....---...---...EYIK.NWR.......P.RYFLLK-..---....TD..GS
Mpf_ENSMPUP00000003141 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013099 -----------TERNGNLYKKS....---...--D...GIRK.VWQ.......K.RKCSV--..---....KN..GF
Mpf_ENSMPUP00000010983 ----------EFIVRGWLHKEV....-KN...SPK...MSSL.KLK.......K.RWFVL--..---....TH..NS
Mpf_ENSMPUP00000004910 ---------SVVIMADSLKIRG....---...---...-TLK.SWT.......K.LWCVL--..---....KP..GV
Mpf_ENSMPUP00000016233 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002953 ----------------------....---...---...----.EVH.......K.RWWQL--..---....--..--
Mpf_ENSMPUP00000011716 ------------VKSGWLLRQS....---...---...TILK.RWK.......K.NWFDLW-..---....SD..GH
Mpf_ENSMPUP00000007767 -----------VEERGFLTIFE....---...-DV...SGFG.AWH.......R.RWCVL--..---....SG..NC
Mpf_ENSMPUP00000014585 ---------RKYLKQGFMEKTG....---...--P...KQKE.PFK.......K.RWFVLDP..---....QE..RR
Mpf_ENSMPUP00000014164 DDPQMPCSEEEVPCCGYLNVLV....---...---...--NQ.GWK.......E.RWCRL--..---....KC..NT
Mpf_ENSMPUP00000005886 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013797 ----------------------....---...---...----.---.......D.CYLEL--..---....FH..SY
Mpf_ENSMPUP00000004108 ---------------GYLMKYT....---...---...NLVT.GWQ.......Y.RFFVLNN..---....EA..GL
Mpf_ENSMPUP00000009167 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016226 ---------GVITKEGMLHYKA....--G...TSY...LGKE.HWK.......T.CFVVL--..---....SN..GI
Mpf_ENSMPUP00000014024 ------------IMCGFLQLVG....---...--D...KWGK.SGP.......R.GWCVI--..PRD....DP..LV
Mpf_ENSMPUP00000008448 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010607 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015774 ------------EKVGFLYKKS....---...--D...GIRR.VWQ.......K.RKCGV--..---....KY..GC
Mpf_ENSMPUP00000008639 ----------------------....---...---...IRSR.TWH.......KeRLYRL--..---....QE..DG
Mpf_ENSMPUP00000012941 -------------KYGLLNVTK....ITE...NGK...KVRK.NWL.......S.SWAVL--..---....QG..SS
Mpf_ENSMPUP00000016218 ----------------------....---...---...-KNK.SGH.......K.LYIFL--..---....FQ..DI
Mpf_ENSMPUP00000007001 --------SRWLVKSGELTALE....FSL...SPG...LRRKlNTR.......P.VHLHL--..---....FN..DC
Mpf_ENSMPUP00000001986 ------------RKAGWLFFKPlvtlQ-K...EKKlelVARR.KWK.......Q.YWVTL--..---....KG..CT
Mpf_ENSMPUP00000010415 --------------CGYLNVLS....---...---...--NS.RWR.......E.RWCRV--..---....KD..NR
Mpf_ENSMPUP00000003836 ----------NPECLGLLHQSD....---...---...GSTD.RWV.......Q.HYCIL--..---....KD..GC
Mpf_ENSMPUP00000007027 -------GGSKPTVKGWLTKVK....---...---...--HG.HSK.......L.VWCAL--..---....VG..RT
Mpf_ENSMPUP00000002688 ------SSSRWLVKRGELTAYV....EDT...VLF...SRRT.SKQ.......Q.VYFFL--..---....FN..DV
Mpf_ENSMPUP00000001373 -----------SEKKGYLLKKS....---...--D...GLRK.VWQ.......R.RKCAV--..---....KN..GI
Mpf_ENSMPUP00000013700 ----------QLVKDGFLVEVS....---...---...--ES.SRK.......L.RHVFL--..---....FT..DV
Mpf_ENSMPUP00000016589 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015325 ------------TRKGYLSKRS....---...---...SDNT.KWQ.......T.KWFAL--..---....LQ..NL
Mpf_ENSMPUP00000001960 ------------------NVLV....---...---...--NS.QWK.......S.RWCSV--..---....RD..SH
Mpf_ENSMPUP00000006310 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000016747 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013323 -----SYTQEPAIQKGFLLKKR....---...--K...WPLK.GWH.......K.RFFYL--..---....DK..GI
Mpf_ENSMPUP00000007350 -------ISTKVQLYGVLWKRP....---...-FG...RPSA.KWS.......R.RFFII--..---....KE..SF
Mpf_ENSMPUP00000017588 ----------------------....---...---...----.---.......-.----L--..---....ET..RQ
Mpf_ENSMPUP00000007745 -------------VEGTCFRKL....---...--N...CRRR.QDK.......F.WYCRLSP..---....NH..KV
Mpf_ENSMPUP00000006409 -------------LCGYLSKFG....---...-GK...GPIR.GWK.......S.RWFFYDE..---....KK..CH
Mpf_ENSMPUP00000015574 -----------VRLCGHLRKQK....---...---...----.SQR.......R.RFFVLRA..---....DP..PR
Mpf_ENSMPUP00000008365 -------------KAGVLHRTKt...VDK...GKR...LRKK.HWS.......A.SWTVL--..---....EG..GV
Mpf_ENSMPUP00000001054 ----------------------....---...---...---R.KWK.......H.YWVSL--..---....KG..CT
Mpf_ENSMPUP00000017488 ----------------------....---...---...NRRR.QER.......F.WYCRLAL..---....NH..KV
Mpf_ENSMPUP00000005234 -------HSRWLLKQGELQQMSgp..KTS...RTL...RTKK.LFR.......E.IYLFL--..---....FN..DL
Mpf_ENSMPUP00000013182 ----------------------....---...--K...LTLK.GYR.......Q.HWVVF--..---....KE..TT
Mpf_ENSMPUP00000011513 ---------EPLEKSGYLLKMS....---...---...GRVK.TWK.......R.RWFVL--..---....KG..GE
Mpf_ENSMPUP00000005385 ----------------------....---...---...---K.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009077 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000001767 ----------------------....---...---...----.---.......-.----L--..---....TG..HH
Mpf_ENSMPUP00000007827 ------------TMEGYLYVQE....---...-KR...HFGT.SWV.......K.HYCTYQR..---....DS..KQ
Mpf_ENSMPUP00000000541 -------------KAGWIKKSS....---...--G...GLLG.FWK.......D.RYLLL--..---....CQ..AQ
Mpf_ENSMPUP00000001809 -----------VEKSGLLNVTK....IAQ...GGR...KLRK.NWS.......S.SWVVL--..---....AG..NS
Mpf_ENSMPUP00000005803 -----------SIKEGMLKIKE....-EP...SKI...LSGN.KFQ.......D.RYFVL--..---....RD..GY
Mpf_ENSMPUP00000013182 ----------------------....---...---...-W--.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005315 -------PSAPPEKVGWVRKFC....---...GKG...IFRE.IWK.......N.RYVVL--..---....KG..DQ
Mpf_ENSMPUP00000014585 -------------REGFLWKRG....---...---...RDNA.QFL.......R.RKFVLLA..---....KE..GL
Mpf_ENSMPUP00000015166 -------------KEGHLLKKR....---...--K...WPLK.GWH.......K.RYFVL--..---....ED..GI
Mpf_ENSMPUP00000002409 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005807 -----------VIRRGWLTINN....---...-IS...LMKG.GSK.......E.YWFVL--..---....TA..ES
Mpf_ENSMPUP00000013796 ----------------------....---...---...--SQ.EQQ.......D.RLLVL--..---....YP..SS
Mpf_ENSMPUP00000017782 ------EPYSAGYREGFLWKRG....---...---...RDNG.QFL.......S.RKFVLTE..---....RE..GS
Mpf_ENSMPUP00000019464 ---------SPADHTGFLRTWG....GPG...TAP...TPSG.TGR.......R.CWFVL--..---....KG..NL
Mpf_ENSMPUP00000012725 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010996 ---------------GFLNQQQ....---...-ME...ENLI.SWR.......R.LYCVL--..---....RG..GK
Mpf_ENSMPUP00000007938 -------------RVGLLRCRE....--E...PPR...LLGN.RFQ.......E.RFFLL--..---....RG..HC
Mpf_ENSMPUP00000009654 -------------RGGWLWRQS....---...---...SILR.RWK.......R.NWFALW-..---....LD..GT
Mpf_ENSMPUP00000005385 ----------------------....---...-KK...LTLK.GYK.......Q.YWCTF--..---....KD..TS
Mpf_ENSMPUP00000006310 ----------------------....---...-KK...LILK.AFK.......Q.YWFIF--..---....KD..TS
Mpf_ENSMPUP00000007963 ----------------------....---...---...----.---.......-.-------..---....--..DV
Mpf_ENSMPUP00000002310 -----------PIKQGMLLKRS....---...-GK...SLNK.EWK.......K.KYVTLC-..---....DN..GV
Mpf_ENSMPUP00000000486 --------FPNILKKGYLEIRK....---...---...DHDS.YWQ.......S.CYAEL--..---....SP..YN
Mpf_ENSMPUP00000007805 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010246 ----------------------....---...---...----.---.......-.--VCI--..---....TD..TN
Mpf_ENSMPUP00000004460 -----------IVKQGYVKMKS....---...---...RKLG.IYR.......R.CWLVFRK..SSS....KGp.QR
Mpf_ENSMPUP00000014791 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000003154 -------------HEGFMLKKR....---...--K...WPLK.GWH.......K.RFFVL--..---....DN..GM
Mpf_ENSMPUP00000005214 -------SGRWFLRQGWLLVVP....---...---...-PHG.EPR.......P.RMFFL--..---....FS..DV
Mpf_ENSMPUP00000003932 -----------VCKRGYLRKQK....---...---...----.HGH.......R.RYFVLKLe.TAD....AP..AR
Mpf_ENSMPUP00000008710 -------GRAIPIKQGVLLKRS....---...-GK...SLNK.EWK.......K.KYVTL--..---....CD..NG
Mpf_ENSMPUP00000005632 ------------LCEGTLFRKI....---...-SS...RRRQ.LTD.......KlWFCCLSP..---....NH..KV
Mpf_ENSMPUP00000002828 ----------------------....---...---...----.-RK.......L.RHVFL--..---....FT..DL
Mpf_ENSMPUP00000017859 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013754 ---------TVPTMEGPLRRKTl...LKE...GRR...PALS.SWT.......R.YWVIL--..---....SG..ST
Mpf_ENSMPUP00000004548 ---------GQPTIEGYLYTQE....---...-KW...ALGI.SWV.......K.YYCQYEK..---....ET..KM
Mpf_ENSMPUP00000000646 ----------------------....---...---...----.---.......-.---YL--..---....TA..TH
Mpf_ENSMPUP00000004473 ----------------------....---...---...--GV.VWS.......E.VWATIPA..SEP....LE..LV
Mpf_ENSMPUP00000000402 ------------EIEGVLWLKD....---...---...DGKK.SWK.......K.RYFLL--..---....RA..SG
Mpf_ENSMPUP00000007412 ----------WLLKRGELFVVE....-ET...RLF...RKLA.SRP.......T.CYLFL--..---....FN..DV
Mpf_ENSMPUP00000004935 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011513 ----------------------....---...---...---G.YSK.......R.VWCTL--..---....IG..KT
Mpf_ENSMPUP00000001759 ---------SQWTMEGYLYVQE....---...-KR...PLGF.TWI.......K.HYCTYDK..---....GS..KT
Mpf_ENSMPUP00000008353 ------NPFRGLMKLGTVERRG....---...---...-AMG.IWK.......E.LFCEL--..---....SP..LE
Mpf_ENSMPUP00000012083 ------------ELEGALYLKE....---...---...DGKK.SWK.......R.RYFLL--..---....RA..SG
Mpf_ENSMPUP00000006956 -----------FTAEGYLYVQE....--K...RPA...PFGS.SWV.......K.HYCMYRK..AA-....KK..FN
Mpf_ENSMPUP00000014860 ------------EIQGFLQLRG....---...---...SGRK.LWK.......R.FFCFL--..---....RR..SG
Mpf_ENSMPUP00000009647 ----------------------....---...---...PQRL.GLH.......Q.REVFL--..---....FN..DL
Mpf_ENSMPUP00000005803 ----------TPEKCGYLELRG....---...---...----.YKA.......K.IFTVL--..---....SG..SS
Mpf_ENSMPUP00000005109 ------------TIQGVLRRKTl...LKE...GKK...PTVA.SWT.......K.YWAAL--..---....CG..TQ
Mpf_ENSMPUP00000006149 ----------------------....---...---...-STK.IYQ.......R.CWLVFKK..ASS....KGp.KR
Mpf_ENSMPUP00000001981 -----------PIKQSFLLKRS....---...-GN...SLNK.EWK.......K.KYVTLS-..---....SN..GF
Mpf_ENSMPUP00000017916 ----------------------....---...---...---Q.AAH.......Q.REVFL--..---....FN..DL
Mpf_ENSMPUP00000003318 ----------------------....---...---...--GL.QRQ.......E.RHLFL--..---....FN..DL
Mpf_ENSMPUP00000017175 ----------------------....---...---...----.GLH.......Q.REIFL--..---....FN..DL
Mpf_ENSMPUP00000016038 ----------------------....---...---...----.---.......-.-------..---....-P..DV
Mpf_ENSMPUP00000016192 ----------------------....---...---...----.SSK.......A.VYLHL--..---....FN..DC
Mpf_ENSMPUP00000015325 ----------------------....---...---...--LK.KEG.......E.RQCFL--..---....FS..KH
Mpf_ENSMPUP00000000660 ----------YPEIHGFLHAKE....---...---...QGKK.SWK.......K.IYFLL--..---....RR..SG
Mpf_ENSMPUP00000005493 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009754 ----------------------....---...GLG...LPSG.GFH.......D.RYFIL--..---....NS..SC
Mpf_ENSMPUP00000013796 ----------------------....---...---...----.---.......D.CYLEL--..---....FH..SY
Mpf_ENSMPUP00000010667 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013126 -----------VIRKGWLTINN....---...-IG...IMKG.GSK.......E.YWFVL--..---....TA..EN
Mpf_ENSMPUP00000018046 ------NSSSCPEIQGFLHVKE....---...---...LGRK.SWR.......K.LYVCL--..---....RR..SG
Mpf_ENSMPUP00000006359 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015086 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000008387 ----------------------....---...---...--LK.KEG.......E.RQCFLF-..---....TK..HF
Mpf_ENSMPUP00000015207 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000004217 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015689 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000015159 ----------------------....---...---...----.---.......-.-------..---....TG..HH
Mpf_ENSMPUP00000018833 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000007866 --------------SGTLRVQQ....---...--A...GELQ.DWA.......R.VHGVL--..---....KG..TS
Mpf_ENSMPUP00000007938 ---------PRPLRTGMLELRG....---...---...----.HKA.......K.VFAAL--..---....SP..GE
Mpf_ENSMPUP00000010694 ----------------------....---...---...--GL.RWE.......K.RWCDL--..---....--..--
Mpf_ENSMPUP00000013131 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000000312 ----------------------....---...---...----.---.......-.NWFIL--..---....FN..DA
Mpf_ENSMPUP00000019132 -----------VLKEGVLEKRS....---...--G...GLLQ.LWK.......R.KRCVL--..---....TE..RG
Mpf_ENSMPUP00000015959 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000012612 -----------PDREGWLLKLG....---...---...-WGR.KWD.......R.MWL----..---....RG..AS
Mpf_ENSMPUP00000007938 -----PATYSSFLYCGPISNKA....GPP...PPR...RGRD.APP.......R.LWCVL--..---....-R..AA
Mpf_ENSMPUP00000007989 ----------------------....---...---...----.---.......-.LCLLL--..---....FS..DL
Mpf_ENSMPUP00000016156 ----------------------....---...---...----.---.......-.-------..---....KK..CK
Mpf_ENSMPUP00000013721 -----------IIFSGNLFQYQ....---...---...EDNK.KWR.......N.RFSLVP-..---....HN..YG
Mpf_ENSMPUP00000005447 -----------SRIEGWLSIPN....---...RGN...IKRY.GWK.......K.QYVVV--..---....SS..KK
Mpf_ENSMPUP00000015768 -------------HRGPLTQLG....---...---...GHPP.RWQ.......P.IFCVL--..---....RGd.GR
Mpf_ENSMPUP00000004215 ------------VKQGFLYLLQ....---...-QQ...TFGK.KWR.......R.FGAVLYG..ESD....CAl.AR
Mpf_ENSMPUP00000010108 ---------PDVVVKGWLYGEP....RGG...GAR...-PWL.PPR.......R.AWFVL--..---....TR..DS
Mpf_ENSMPUP00000002188 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000013446 ------------RLEGWLSLPV....---...RNN...TKKF.GWV.......K.KYVIV--..---....SS..KK
Mpf_ENSMPUP00000012407 ----------GTAYEGFLSVPR....---...-PS...GVRR.GWQ.......R.VFAAL--..---....SD..SR
Mpf_ENSMPUP00000017043 ----------------------....---...--G...RACY.RWS.......K.RWLIV--..---....KD..SF
Mpf_ENSMPUP00000007898 ----------------------....---...---...----.---.......-.-------..---....YS..DL
Mpf_ENSMPUP00000017064 ----------------------....---...---...----.---.......-.----L--..---....FN..DC
Mpf_ENSMPUP00000009754 ---------------GSLELRG....---...---...----.FKN.......K.LYVAV--..---....VG..DK
Mpf_ENSMPUP00000016461 ----------VWVKTGALQWWC....---...--D...WKPH.KWV.......D.VCVALEQ..FTGldgaRD..SI
Mpf_ENSMPUP00000008230 ------------VMEGPLFLQS....---...-QR...FGTK.RWR.......K.TWAVLYP..ASP....HGv.AR
Mpf_ENSMPUP00000001993 -------------KQDYFIKSP....-PP...QLF...FSAS.SWK.......R.RYFILSK..SGE....RS..LR
Mpf_ENSMPUP00000014500 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002405 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002933 -----KEPSSGLHLEGWMKVPR....---...NNK...RGQQ.GWD.......R.KYIVL--..---....EG..SK
Mpf_ENSMPUP00000007268 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010983 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010498 ------------------KLRD....---...---...--GK.KWK.......T.RWLVLRK..PSP....VA..DC
Mpf_ENSMPUP00000018101 --------------EGRVWIPK....---...-KA...GARK.GWQ.......R.ALAVV--..---....CD..FK
Mpf_ENSMPUP00000002033 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010694 --------NQQIVYMGWCEARE....---...QDP...LQDR.VYS.......P.TFLAL--..---....RG..SC
Mpf_ENSMPUP00000008353 ------------IKESLLYLYT....---...---...--DR.TWM.......P.YIFSL--..---....SL..ES
Mpf_ENSMPUP00000009754 ----------------------....---...--G...LSLQ.RAQ.......E.GWFSL--..---....TG..SE
Mpf_ENSMPUP00000015718 -------------YEGHVRIPK....---...-PA...GVKK.GWQ.......R.ALAVV--..---....CD..FK
Mpf_ENSMPUP00000002358 --------------KGYVKVPK....---...-PT...GVKK.GWQ.......R.AYAVV--..---....CD..CK
Mpf_ENSMPUP00000005077 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000009107 -----------PTMEGFLEFQQql..WSA...QRQ...PCLS.LWD.......G.CHGTL--..---....RG..SS
Mpf_ENSMPUP00000016101 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000011911 ---------ETPVKDGILYQQH....---...-IK...FGKK.SWR.......K.VWGLLYA..GSP....SGv.AR
Mpf_ENSMPUP00000007938 ---------------GRLWLRS....-PT...HSA...LAPG.LWL.......S.GFGLL--..---....RG..DL
Mpf_ENSMPUP00000009676 ----------------------....---...---...----.---.......-.--GSL--..---....RR..SS
Mpf_ENSMPUP00000005809 -------------YEGPLWKSS....---...---...-RFF.GWR.......L.FWVVL--..---....EH..GV
Mpf_ENSMPUP00000016410 ----------------------....---...---...--VN.RWT.......R.RQVIL--..---....CG..TC
Mpf_ENSMPUP00000006638 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000005803 ---------------GQLYYKD....---...--C...HALD.QWR.......K.GWFSM--..---....EK..SS
Mpf_ENSMPUP00000010983 -------------FHSFLYMKG....---...---...GLMN.SWK.......R.RWCVL--..---....KD..ET
Mpf_ENSMPUP00000000717 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000002793 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000007833 --------------SGIYNVRK....---...-GK...TQLH.KWA.......E.RLVVL--..---....CG..TC
Mpf_ENSMPUP00000002271 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010974 ----------------------....---...---...----.---.......-.-------..---....--..--
Mpf_ENSMPUP00000010755 ----------------------....---...--D...QVCY.RWS.......K.RWLVV--..---....KD..SF
Mpf_ENSMPUP00000013112 ----------------------....---...---...----.---.......-.-------..---....--..--


                         60                                                  70                     
                          |                                                   |                     
d1wg7a_                LNFYKDEKI..................SKE........................PKG.SIFLD............SC
Mpf_ENSMPUP00000000236 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000001054 LSIYEDWD-..................PFR........................FRH.MIPTE............AL
Mpf_ENSMPUP00000001986 ---------..................PFK........................FRW.LIPIS............AL
Mpf_ENSMPUP00000006133 ---------..................---........................---.----S............--
Mpf_ENSMPUP00000009494 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000004093 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000012215 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000016175 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000009909 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010977 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000016638 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000018612 ---------..................---........................---.----K............--
Mpf_ENSMPUP00000018966 ---------..................---........................---.----K............--
Mpf_ENSMPUP00000004660 FYYYGSDK-..................DKQ........................QKG.EFSID............GY
Mpf_ENSMPUP00000002149 LSYYEYDFErgr...............RGS........................KKG.SIDVE............KI
Mpf_ENSMPUP00000018066 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000017958 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011450 ---------..................---........................--E.NFPLS............TI
Mpf_ENSMPUP00000016402 -------R-..................KLF........................FRR.HYPLN............TV
Mpf_ENSMPUP00000004951 VSYFYDST-..................-RN........................VYR.IISLD............GS
Mpf_ENSMPUP00000011363 ---------..................N--........................---.-----............--
Mpf_ENSMPUP00000015445 --YFYDVT-..................-RN........................SYR.IISVD............GA
Mpf_ENSMPUP00000015195 FYYYANEK-..................SKQ........................PKG.TFLIK............GY
Mpf_ENSMPUP00000011751 LIYCKKDLLrrd...............VLY........................YKG.RVDMD............GQ
Mpf_ENSMPUP00000009831 MVLCKKDLIrrd...............ILY........................YKG.RIDMD............KY
Mpf_ENSMPUP00000004111 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005349 LTYYEGRPE..................KKY........................RKG.FIDVA............KI
Mpf_ENSMPUP00000006137 ---------..................KLF........................FRR.HYPVN............SI
Mpf_ENSMPUP00000009095 FTYQRSKG-..................-DQ........................PLC.SIPIE............NI
Mpf_ENSMPUP00000005832 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000014567 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015198 L-YYVDPV-..................NKV........................LKG.EIPWS............QE
Mpf_ENSMPUP00000008441 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005146 LNIYEKDD-..................KLT........................PKI.GFPWS............EI
Mpf_ENSMPUP00000010667 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000000642 LVSCKKDLLrrd...............VLY........................YRG.RTDMD............DV
Mpf_ENSMPUP00000015373 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000003213 ---------..................---........................---.--E--............--
Mpf_ENSMPUP00000012196 ---------..................---........................---.-ISIY............GV
Mpf_ENSMPUP00000012194 ---------..................---........................---.----S............--
Mpf_ENSMPUP00000003212 ---------..................---........................---.--E--............--
Mpf_ENSMPUP00000001158 LNIYEQND-..................RLT........................PKI.GFPWS............EI
Mpf_ENSMPUP00000010667 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013386 LAYFENRQGk.................KRT........................LKG.SIELS............RI
Mpf_ENSMPUP00000016712 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000003302 LNIYEHDD-..................KLT........................PKI.GFPWS............EI
Mpf_ENSMPUP00000003768 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008012 ---------..................---........................---.---L-............--
Mpf_ENSMPUP00000002625 LSYYEYDKMk.................RGS........................RKG.SIEIK............KI
Mpf_ENSMPUP00000010667 ---------..................---........................L--.-----............--
Mpf_ENSMPUP00000006140 ---------..................--W........................PSV.NMNVA............DA
Mpf_ENSMPUP00000015670 ---------..................K--........................---.-----............--
Mpf_ENSMPUP00000008341 LYWTYQSK-..................EME........................FLD.ITNIR............DT
Mpf_ENSMPUP00000017573 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000012859 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000012131 LTYHKQPG-..................SKD........................AIY.TIPVK............NI
Mpf_ENSMPUP00000000172 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013200 LHIYDPEN-..................RLT........................PKI.SFPWN............EI
Mpf_ENSMPUP00000003522 VLLQRQDEKlllkchsktaagssds..KQT........................FSP.VLKLN............AV
Mpf_ENSMPUP00000011499 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011494 LYLRSLET-..................DSA........................LIL.DVPLG............VI
Mpf_ENSMPUP00000012716 ISYYVSED-..................LKD........................KKG.DILLDe...........NC
Mpf_ENSMPUP00000002913 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000003504 LCYFGSEE-..................CKE........................KRG.TIPLDa...........QC
Mpf_ENSMPUP00000004361 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000017389 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015829 LEFFVPPK-..................ASR........................PKV.SIPLSaii.........EV
Mpf_ENSMPUP00000003644 ----D----..................---........................---.-----............--
Mpf_ENSMPUP00000006376 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000014536 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011501 --YFKNVER..................DPN........................FVL.DVPLG............VI
Mpf_ENSMPUP00000017670 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000006727 LLW------..................---........................---.-----............--
Mpf_ENSMPUP00000000961 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000004942 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000002151 LVLCKDT--..................---........................---.-----............--
Mpf_ENSMPUP00000014680 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005563 LVLLQKQDDrlvlrchskilastads.KHT........................FSP.VIKLN............TV
Mpf_ENSMPUP00000011333 LFYYRDEK-..................EEG........................ILG.SILLP............SF
Mpf_ENSMPUP00000000969 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010395 MICCKSNHGqprlpgasna........EYR........................LKE.KFFMR............KV
Mpf_ENSMPUP00000015361 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000001991 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005637 ---------..................---........................CVL.EISVR............GV
Mpf_ENSMPUP00000007307 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008193 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000007177 LLLQRQDERlllkshsrtltptpdg..KTM........................LRP.VLRLT............SA
Mpf_ENSMPUP00000010360 VLFCKRREEsgegyekap.........SYS........................YKQ.SLNMA............AV
Mpf_ENSMPUP00000010611 MGFYKDAKTaasgi.............PYH........................SEV.PVSLK............EA
Mpf_ENSMPUP00000007161 ------QN-..................NTK........................DRK.VIPLK............MC
Mpf_ENSMPUP00000006134 ---------..................---........................---.----L............--
Mpf_ENSMPUP00000004983 MISCKPNHSqsrlpgyssa........EYR........................LKE.KFVMR............KI
Mpf_ENSMPUP00000001920 ---------..................---........................---.--DFN............QV
Mpf_ENSMPUP00000013542 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008337 LLLLQEKDQkyvfas............VDS........................KHP.VISLQ............KL
Mpf_ENSMPUP00000013626 ---------..................---........................---.---I-............--
Mpf_ENSMPUP00000001949 LYWYSNQM-..................AEK........................ADG.FVNLP............DF
Mpf_ENSMPUP00000017721 ---------..................---........................---.SLKMA............YV
Mpf_ENSMPUP00000001109 ---------..................---........................-RK.NIPLK............MC
Mpf_ENSMPUP00000001935 ---------..................---........................--L.EISLR............GV
Mpf_ENSMPUP00000006252 ---------..................---........................---.-----............Q-
Mpf_ENSMPUP00000005676 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005196 ITLFQNNT-..................TNR........................YYK.EIPLS............EI
Mpf_ENSMPUP00000012589 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010571 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011589 LFYYKDEK-..................EES........................ILG.SIPLL............SF
Mpf_ENSMPUP00000005676 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000002533 LSYSKSPE-..................-WQ........................MRS.SIPVS............HI
Mpf_ENSMPUP00000004215 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013399 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010530 LLMLSASPRms................GFI........................YQG.KLPTT............GM
Mpf_ENSMPUP00000006089 LLFSKPRRGptgtd.............TFA........................YKR.SFKMA............DL
Mpf_ENSMPUP00000016498 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000007327 ---------..................---........................H--.-----............--
Mpf_ENSMPUP00000001749 IVFCKRRVEsgegsdryp.........SYS........................FKH.CLKMD............EV
Mpf_ENSMPUP00000016475 LYYFEYTT-..................DKE........................PRG.IIPLE............NL
Mpf_ENSMPUP00000013206 LFYYKDSR-..................EEA........................VLG.SIPLP............SY
Mpf_ENSMPUP00000006140 LSLVDPMD-..................-RS........................VLH.SQPIA............SI
Mpf_ENSMPUP00000005780 LLFLQEKDQkyifaav...........DQK........................PS-.VISLQ............KL
Mpf_ENSMPUP00000001869 LIMLSASPRms................GFI........................YQG.KIPVA............GM
Mpf_ENSMPUP00000012475 LYYFEYTT-..................DKE........................PRG.IIPLE............NL
Mpf_ENSMPUP00000008316 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000001167 ---------..................---........................---.-----............-M
Mpf_ENSMPUP00000008230 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000017717 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010272 ILFSKTRKVeggyd.............TYT........................YKQ.SFKTA............EI
Mpf_ENSMPUP00000003964 LYYFEYTT-..................DKE........................PRG.IIPLE............NL
Mpf_ENSMPUP00000017478 LVYCKRKSRvtgs..............KKS........................TKR.TKSINgslyifrgri..NT
Mpf_ENSMPUP00000010168 LTLFQNES-..................GSK........................YYK.EIPLS............EI
Mpf_ENSMPUP00000009546 ISYFKCEQ-..................DRE........................PLR.TIFLKdvlkth......EC
Mpf_ENSMPUP00000002870 IGYFKSEL-..................EKE........................PLR.VIPLK............EV
Mpf_ENSMPUP00000000151 LLFSKLKGPegg...............SET........................FVY.KQAFK............TA
Mpf_ENSMPUP00000000216 LLYCVPRFSlvgs..............KFT........................VRT.RVGID............GM
Mpf_ENSMPUP00000007012 LLICKRRGD..................SYD........................LKD.FVNLH............SF
Mpf_ENSMPUP00000012096 VIVCKRRGY..................SYE........................LKE.VIELL............FH
Mpf_ENSMPUP00000004281 LVFSKEIKDssg...............HTK........................YVY.KNKLL............TS
Mpf_ENSMPUP00000004460 -----I---..................---........................---.-----............--
Mpf_ENSMPUP00000011499 LFFYKSHQ-..................DNH........................PLA.SLPLL............GY
Mpf_ENSMPUP00000003498 LFYYKDSR-..................EES........................VLG.SVLLP............SY
Mpf_ENSMPUP00000006723 LTFYKDAKNlal...............GVP........................YHG.EEPLAlr..........HA
Mpf_ENSMPUP00000006149 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011052 VIFSEPLDKkkgfsmp...........GFL........................FKN.SIKVS............CL
Mpf_ENSMPUP00000015653 LYWYRQPQ-..................DEK........................AEG.LINVS............NY
Mpf_ENSMPUP00000014937 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000006713 LLITKKRGD..................HFV........................YKG.HIPCS............SL
Mpf_ENSMPUP00000005370 ITLFQNDT-..................GSR........................YYK.EIPLS............EI
Mpf_ENSMPUP00000017142 LYTYMASE-..................DTV........................AME.SMPLL............GF
Mpf_ENSMPUP00000011052 LVFSKEVKDssg...............RSK........................YLY.KSKLF............TS
Mpf_ENSMPUP00000000930 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000016865 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000000090 VIVCKRKGD..................NYE........................MKE.IIDLQ............QY
Mpf_ENSMPUP00000012035 LYLYKDKREqtt...............PSE........................EEQ.PISVN............AC
Mpf_ENSMPUP00000009068 LFYYKDKD-..................ETK........................PQG.FISLQ............GT
Mpf_ENSMPUP00000000172 LFFYKTHQ-..................DDY........................PLA.SLPLL............GY
Mpf_ENSMPUP00000013402 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000012726 LEFFVPPK-..................ASR........................PRL.SIPCS............TI
Mpf_ENSMPUP00000010329 LLITKKRDD..................TFT........................YKA.HILCG............NL
Mpf_ENSMPUP00000005886 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011911 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013895 LLLTYMVKQfavssgseklfssksnaqFKM........................YKT.PIFLN............EV
Mpf_ENSMPUP00000009754 LRYFDSNK-..................DAY........................SKR.FISVA............CI
Mpf_ENSMPUP00000017452 LVFLQEKDQkyvfas............LDQ........................KST.VISLK............KL
Mpf_ENSMPUP00000004281 VIFSELLRKgsltp.............GYM........................FKR.SIKMN............YL
Mpf_ENSMPUP00000017577 LGFYKDAKGpasrgth...........GGE........................P--.LLSLH............RA
Mpf_ENSMPUP00000004977 LLFLQEKDQkyifp.............ALD........................KPS.VVSLQ............NL
Mpf_ENSMPUP00000017884 L-IWRDQK-..................NHE........................CCM.AIPLS............QI
Mpf_ENSMPUP00000007027 IMYYKSPSDv.................IRK........................PQG.QVELNs...........RC
Mpf_ENSMPUP00000012725 LRYYDSGE-..................DTN........................CKG.HIDLA............EV
Mpf_ENSMPUP00000000871 ---------..................---........................-IR.CLPLE............EG
Mpf_ENSMPUP00000006220 LHYYDPAG-..................GED........................PLG.AIHLR............GC
Mpf_ENSMPUP00000008418 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000003932 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000001861 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008418 --------Mslvnpl............DHS........................LIH.CQPLV............HI
Mpf_ENSMPUP00000006249 LFFYKDEE-..................DTK........................PQG.CMYLP............GS
Mpf_ENSMPUP00000003836 LHYYRHKKDeg................KCS........................PLE.VIKLE............GA
Mpf_ENSMPUP00000015858 LSFAKTPS-..................-SK........................KSA.LIKLA............NI
Mpf_ENSMPUP00000002835 KTIWQESRKvm................RTP........................ESQ.LFSIE............DI
Mpf_ENSMPUP00000004473 ILYCVPKLRlmgq..............KFS........................VRE.KMDIS............GL
Mpf_ENSMPUP00000000137 LYWYINEE-..................DEK........................AEG.FISLP............EF
Mpf_ENSMPUP00000001907 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000014024 LLYCIPKVIqvga..............QFQ........................VRT.RIDVA............GM
Mpf_ENSMPUP00000001742 LYYAKDSK-..................-SL........................IFD.EVDLS............DA
Mpf_ENSMPUP00000000172 LLYTSKGVTgss...............HFR........................IRG.RLPLH............GM
Mpf_ENSMPUP00000005480 LYYAKTAK-..................-SI........................IFD.EVDLT............DA
Mpf_ENSMPUP00000018515 LVYGNIVIQkk................KYN........................KQH.IIPLE............NV
Mpf_ENSMPUP00000009502 LKYFKDQM-..................SPE........................PIR.ILDLT............EC
Mpf_ENSMPUP00000013672 IIFLSKG--..................---........................---.-----............--
Mpf_ENSMPUP00000011336 LLYCVPRLRllgq..............KFS........................VRA.RIDVD............GM
Mpf_ENSMPUP00000001410 LRWEPSKK-..................-DS........................EKA.KIDIK............SI
Mpf_ENSMPUP00000003424 LGFYKDAKAasa...............GVP........................YHG.EVPVSla..........RA
Mpf_ENSMPUP00000007040 ---------..................-S-........................---.-----............--
Mpf_ENSMPUP00000019493 LLVATWLPQrrg...............MYR........................YNA.LYPLD............GL
Mpf_ENSMPUP00000018830 LVYGSVVLPkr................KYR........................SQH.VIPLE............EV
Mpf_ENSMPUP00000003141 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010983 LMYFENDS-..................EDK........................LKG.TLEIR............TA
Mpf_ENSMPUP00000010498 ---------..................---........................W--.-----............--
Mpf_ENSMPUP00000012786 LYLQKDEYKpekals............EED........................LKN.AVSVH............HA
Mpf_ENSMPUP00000014114 LVYQKKVK-..................DAL........................TVV.VDDLR............LC
Mpf_ENSMPUP00000007256 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005608 LSYYKSEDEt.................EYG........................CRG.SICLS............KA
Mpf_ENSMPUP00000002033 LRYYDHRV-..................DTE........................CKG.VIDLA............EV
Mpf_ENSMPUP00000016751 LKLIDPQT-..................-QV........................TRL.TFPLP............SV
Mpf_ENSMPUP00000016435 MTVWHARQA..................GST........................AKP.TFSIS............DV
Mpf_ENSMPUP00000001167 LEYYENEKKwrhk..............SSA........................PKR.SIPLE............SC
Mpf_ENSMPUP00000001585 LFFYSDKK-..................SPT........................YVD.KLDLI............DL
Mpf_ENSMPUP00000002351 IVFCKIRMEpsdqglap..........HYS........................FKK.SMKLV............TL
Mpf_ENSMPUP00000011499 LLYTSRGLTasn...............QFK........................VHG.QLPLY............GM
Mpf_ENSMPUP00000005375 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015986 ------E--..................---........................---.-----............--
Mpf_ENSMPUP00000004747 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000009754 LSYYENER-..................AVT........................PNG.EIRAS............EI
Mpf_ENSMPUP00000002257 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000006734 LLVTKAVKKaer...............TKV........................IRP.PLLVD............KI
Mpf_ENSMPUP00000003502 ---------..................KKK........................VSI.MVSVD............GV
Mpf_ENSMPUP00000011019 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000003673 LEWRGE---..................GEA........................PQS.LLTME............EI
Mpf_ENSMPUP00000000383 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008997 LYLQKDEYRpdkals............EGD........................LKN.AIRVH............HA
Mpf_ENSMPUP00000010040 LVYQKKYK-..................DPV........................TVV.VDDLR............LC
Mpf_ENSMPUP00000007257 LYTYAASE-..................DVA........................ALE.SQPLL............GF
Mpf_ENSMPUP00000016774 LYLQKEEYQpgkals............EAE........................LKN.AISIH............HA
Mpf_ENSMPUP00000001960 LLCYKSSK-..................DHS........................PQL.DVNLL............GS
Mpf_ENSMPUP00000007610 VRWRPSRK-..................--H........................EKA.KISID............SI
Mpf_ENSMPUP00000017612 LLVAKRRGP..................EYT........................YKG.HIFCC............NL
Mpf_ENSMPUP00000007907 LRWEPSKKD..................--L........................EKA.KLDIS............AI
Mpf_ENSMPUP00000014021 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008982 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005803 ISYYNNEK-..................EKY........................SKG.IIPLS............AI
Mpf_ENSMPUP00000002728 LRWRPSRK-..................SEK........................AK-.-ILID............SI
Mpf_ENSMPUP00000007017 LHYYDPSKE..................ENR........................PVG.GFSLR............GS
Mpf_ENSMPUP00000003752 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000001306 LLLTQIIKPlgssgsdkvfspkshll.YKM........................YKT.PIFLN............EV
Mpf_ENSMPUP00000005338 -----DEK-..................TKE........................VIQ.EWSLT............NI
Mpf_ENSMPUP00000001689 LNSYKDEKN..................SKE........................SKG.CIYLD............AC
Mpf_ENSMPUP00000010415 LLCYKSSK-..................DQQ........................PQM.ELPLQ............GC
Mpf_ENSMPUP00000006220 IEFYKKKS-..................DNS........................PKG.MIPLK............GS
Mpf_ENSMPUP00000016350 VFIYNSDK-..................DPV........................ERG.VINLS............TA
Mpf_ENSMPUP00000018773 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000017599 FIGYKERP-..................DAP........................DQT.LPPLN............NF
Mpf_ENSMPUP00000016349 VFIYNSDK-..................DPV........................ERG.VINLS............TA
Mpf_ENSMPUP00000015036 LSLSKERREpgpaaagaaaava.....GED........................EAA.PVCIG............SC
Mpf_ENSMPUP00000007938 LMYFGSDK-..................DPF........................PKG.VIPLT............AI
Mpf_ENSMPUP00000007257 LLYTTPMQSg.................MYK........................LNN.MLSLA............GM
Mpf_ENSMPUP00000005203 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000000650 ------EK-..................TKE........................VLQ.EWPLT............TV
Mpf_ENSMPUP00000007937 LIYFESEKR..................ATK........................PKG.LIDLS............VC
Mpf_ENSMPUP00000007017 LLYYKLEGGrk................VTP........................PKG.RILLD............GC
Mpf_ENSMPUP00000012780 LSYYRNQGEm.................AHT........................CRG.TINLS............TA
Mpf_ENSMPUP00000002522 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000004905 LYFYNSNR-..................DSQ........................HVE.KLVLGafv.........KL
Mpf_ENSMPUP00000011326 LNFYKDEKI..................SKE........................PKG.SIFLD............SC
Mpf_ENSMPUP00000009449 LYFLKGEDHcppageslv.........GQM........................VDE.PVGVH............HS
Mpf_ENSMPUP00000000014 LRYYRDSAAee................AAD........................LDG.EIDLS............TC
Mpf_ENSMPUP00000012737 LKYYRDSTAee................ADE........................LDG.EIDLR............SC
Mpf_ENSMPUP00000002136 FTGYKERP-..................QDV........................EQR.EAPLN............NF
Mpf_ENSMPUP00000017782 LMYFKDPL-..................DAF........................ARG.EVFIGskes........GY
Mpf_ENSMPUP00000013550 LEWRGEGE-..................--S........................RQN.LLTME............QI
Mpf_ENSMPUP00000017362 LLIYKTQK-..................NGQ........................WVG.TVLLN............AC
Mpf_ENSMPUP00000006996 LSYYTSKDKmm................RGS........................RRG.CVRLR............GA
Mpf_ENSMPUP00000004785 LSYYVDKH-..................ETK........................LKG.VIYFQ............AI
Mpf_ENSMPUP00000014164 LLCYKSSK-..................DRQ........................PHL.RLALD............VC
Mpf_ENSMPUP00000016592 MNFYKDEKI..................SKE........................PKG.CIFLD............SC
Mpf_ENSMPUP00000000486 LMAFQPGKL..................DED........................PLL.SYHVD............VC
Mpf_ENSMPUP00000003712 LVYQKKFK-..................DNP........................TVV.VEDLR............LC
Mpf_ENSMPUP00000006850 LAYYADKE-..................ETK........................LKG.VIYFQ............AI
Mpf_ENSMPUP00000015574 LSLLRKPKGrgsgdtq...........ASP........................PPP.ALRLS............LL
Mpf_ENSMPUP00000014962 LEL------..................---........................---.-----............--
Mpf_ENSMPUP00000016814 LLVTKPQRKlnk...............AKV........................IRP.PLMLE............KL
Mpf_ENSMPUP00000000139 AYLYNSDK-..................DSV........................ERF.VLNLS............TA
Mpf_ENSMPUP00000012020 LMCQP-RG-..................AVA........................GGL.IQDLD............NC
Mpf_ENSMPUP00000006069 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000017142 LLYTYPQKDg.................KYR........................LKN.TLSVA............SM
Mpf_ENSMPUP00000013991 LCFAHHPT-..................-FA........................RFE.TIDLS............QV
Mpf_ENSMPUP00000010353 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000000014 LRYALDEMP..................TTL........................PQG.TINMN............QC
Mpf_ENSMPUP00000009546 LLWYMDNPQnlam..............GAG........................AVG.SLQLT............YI
Mpf_ENSMPUP00000012020 ----DPQT-..................-QV........................TRA.NFELT............SI
Mpf_ENSMPUP00000016751 L-MSQARG-..................DVA........................GGL.AMDID............NC
Mpf_ENSMPUP00000000216 LYMYGAPQ-..................DVR........................AQA.TIPLL............GY
Mpf_ENSMPUP00000010854 IYYFKSST-..................SAS........................PQG.AFSLS............GY
Mpf_ENSMPUP00000016813 MCSYREKK-..................-AE........................PQE.LLQLD............GY
Mpf_ENSMPUP00000002870 FVWYMDNPQnlps..............GSS........................RVG.AIKLT............YI
Mpf_ENSMPUP00000003651 LEFYKESKQqalsnmk...........TGH........................KPE.SVDLC............GA
Mpf_ENSMPUP00000002370 ---------..................---........................---.-INTE............VM
Mpf_ENSMPUP00000006780 MCSYREKK-..................-SE........................PQE.LMQLE............GY
Mpf_ENSMPUP00000002802 LLFQKGKSKddp...............DDS........................PIE.LSKVQ............SV
Mpf_ENSMPUP00000011336 LYIYGAPQ-..................DVK........................AQR.SLPLI............GF
Mpf_ENSMPUP00000003120 LSYYDSQDDv.................CKG........................SKG.SIKMA............VC
Mpf_ENSMPUP00000005803 LSYYENDK-..................STA........................PNG.TININ............EV
Mpf_ENSMPUP00000004980 LSYYDSPEDa.................WKG........................CKG.SIQMA............VC
Mpf_ENSMPUP00000015621 FIGYKEKPQdvd...............LPY........................PLN.NFSVA............KC
Mpf_ENSMPUP00000003141 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013099 LTISHGTA-..................-NR........................PPA.KLNLL............TC
Mpf_ENSMPUP00000010983 LDYYKSSEK..................NAL........................KLG.TLVLN............SL
Mpf_ENSMPUP00000004910 LLIYKTPK-..................VGQ........................WVG.TVLLH............CC
Mpf_ENSMPUP00000016233 ---------..................--T........................KRG.TVFLT............SY
Mpf_ENSMPUP00000002953 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011716 LIYYDDQTRhsvedk............IHM........................PVD.CINIRigh.........EC
Mpf_ENSMPUP00000007767 ISYWTYPDDek................RKN........................PIG.RINLA............NC
Mpf_ENSMPUP00000014585 LLYYKNPL-..................DAF........................EQG.QVFLGsneq........GY
Mpf_ENSMPUP00000014164 LYFHKDHTD..................LRT........................HVN.AIALR............GC
Mpf_ENSMPUP00000005886 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013797 LYFQARGSK..................GLA........................FQG.LLPLM............EL
Mpf_ENSMPUP00000004108 LEYFVNEQSr.................NQK........................PRG.TLQLA............GA
Mpf_ENSMPUP00000009167 ---------..................---........................IEG.FLDIM............EI
Mpf_ENSMPUP00000016226 LYQYPDRT-..................DVT........................PLL.SVNMGge..........QC
Mpf_ENSMPUP00000014024 LYVYAAPQ-..................DMR........................AHT.SVPLL............GY
Mpf_ENSMPUP00000008448 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010607 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015774 LTISHSTI-..................-NR........................PPV.KLTLL............TC
Mpf_ENSMPUP00000008639 LSVWFQRRIp.................RAP........................SQH.IFFVQ............HI
Mpf_ENSMPUP00000012941 LLFTKTQGSstswfgsn..........QSK........................PEF.TVDLK............GA
Mpf_ENSMPUP00000016218 LVLTRPVTRnerhf.............YQV........................YRQ.PIPVQ............EL
Mpf_ENSMPUP00000007001 LLLSRPREGsrflvf............DHA........................PFS.SIRGE............KC
Mpf_ENSMPUP00000001986 LLFYETYGKnsmdq.............SSA........................PRC.ALFAE............DS
Mpf_ENSMPUP00000010415 LIFHKDRTD..................LKT........................HIV.SVPLR............GC
Mpf_ENSMPUP00000003836 LYFYASIR-..................STQ........................ASG.GLYLQ............GY
Mpf_ENSMPUP00000007027 FYYYRSHE-..................DKR........................PLG.HLPVR............DA
Mpf_ENSMPUP00000002688 LIITKKKSEesynvn............DYS........................LRD.QLLVE............SC
Mpf_ENSMPUP00000001373 LTISHATS-..................NRQ........................PA-.KLNLL............TC
Mpf_ENSMPUP00000013700 LLCAKLKKTsagkhq............QYD........................CKW.YIPLA............DL
Mpf_ENSMPUP00000016589 ---------..................---........................L--.-----............--
Mpf_ENSMPUP00000015325 LFYFESDS-..................SSR........................PSG.LYLLE............GC
Mpf_ENSMPUP00000001960 LHFYQDRNR..................SKV........................AQQ.PLSLV............GC
Mpf_ENSMPUP00000006310 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000016747 ---------..................---........................-DG.EVRLG............GS
Mpf_ENSMPUP00000013323 LKYAKSQTDie................REK........................LHG.CIDVG............LS
Mpf_ENSMPUP00000007350 LLYYSESEKknfesnkyf.........NIH........................PKG.VIPLG............GC
Mpf_ENSMPUP00000017588 ITWSRGAD-..................--K........................IEG.AIDIR............EI
Mpf_ENSMPUP00000007745 LHYGDLEESpqgevp............HDS........................LQD.KLPVA............DI
Mpf_ENSMPUP00000006409 LYYSRTAQ-..................DAN........................PLD.SIDLS............SA
Mpf_ENSMPUP00000015574 LECYESEKKfrag..............RAP........................PKL.SVSLA............GA
Mpf_ENSMPUP00000008365 LTFFKDSKAsaagglrqppk.......LST........................PEY.TVDLR............GA
Mpf_ENSMPUP00000001054 LFFYESDGRsgidh.............NSI........................PKH.AVWVE............NS
Mpf_ENSMPUP00000017488 LHYGDLDDNpqgevt............FES........................LQE.KIPVA............DI
Mpf_ENSMPUP00000005234 LVICRQIPGdkyqvf............DSA........................PRG.LLRVE............--
Mpf_ENSMPUP00000013182 LSYYKSQDEa.................PGD........................PIQ.QLNLK............GC
Mpf_ENSMPUP00000011513 LLYYKSPSDv.................IRK........................PQG.HIELS............AS
Mpf_ENSMPUP00000005385 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000009077 ---------..................---........................---.-----............-C
Mpf_ENSMPUP00000001767 LILSSRQD-..................NTE........................---.-----............--
Mpf_ENSMPUP00000007827 ITMVPFDQKsgg...............KGG........................EDE.SVTLK............SC
Mpf_ENSMPUP00000000541 LLVYENED-..................EQK........................CVE.TVELG............SY
Mpf_ENSMPUP00000001809 LVFYREPPPaapssiwgpa........GSR........................PES.SVDLR............GA
Mpf_ENSMPUP00000005803 LFLYKDSK-..................SSK........................YDK.MFSLG............SL
Mpf_ENSMPUP00000013182 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000005315 LYVSDKEVKd.................EKN........................IQE.VFDLS............DY
Mpf_ENSMPUP00000014585 LKYYTKEE-..................GKG........................PKA.VISIK............DL
Mpf_ENSMPUP00000015166 LHYATTRQDit................KGK........................LHG.SIDVR............LS
Mpf_ENSMPUP00000002409 L--------..................---........................---.-----............--
Mpf_ENSMPUP00000005807 LSWYKDEE-..................EKE........................KKY.MLPLD............NL
Mpf_ENSMPUP00000013796 LAIFSEEAE..................GLC........................FKG.ELPLS............TI
Mpf_ENSMPUP00000017782 LKYFNRND-..................AKE........................PKA.IMKIE............HL
Mpf_ENSMPUP00000019464 LFSFESRE-..................SRA........................PLS.LVVLE............GC
Mpf_ENSMPUP00000012725 ---------..................---........................---.-----............-I
Mpf_ENSMPUP00000010996 LYCFYSPQEiea...............KVE........................PAL.VVSIN............KE
Mpf_ENSMPUP00000007938 LLLLKEKK-..................SSK........................PER.EWPLE............GS
Mpf_ENSMPUP00000009654 LGYYRDETAq.................DEE........................DRV.LIQFNirdikigq....EC
Mpf_ENSMPUP00000005385 ISCYKSKEEs.................SGT........................PAH.QMNLR............GC
Mpf_ENSMPUP00000006310 IAYFKNKELe.................QGE........................PVE.KLNLR............GC
Mpf_ENSMPUP00000007963 LEYYKNDH-..................SKK........................PLR.IINLN............FC
Mpf_ENSMPUP00000002310 LTYHPSLHDym................QNV........................HGK.EIDLL............RT
Mpf_ENSMPUP00000000486 LYFYSLDSSg.................NQA........................LYA.TYQLS............HF
Mpf_ENSMPUP00000007805 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010246 LYFQPLNG-..................YPK........................PVV.QITLQ............DV
Mpf_ENSMPUP00000004460 LEKYPDEK-..................SVC........................LRG.CPKVT............EI
Mpf_ENSMPUP00000014791 ---------..................TYQ........................FIA.SVALH............RL
Mpf_ENSMPUP00000003154 LKYSKAPLDiq................KGK........................VHG.SIDVG............LS
Mpf_ENSMPUP00000005214 LLMAKPRPPlhllqsg...........TFA........................CRA.LYPMA............QC
Mpf_ENSMPUP00000003932 LEYYENARK..................-FRhsvraaaaaaaaaasgaavpalipPRR.VITLY............QC
Mpf_ENSMPUP00000008710 LLTYHPSLHdym...............QNI........................HGK.EIDLL............RT
Mpf_ENSMPUP00000005632 LQYGDMEEGaspptl............DSL........................P-E.QLPVA............DI
Mpf_ENSMPUP00000002828 LLCTKLKKQsggktq............QYD........................CKW.YIPLT............DL
Mpf_ENSMPUP00000017859 ---------..................KKA........................ALG.TLYLT............AT
Mpf_ENSMPUP00000013754 LLYYGAKSLrgtdrkhy..........KST........................PGK.KVSVV............GW
Mpf_ENSMPUP00000004548 LTMTPMEQK..................PGA........................KQG.PLDLTl...........KY
Mpf_ENSMPUP00000000646 LLFIDSHQ-..................KET........................WIL.HHHIA............LV
Mpf_ENSMPUP00000004473 LHLQRDSQ-..................DGG........................PPR.TIPLA............GC
Mpf_ENSMPUP00000000402 IYYVPKGKAkv................SRE........................LVC.FLQLD............HV
Mpf_ENSMPUP00000007412 LVVTKKKSEd.................SFM........................VQD.YAQVD............HI
Mpf_ENSMPUP00000004935 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011513 LYYFRSQE-..................DKF........................PLG.QIKLW............EA
Mpf_ENSMPUP00000001759 FTMSVSEMKssgkmnglv.........TGS........................PE-.MFKLK............SC
Mpf_ENSMPUP00000008353 FRLYLNTE-..................ERL........................CVE.TCSLL............RC
Mpf_ENSMPUP00000012083 IYYVPKGKTkt................SRD........................LAC.FIQFK............NV
Mpf_ENSMPUP00000006956 IIPFEHRSG..................GKL........................GDGeVFFLK............EC
Mpf_ENSMPUP00000014860 LYYSTKGT-..................SKD........................PRH.LQYIAdvn.........ES
Mpf_ENSMPUP00000009647 LVVTKIFQKkkilv.............TYS........................FRQ.SFPLV............EM
Mpf_ENSMPUP00000005803 VWLCKNEQDfk................SGL........................GIT.IIPMN............VA
Mpf_ENSMPUP00000005109 LFYYAAKSLkaterkhf..........KST........................SNK.NVSVV............GW
Mpf_ENSMPUP00000006149 LEKFSDERAay................FRC........................YHK.VTELN............NV
Mpf_ENSMPUP00000001981 LLYHPSINDyi................HST........................HGK.EMDLL............RT
Mpf_ENSMPUP00000017916 LVILKLCPKkksss.............TYT........................FCK.SVGLL............GM
Mpf_ENSMPUP00000003318 FVVAKIKYNn.................NFK........................IKN.KIKLS............DM
Mpf_ENSMPUP00000017175 LVVTKIFQKkknsv.............TYS........................FRQ.SFSLY............GM
Mpf_ENSMPUP00000016038 LEYYRSKH-..................ASK........................PIR.AIDLS............EC
Mpf_ENSMPUP00000016192 LLLSRRKELg.................KFA........................VFV.HARMA............EL
Mpf_ENSMPUP00000015325 LIICTRGSGgkl...............HLT........................KNG.VISLI............DC
Mpf_ENSMPUP00000000660 LYFSTKGT-..................SKE........................PRH.LQFFSefgns.......DI
Mpf_ENSMPUP00000005493 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000009754 LRLYKEIR-..................SHR........................PEK.EWPVR............SL
Mpf_ENSMPUP00000013796 LYFQARGSK..................GLA........................FQG.LLPLM............EL
Mpf_ENSMPUP00000010667 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013126 LSWYKDDEThslsetd...........MSV........................LPD.NYSLNhlh.........EW
Mpf_ENSMPUP00000018046 LYCSTKGA-..................SKE........................PRH.LQLLG............GL
Mpf_ENSMPUP00000006359 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015086 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000008387 LICTRSSGGklh...............LLK........................TGG.VLSLI............EC
Mpf_ENSMPUP00000015207 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000004217 ---------..................---........................---.MQFLS............GC
Mpf_ENSMPUP00000015689 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000015159 LLLSPGPQ-..................GTS........................DLW.LLLLR............SV
Mpf_ENSMPUP00000018833 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000007866 LFCYRQPEDadt...............GEE........................PLF.TIAIN............KE
Mpf_ENSMPUP00000007938 LALYKSEQAfs................SGI........................GIC.FIELQ............GC
Mpf_ENSMPUP00000010694 ---------..................---........................--R.LIPLL............HS
Mpf_ENSMPUP00000013131 ---------..................---........................---.-VPLQ............LI
Mpf_ENSMPUP00000000312 LVHAQ----..................-FS........................THH.VFPLA............TL
Mpf_ENSMPUP00000019132 LQLFEAKGT..................GGR........................PK-.ELSFA............RI
Mpf_ENSMPUP00000015959 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000012612 LQHDEEAGRt.................SNP........................QRG.AVAMC............GK
Mpf_ENSMPUP00000007938 LEMFASES-..................SPE........................PLS.LIQPQ............DV
Mpf_ENSMPUP00000007989 LLITQPKSGq.................R--........................LQ-.VLDYAhrs.........LV
Mpf_ENSMPUP00000016156 LFYKKDNEF..................KEK........................GVG.TLHLK............--
Mpf_ENSMPUP00000013721 LVLYENKVAyer...............QVP........................PRA.IINSA............GY
Mpf_ENSMPUP00000005447 ILFYNDEQDke................QSS........................PSM.VLDID............KL
Mpf_ENSMPUP00000015768 LEWFSHREEyen...............GGH........................PLG.STTLT............GY
Mpf_ENSMPUP00000004215 LELQEGPEKprr...............GEA........................ARR.VIRLS............DC
Mpf_ENSMPUP00000010108 LDQFSSSGK..................GAR........................RLR.SLVLT............SL
Mpf_ENSMPUP00000002188 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000013446 ILFYDSEQDke................QSN........................PYM.VLDID............KL
Mpf_ENSMPUP00000012407 LLLFDAPDPrlspa.............SGA........................LMQ.ALDLRdpqfsatpv...LA
Mpf_ENSMPUP00000017043 LLYMKPDS-..................-GA........................IAF.VLLVDk...........EF
Mpf_ENSMPUP00000007898 LLFTKEDEPgr................CDV........................LRN.PLYLQ............SV
Mpf_ENSMPUP00000017064 LEIARKRHKvigtfrsppghtrppa..SLK........................HIH.LMPLS............QI
Mpf_ENSMPUP00000009754 VQLYKNLEEyh................LGI........................GIT.FIDMS............VG
Mpf_ENSMPUP00000016461 LFIYYVVH-..................EEK........................KYL.HVFLN............EV
Mpf_ENSMPUP00000008230 LEFFDHKGSssgggrggs.........RRL........................DCK.VIRLA............EC
Mpf_ENSMPUP00000001993 LSYYKDQH-..................---........................RRG.SIEIDrns.........SV
Mpf_ENSMPUP00000014500 ---------..................---........................CRG.TINLA............TA
Mpf_ENSMPUP00000002405 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000002933 VLIYDNEARea................GQR........................PVE.EFELClpdgdvsihgavGA
Mpf_ENSMPUP00000007268 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010983 ---------..................---........................-VG.TLDVG............LI
Mpf_ENSMPUP00000010498 LLMLVYKDKaerak.............GLR........................ERS.SLTLE............DI
Mpf_ENSMPUP00000018101 LFLYNMDEEkdskp.............NVV........................VSQ.VIDMRdgaf........SV
Mpf_ENSMPUP00000002033 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010694 LYKFLAPPVttwd..............WTR........................AEK.TFSVY............EI
Mpf_ENSMPUP00000008353 LKCFRVRNN..................EKM........................LSD.SHGIE............TI
Mpf_ENSMPUP00000009754 LRAVFPEGP..................CEE........................PLQ.---LR............KL
Mpf_ENSMPUP00000015718 LFLYDVAEGkasqp.............SVV........................VSQ.VIDMRdeefsvssv...LA
Mpf_ENSMPUP00000002358 LFLYDLPEGkstqp.............GVV........................ASQ.VLDLRdeefsvssv...LA
Mpf_ENSMPUP00000005077 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000009107 LSLFWDKRTaae...............NMA........................PVA.TLDLR............GA
Mpf_ENSMPUP00000016101 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000011911 LESWEVREGglgptgdrptgps.....RRG........................ERR.VIRLA............DC
Mpf_ENSMPUP00000007938 LFLCPASGPg.................PPA........................PED.MVHLRrlq.........EI
Mpf_ENSMPUP00000009676 MSLYTAASVidtas.............KYK........................L--.-----............--
Mpf_ENSMPUP00000005809 LSWYRKQPDavr...............NIY........................RQG.CKHLT............QA
Mpf_ENSMPUP00000016410 LIVSSVKDS..................LTG........................KMH.VLPLI............GG
Mpf_ENSMPUP00000006638 ---------..................---........................--T.HVVLK............EC
Mpf_ENSMPUP00000005803 LRFCLQMQEv.................QED........................RMY.LRRLQ............EL
Mpf_ENSMPUP00000010983 FLWFRSKQ-..................---........................---.-----............--
Mpf_ENSMPUP00000000717 ---------..................---........................---.-----............-S
Mpf_ENSMPUP00000002793 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000007833 LIVSSVKDC..................QTG........................KMH.ILPLV............GG
Mpf_ENSMPUP00000002271 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010974 ---------..................---........................---.-----............--
Mpf_ENSMPUP00000010755 LLYMCLET-..................-GA........................ISF.VQL-Fdp..........GF
Mpf_ENSMPUP00000013112 ---------..................---........................--H.-----............--


                        80                                                                          
                         |                                                                          
d1wg7a_                .MGVVQNN....KV...........................RR..................................
Mpf_ENSMPUP00000000236 .-----TT....TT...........................RS..................................
Mpf_ENSMPUP00000001054 .QVRALAS....ADae.........................AN..................................
Mpf_ENSMPUP00000001986 .QVRLGNTag..TE...........................NN..................................
Mpf_ENSMPUP00000006133 .-------....--...........................--..................................
Mpf_ENSMPUP00000009494 .-------....--...........................--..................................
Mpf_ENSMPUP00000004093 .-------....--...........................--..................................
Mpf_ENSMPUP00000012215 .-------....--...........................--..................................
Mpf_ENSMPUP00000016175 .----VTD....SS...........................RY..................................
Mpf_ENSMPUP00000009909 .-------....--...........................--..................................
Mpf_ENSMPUP00000010977 .-------....--...........................--..................................
Mpf_ENSMPUP00000016638 .-VETVTD....SS...........................RY..................................
Mpf_ENSMPUP00000018612 .-------....--...........................--..................................
Mpf_ENSMPUP00000018966 .-------....--...........................--..................................
Mpf_ENSMPUP00000004660 .NVRMNNTl...RKdgk........................KD..................................
Mpf_ENSMPUP00000002149 .TCVETVVp...EK...........................NPpperqiprrgeessemeqisiierfp........
Mpf_ENSMPUP00000018066 .-------....--...........................--..................................
Mpf_ENSMPUP00000017958 .-------....--...........................--..................................
Mpf_ENSMPUP00000011450 .QHCQAVMhs..CN...........................YD..................................
Mpf_ENSMPUP00000016402 .TFCDLDP....QE...........................R-..................................
Mpf_ENSMPUP00000004951 .KAIINST....--...........................--..................................
Mpf_ENSMPUP00000011363 .-------....--...........................--..................................
Mpf_ENSMPUP00000015445 .KVIINST....IT...........................PN..................................
Mpf_ENSMPUP00000015195 .SVRMAPYl...RKdsk........................KE..................................
Mpf_ENSMPUP00000011751 .EVVDLEDg...KDrdlhvs.....................VK..................................
Mpf_ENSMPUP00000009831 .EVVDIEDg...RDddfnvs.....................MK..................................
Mpf_ENSMPUP00000004111 .-------....--...........................--..................................
Mpf_ENSMPUP00000005349 .KCVEIVKn...DEgvvpcq.....................NK..................................
Mpf_ENSMPUP00000006137 .TFSSTDP....QD...........................R-..................................
Mpf_ENSMPUP00000009095 .LAVERLE....EEsfk........................MK..................................
Mpf_ENSMPUP00000005832 .-------....--...........................--..................................
Mpf_ENSMPUP00000014567 .-------....--...........................--..................................
Mpf_ENSMPUP00000015198 .LRPEAKN....FK...........................--..................................
Mpf_ENSMPUP00000008441 .-------....--...........................--..................................
Mpf_ENSMPUP00000005146 .RNISFND....KK...........................--..................................
Mpf_ENSMPUP00000010667 .-------....--...........................--..................................
Mpf_ENSMPUP00000000642 .ELVDLEDg...RDkdwnls.....................VK..................................
Mpf_ENSMPUP00000015373 .-------....--...........................--..................................
Mpf_ENSMPUP00000003213 .-------....--...........................--..................................
Mpf_ENSMPUP00000012196 .KILEPKT....KEvqhncql....................HR..................................
Mpf_ENSMPUP00000012194 .-------....--...........................--..................................
Mpf_ENSMPUP00000003212 .-------....--...........................--..................................
Mpf_ENSMPUP00000001158 .RNISFND....KK...........................--..................................
Mpf_ENSMPUP00000010667 .-------....--...........................--..................................
Mpf_ENSMPUP00000013386 .KCVEIVK....SDisipch.....................YK..................................
Mpf_ENSMPUP00000016712 .-------....--...........................--..................................
Mpf_ENSMPUP00000003302 .RNISFND....KK...........................--..................................
Mpf_ENSMPUP00000003768 .-V-----....--...........................--..................................
Mpf_ENSMPUP00000008012 .-------....--...........................--..................................
Mpf_ENSMPUP00000002625 .RCVEKVNl...EEqtpae......................RQ..................................
Mpf_ENSMPUP00000010667 .-------....--...........................--..................................
Mpf_ENSMPUP00000006140 .TVTVISE....KSeedvlvecrvrflsfmgvgkdv.....HT..................................
Mpf_ENSMPUP00000015670 .-------....--...........................--..................................
Mpf_ENSMPUP00000008341 .RFGKFAKi...PKsqk........................LR..................................
Mpf_ENSMPUP00000017573 .-------....R-...........................--..................................
Mpf_ENSMPUP00000012859 .------R....--...........................--..................................
Mpf_ENSMPUP00000012131 .LAVEKLE....ESsfn........................KK..................................
Mpf_ENSMPUP00000000172 .-------....--...........................-R..................................
Mpf_ENSMPUP00000013200 .RNISYSD....KE...........................--..................................
Mpf_ENSMPUP00000003522 .LVRSVAT....DK...........................RA..................................
Mpf_ENSMPUP00000011499 .-------....--...........................--..................................
Mpf_ENSMPUP00000011494 .SRIEKMGga..TSrge........................NS..................................
Mpf_ENSMPUP00000012716 .CVESLPDk...DG...........................KK..................................
Mpf_ENSMPUP00000002913 .-------....--...........................--..................................
Mpf_ENSMPUP00000003504 .CVEVLPDr...EG...........................KR..................................
Mpf_ENSMPUP00000004361 .-------....--...........................--..................................
Mpf_ENSMPUP00000017389 .-------....--...........................--..................................
Mpf_ENSMPUP00000015829 .RTTMPLEm...PE...........................KD..................................
Mpf_ENSMPUP00000003644 .-------....--...........................--..................................
Mpf_ENSMPUP00000006376 .-------....--...........................--..................................
Mpf_ENSMPUP00000014536 .-------....--...........................--..................................
Mpf_ENSMPUP00000011501 .SRVEKI-....-Gaqshgd.....................NS..................................
Mpf_ENSMPUP00000017670 .-------....--...........................--..................................
Mpf_ENSMPUP00000006727 .-------....--...........................--..................................
Mpf_ENSMPUP00000000961 .-------....--...........................--..................................
Mpf_ENSMPUP00000004942 .-------....--...........................--..................................
Mpf_ENSMPUP00000002151 .-------....--...........................--..................................
Mpf_ENSMPUP00000014680 .-------....-N...........................--..................................
Mpf_ENSMPUP00000005563 .LVRQVAT....DN...........................-K..................................
Mpf_ENSMPUP00000011333 .QIAMLTS....EDhvn........................RK..................................
Mpf_ENSMPUP00000000969 .-VVEDDD....QGkeqe.......................HT..................................
Mpf_ENSMPUP00000010395 .QINDKDDt...SE...........................YK..................................
Mpf_ENSMPUP00000015361 .-------....--...........................--..................................
Mpf_ENSMPUP00000001991 .-------....--...........................--..................................
Mpf_ENSMPUP00000005637 .KIGVKAD....DSqeakgnk....................CS..................................
Mpf_ENSMPUP00000007307 .------Qg...RE...........................QE..................................
Mpf_ENSMPUP00000008193 .-------....--...........................--..................................
Mpf_ENSMPUP00000007177 .ITREVAT....D-...........................HK..................................
Mpf_ENSMPUP00000010360 .GITESVKg...DV...........................RK..................................
Mpf_ENSMPUP00000010611 .ICEVALDy...KK...........................KK..................................
Mpf_ENSMPUP00000007161 .FAARNLSm...PDl..........................EN..................................
Mpf_ENSMPUP00000006134 .-------....--...........................--..................................
Mpf_ENSMPUP00000004983 .QICDKDDt...CE...........................YK..................................
Mpf_ENSMPUP00000001920 .QTIQYSNsed.KD...........................RK..................................
Mpf_ENSMPUP00000013542 .-------....--...........................--..................................
Mpf_ENSMPUP00000008337 .IVREVANe...EK...........................AM..................................
Mpf_ENSMPUP00000013626 .-------....--...........................--..................................
Mpf_ENSMPUP00000001949 .TVERASE....CK...........................KK..................................
Mpf_ENSMPUP00000017721 .SRRCTPS....DP...........................EP..................................
Mpf_ENSMPUP00000001109 .FVTRSLAs...ADpen........................RQ..................................
Mpf_ENSMPUP00000001935 .KLSLSGG....PE...........................FQ..................................
Mpf_ENSMPUP00000006252 .-------....--...........................--..................................
Mpf_ENSMPUP00000005676 .-------....--...........................--..................................
Mpf_ENSMPUP00000005196 lTVEPAQN....FSlvppgt.....................NP..................................
Mpf_ENSMPUP00000012589 .-------....--...........................--..................................
Mpf_ENSMPUP00000010571 .-------....--...........................--..................................
Mpf_ENSMPUP00000011589 .RVAAVQPs...DNis.........................RK..................................
Mpf_ENSMPUP00000005676 .-------....--...........................--..................................
Mpf_ENSMPUP00000002533 .RAVERVD....EGafq........................LP..................................
Mpf_ENSMPUP00000004215 .-------....--...........................--..................................
Mpf_ENSMPUP00000013399 .-------....--...........................--..................................
Mpf_ENSMPUP00000010530 .TITKLEDs...EN...........................HR..................................
Mpf_ENSMPUP00000006089 .GLTECCGe...SN...........................LR..................................
Mpf_ENSMPUP00000016498 .-------....--...........................--..................................
Mpf_ENSMPUP00000007327 .-------....--...........................--..................................
Mpf_ENSMPUP00000001749 .GITEYVKg...DN...........................RK..................................
Mpf_ENSMPUP00000016475 .SIREVED....PR...........................KP..................................
Mpf_ENSMPUP00000013206 .VISPVAP....EDris........................RK..................................
Mpf_ENSMPUP00000006140 .RVWGVGRd...NG...........................RD..................................
Mpf_ENSMPUP00000005780 .IAREVAN....EE...........................RG..................................
Mpf_ENSMPUP00000001869 .VVTRLDEi...EG...........................ND..................................
Mpf_ENSMPUP00000012475 .SIREVED....SK...........................KP..................................
Mpf_ENSMPUP00000008316 .-------....--...........................--..................................
Mpf_ENSMPUP00000001167 .-------....--...........................--..................................
Mpf_ENSMPUP00000008230 .-------....--...........................V-..................................
Mpf_ENSMPUP00000017717 .-------....--...........................--..................................
Mpf_ENSMPUP00000010272 .GLTENVGd...SG...........................LR..................................
Mpf_ENSMPUP00000003964 .SIREVDD....PR...........................KP..................................
Mpf_ENSMPUP00000017478 .EVMEVENv...EDgtadyhsngyt................VT..................................
Mpf_ENSMPUP00000010168 .LRISSPQdf..TNisqgs......................NP..................................
Mpf_ENSMPUP00000009546 .LVK----....-Sgdllm......................RD..................................
Mpf_ENSMPUP00000002870 .HKVQECKq...SDimm........................RD..................................
Mpf_ENSMPUP00000000151 .DMGLTENi...GD...........................SG..................................
Mpf_ENSMPUP00000000216 .KIVETHN....EE...........................YP..................................
Mpf_ENSMPUP00000007012 .QVRDDSSg...DRenkk.......................WT..................................
Mpf_ENSMPUP00000012096 .KMTDDPTn...NKdvkk.......................WS..................................
Mpf_ENSMPUP00000004281 .ELGVTEHv...EG...........................DP..................................
Mpf_ENSMPUP00000004460 .-------....--...........................--..................................
Mpf_ENSMPUP00000011499 .SLTIPSEs...EDih.........................KD..................................
Mpf_ENSMPUP00000003498 .SIRPDGPgap.RG...........................RR..................................
Mpf_ENSMPUP00000006723 .ICEIAANy...KK...........................KK..................................
Mpf_ENSMPUP00000006149 .-------....--...........................--..................................
Mpf_ENSMPUP00000011052 .CLEENVEn...D-...........................-P..................................
Mpf_ENSMPUP00000015653 .SLESGQD....QK...........................KK..................................
Mpf_ENSMPUP00000014937 .-------....-S...........................--..................................
Mpf_ENSMPUP00000006713 .MLIESTR....DS...........................--..................................
Mpf_ENSMPUP00000005370 .LSLEPAK....PSdlipnga....................NP..................................
Mpf_ENSMPUP00000017142 .TIAPEKE....EGsse........................VG..................................
Mpf_ENSMPUP00000011052 .ELGVTEHv...EG...........................DP..................................
Mpf_ENSMPUP00000000930 .-------....--...........................--..................................
Mpf_ENSMPUP00000016865 .-------....--...........................--..................................
Mpf_ENSMPUP00000000090 .KIANNPTt...DKenkk.......................WS..................................
Mpf_ENSMPUP00000012035 .LIDISYSe...TK...........................RK..................................
Mpf_ENSMPUP00000009068 .RVTELLPg...PEda.........................GK..................................
Mpf_ENSMPUP00000000172 .SVSVPKEa...DGvh.........................KE..................................
Mpf_ENSMPUP00000013402 .-------....--...........................--..................................
Mpf_ENSMPUP00000012726 .TDVRTTTalemPD...........................RE..................................
Mpf_ENSMPUP00000010329 .MLVEVIP....KE...........................-P..................................
Mpf_ENSMPUP00000005886 .-------....--...........................--..................................
Mpf_ENSMPUP00000011911 .-------....--...........................--..................................
Mpf_ENSMPUP00000013895 .LVKLPTDp...SS...........................DE..................................
Mpf_ENSMPUP00000009754 .SRVAAIGd...QK...........................--..................................
Mpf_ENSMPUP00000017452 .IVREVAHe...EK...........................GL..................................
Mpf_ENSMPUP00000004281 .VLEENVDn...D-...........................-P..................................
Mpf_ENSMPUP00000017577 .TSEVASDy...KK...........................KK..................................
Mpf_ENSMPUP00000004977 .IVRDIANq...EK...........................G-..................................
Mpf_ENSMPUP00000017884 .VFIE---....--...........................--..................................
Mpf_ENSMPUP00000007027 .QIVRGEG....AQ...........................--..................................
Mpf_ENSMPUP00000012725 .EMVIPAG....PSmgapkhts...................DK..................................
Mpf_ENSMPUP00000000871 .QAVLQLGi...EG...........................AP..................................
Mpf_ENSMPUP00000006220 .VVTSVESs...SDvrkse......................EE..................................
Mpf_ENSMPUP00000008418 .-------....--...........................--..................................
Mpf_ENSMPUP00000003932 .-------....--...........................--..................................
Mpf_ENSMPUP00000001861 .-------....--...........................--..................................
Mpf_ENSMPUP00000008418 .RVWGVGSs...KG...........................RD..................................
Mpf_ENSMPUP00000006249 .TVKEIATn...PEev.........................GK..................................
Mpf_ENSMPUP00000003836 .EVGMDSS....LG...........................KP..................................
Mpf_ENSMPUP00000015858 .RAAEKVE....EKsfg........................SS..................................
Mpf_ENSMPUP00000002835 .QEVRKGHr...TEgmekfardvp.................ED..................................
Mpf_ENSMPUP00000004473 .QVQDIVK....PN...........................AA..................................
Mpf_ENSMPUP00000000137 .KIDRASE....CR...........................KK..................................
Mpf_ENSMPUP00000001907 .-------....QG...........................DP..................................
Mpf_ENSMPUP00000014024 .KVRELTD....AE...........................FP..................................
Mpf_ENSMPUP00000001742 .SVAEAST....KN...........................AN..................................
Mpf_ENSMPUP00000000172 .LVEEGEHe...RP...........................VP..................................
Mpf_ENSMPUP00000005480 .SVAESST....KN...........................VN..................................
Mpf_ENSMPUP00000018515 .TIDSIKDe...GD...........................LR..................................
Mpf_ENSMPUP00000009502 .SAVQFDYs...QE...........................RV..................................
Mpf_ENSMPUP00000013672 .-------....--...........................--..................................
Mpf_ENSMPUP00000011336 .ELKESSN....LN...........................LP..................................
Mpf_ENSMPUP00000001410 .KEVRTGKn...TDifrsngisdqis...............ED..................................
Mpf_ENSMPUP00000003424 .QGSVAFDy...RK...........................RK..................................
Mpf_ENSMPUP00000007040 .-------....--...........................--..................................
Mpf_ENSMPUP00000019493 .AVVNVKDn...PP...........................MK..................................
Mpf_ENSMPUP00000018830 .TLEPLPEt...PR...........................AK..................................
Mpf_ENSMPUP00000003141 .-------....--...........................--..................................
Mpf_ENSMPUP00000010983 .KEIIDNT....S-...........................KE..................................
Mpf_ENSMPUP00000010498 .-------....--...........................--..................................
Mpf_ENSMPUP00000012786 .LASKATDy...EK...........................KP..................................
Mpf_ENSMPUP00000014114 .SVKPCED....IE...........................RR..................................
Mpf_ENSMPUP00000007256 .-Y-----....--...........................--..................................
Mpf_ENSMPUP00000005608 .VITPHDF....DE...........................CR..................................
Mpf_ENSMPUP00000002033 .EAVAPGT....PTmgapktvd...................EK..................................
Mpf_ENSMPUP00000016751 .VLYATHQe...NK...........................RL..................................
Mpf_ENSMPUP00000016435 .ESVREGQ....ESellrslaeelp................LE..................................
Mpf_ENSMPUP00000001167 fNINKRAD....SK...........................NK..................................
Mpf_ENSMPUP00000001585 .TCLTDQN....ST...........................VK..................................
Mpf_ENSMPUP00000002351 .SIRQLGRg...SS...........................RK..................................
Mpf_ENSMPUP00000011499 .TIEESEDe...WG...........................VP..................................
Mpf_ENSMPUP00000005375 .-------....--...........................--..................................
Mpf_ENSMPUP00000015986 .-------....--...........................--..................................
Mpf_ENSMPUP00000004747 .------H....--...........................--..................................
Mpf_ENSMPUP00000009754 .VCLAVPP....PDthg........................FE..................................
Mpf_ENSMPUP00000002257 .----QNTs...DG...........................IK..................................
Mpf_ENSMPUP00000006734 .VCRELRD....PG...........................--..................................
Mpf_ENSMPUP00000003502 .KVILKKKk...KK...........................KE..................................
Mpf_ENSMPUP00000011019 .-------....-K...........................--..................................
Mpf_ENSMPUP00000003673 .QSVEETQ....IK...........................ER..................................
Mpf_ENSMPUP00000000383 .-------....--...........................RR..................................
Mpf_ENSMPUP00000008997 .LATRASDy...SK...........................KS..................................
Mpf_ENSMPUP00000010040 .TVKLCPD....SE...........................RR..................................
Mpf_ENSMPUP00000007257 .TVTQVKDe...NS...........................ES..................................
Mpf_ENSMPUP00000016774 .LATRASDy...SK...........................RP..................................
Mpf_ENSMPUP00000001960 .SVIHKEKqv..RK...........................KE..................................
Mpf_ENSMPUP00000007610 .QEVSEGRq...SEvfqrypdgvfd................PN..................................
Mpf_ENSMPUP00000017612 .SVSESPR....DP...........................L-..................................
Mpf_ENSMPUP00000007907 .KEIRLGKn...TEtfrnngladqic...............ED..................................
Mpf_ENSMPUP00000014021 .-------....--...........................--..................................
Mpf_ENSMPUP00000008982 .-------....--...........................KK..................................
Mpf_ENSMPUP00000005803 .STVRVQG....DN...........................K-..................................
Mpf_ENSMPUP00000002728 .YKVTEGRq...SEifhrqaeghfd................PS..................................
Mpf_ENSMPUP00000007017 .LVSALED....NGvptgvkgnv..................QG..................................
Mpf_ENSMPUP00000003752 .-------....--...........................--..................................
Mpf_ENSMPUP00000001306 .LVKLPTDp...SG...........................DE..................................
Mpf_ENSMPUP00000005338 .KRWAASP....KS...........................--..................................
Mpf_ENSMPUP00000001689 .IDVVQCP....KM...........................RR..................................
Mpf_ENSMPUP00000010415 .NITYTPKds..KK...........................KK..................................
Mpf_ENSMPUP00000006220 .TLTSPCQdf..GK...........................RM..................................
Mpf_ENSMPUP00000016350 .QVEYSED....QQamvk.......................TP..................................
Mpf_ENSMPUP00000018773 .-------....--...........................--..................................
Mpf_ENSMPUP00000017599 .SVAECQL....MKterp.......................RP..................................
Mpf_ENSMPUP00000016349 .QVEYSED....QQamvk.......................TP..................................
Mpf_ENSMPUP00000015036 .LVDISYSe...TK...........................RR..................................
Mpf_ENSMPUP00000007938 .EMTRSSK....DN...........................K-..................................
Mpf_ENSMPUP00000007257 .KVRKPTQ....EA...........................YQ..................................
Mpf_ENSMPUP00000005203 .-------....--...........................--..................................
Mpf_ENSMPUP00000000650 .KRWAASP....KS...........................--..................................
Mpf_ENSMPUP00000007937 .SVYVVHDsl..FG...........................RP..................................
Mpf_ENSMPUP00000007017 .TITCPCLey..EN...........................RP..................................
Mpf_ENSMPUP00000012780 .HFDTEDS....CG...........................--..................................
Mpf_ENSMPUP00000002522 .-------....--...........................--..................................
Mpf_ENSMPUP00000004905 .TDEVPW-....-Essgd.......................PG..................................
Mpf_ENSMPUP00000011326 .MGVIQNN....KV...........................RR..................................
Mpf_ENSMPUP00000009449 .LATPATHy...TK...........................KP..................................
Mpf_ENSMPUP00000000014 .YDVTEYP....VQ...........................RN..................................
Mpf_ENSMPUP00000012737 .TDVTEYA....VQ...........................RN..................................
Mpf_ENSMPUP00000002136 .SVAQCQL....MKterp.......................RP..................................
Mpf_ENSMPUP00000017782 .TVLDGLP....PStqghh......................WP..................................
Mpf_ENSMPUP00000013550 .LSVEETQ....IK...........................DK..................................
Mpf_ENSMPUP00000017362 .EIIERPS....KK...........................DG..................................
Mpf_ENSMPUP00000006996 .VIGIDDE....DD...........................S-..................................
Mpf_ENSMPUP00000004785 .EEVYYDHl...RSaak........................KRffsfsvvtespnpa....................
Mpf_ENSMPUP00000014164 .SVTYVPK....DSrh.........................KR..................................
Mpf_ENSMPUP00000016592 .TGVVQNN....RL...........................RK..................................
Mpf_ENSMPUP00000000486 .LAVQVDNl...DD...........................CD..................................
Mpf_ENSMPUP00000003712 .TVKHCED....IE...........................RR..................................
Mpf_ENSMPUP00000006850 .EEVYYDH....LRcafkspn....................PR..................................
Mpf_ENSMPUP00000015574 .SVRRCGH....AD...........................--..................................
Mpf_ENSMPUP00000014962 .-------....--...........................--..................................
Mpf_ENSMPUP00000016814 .VCRPLRD....PN...........................--..................................
Mpf_ENSMPUP00000000139 .QVEYSED....QQamlk.......................TP..................................
Mpf_ENSMPUP00000012020 .SVMAVDC....ED...........................RR..................................
Mpf_ENSMPUP00000006069 .----LTEe...SE...........................KV..................................
Mpf_ENSMPUP00000017142 .KVSRPVM....EK...........................VP..................................
Mpf_ENSMPUP00000013991 .ALAESSC....RN...........................LC..................................
Mpf_ENSMPUP00000010353 .-------....-Kevhkrryll..................QP..................................
Mpf_ENSMPUP00000000014 .TDVVDGEgr..TG...........................QK..................................
Mpf_ENSMPUP00000009546 .SKVSIAT....PKqkpk.......................TP..................................
Mpf_ENSMPUP00000012020 .TQFAAHQe...NK...........................RL..................................
Mpf_ENSMPUP00000016751 .SVMAVDC....ED...........................RR..................................
Mpf_ENSMPUP00000000216 .VVDDLPKs...AD...........................LP..................................
Mpf_ENSMPUP00000010854 .NRVMRAA....EEttsn.......................NV..................................
Mpf_ENSMPUP00000016813 .TVDYTDPq...PGleg........................GR..................................
Mpf_ENSMPUP00000002870 sKVSDATKlr..PK...........................AE..................................
Mpf_ENSMPUP00000003651 .HIEWAKEk...SS...........................RK..................................
Mpf_ENSMPUP00000002370 .EVENVDDg...TAdfhssghi...................VV..................................
Mpf_ENSMPUP00000006780 .TVDYTDPh...PGlqg........................GQ..................................
Mpf_ENSMPUP00000002802 .KVVARKR....RDrs.........................LP..................................
Mpf_ENSMPUP00000011336 .EVGPPEAger.PD...........................RR..................................
Mpf_ENSMPUP00000003120 .EIKVHSA....DN...........................TR..................................
Mpf_ENSMPUP00000005803 .ICLAVHK....EDfylntg.....................PI..................................
Mpf_ENSMPUP00000004980 .EIQVHSV....DN...........................TR..................................
Mpf_ENSMPUP00000015621 .QLMKTER....P-...........................KP..................................
Mpf_ENSMPUP00000003141 .--K----....--...........................--..................................
Mpf_ENSMPUP00000013099 .QVKTNPE....EK...........................K-..................................
Mpf_ENSMPUP00000010983 .CSVVPPD....EKifket......................GY..................................
Mpf_ENSMPUP00000004910 .ELIERPS....KK...........................DG..................................
Mpf_ENSMPUP00000016233 .RVIFVTS....--...........................--..................................
Mpf_ENSMPUP00000002953 .-------....--...........................RD..................................
Mpf_ENSMPUP00000011716 .WDIQPPDg...KP...........................KD..................................
Mpf_ENSMPUP00000007767 .TSHQIEP....ANrefca......................RR..................................
Mpf_ENSMPUP00000014585 .GVYEDLP....KGirgnr......................WK..................................
Mpf_ENSMPUP00000014164 .EVAPGFG....PR...........................HP..................................
Mpf_ENSMPUP00000005886 .-------....--...........................--..................................
Mpf_ENSMPUP00000013797 .SVCPLEG....S-...........................RE..................................
Mpf_ENSMPUP00000004108 .VISPSDE....DS...........................--..................................
Mpf_ENSMPUP00000009167 .KEIRPGKn...SKdferakvvhqk................KD..................................
Mpf_ENSMPUP00000016226 .GGCRRANt...TD...........................RP..................................
Mpf_ENSMPUP00000014024 .QVTAGTQa...DS...........................R-..................................
Mpf_ENSMPUP00000008448 .----I--....--...........................--..................................
Mpf_ENSMPUP00000010607 .-----A-....--...........................--..................................
Mpf_ENSMPUP00000015774 .QVRPNPE....EK...........................K-..................................
Mpf_ENSMPUP00000008639 .EAVREGHq...SEglrrfggafp.................PA..................................
Mpf_ENSMPUP00000012941 .TVEMASK....DKss.........................KK..................................
Mpf_ENSMPUP00000016218 .VLEDLQD....GDvrmggsfrgafsnsdk...........AK..................................
Mpf_ENSMPUP00000007001 .EMKLHGP....--...........................HK..................................
Mpf_ENSMPUP00000001986 .IVQSVPEh...PK...........................KE..................................
Mpf_ENSMPUP00000010415 .DVIPGLD....SK...........................HP..................................
Mpf_ENSMPUP00000003836 .KVNEQTL....SF...........................KQ..................................
Mpf_ENSMPUP00000007027 .RIEEVDRs...CDsdedyeaggsrrlls............SH..................................
Mpf_ENSMPUP00000002688 .DNEELNSs...PGknsstmlysrqss..............AN..................................
Mpf_ENSMPUP00000001373 .QVKPNAE....DK...........................KS..................................
Mpf_ENSMPUP00000013700 .VFPSPEE....SEaspqv......................HPfpdheledmkmkisalkseiqkekankgqsraie
Mpf_ENSMPUP00000016589 .-------....--...........................--..................................
Mpf_ENSMPUP00000015325 .VCDRAPS....PKpalsgkeple.................KQ..................................
Mpf_ENSMPUP00000001960 .EVVPDPS....PD...........................HL..................................
Mpf_ENSMPUP00000006310 .-------....--...........................--..................................
Mpf_ENSMPUP00000016747 .LRGAFSNn...ER...........................IK..................................
Mpf_ENSMPUP00000013323 .VMSVKKS....SK...........................--..................................
Mpf_ENSMPUP00000007350 .LVEAREE....PS...........................MP..................................
Mpf_ENSMPUP00000017588 .KEIRPGK....TS...........................RDfdryqedpafrpdqs...................
Mpf_ENSMPUP00000007745 .KAVVTGKd...CPhmkekgalkqnkev.............LE..................................
Mpf_ENSMPUP00000006409 .VFDCKADa...EE...........................G-..................................
Mpf_ENSMPUP00000015574 cTISKRVD....AR...........................QR..................................
Mpf_ENSMPUP00000008365 .SLSWAPK....DKss.........................RK..................................
Mpf_ENSMPUP00000001054 .IVQAVPEh...PK...........................KD..................................
Mpf_ENSMPUP00000017488 .KAIVTGKd...CPhmkeksalkqnkev.............LE..................................
Mpf_ENSMPUP00000005234 .---ELED....QGqt.........................LA..................................
Mpf_ENSMPUP00000013182 .EVVPDVNv...SG...........................QK..................................
Mpf_ENSMPUP00000011513 .C------....--...........................--..................................
Mpf_ENSMPUP00000005385 .-------....--...........................--..................................
Mpf_ENSMPUP00000009077 .TRHCLSN....IS...........................DP..................................
Mpf_ENSMPUP00000001767 .-------....--...........................--..................................
Mpf_ENSMPUP00000007827 .TRRKTDS....IE...........................KR..................................
Mpf_ENSMPUP00000000541 .EKCQDLRal..LK...........................RK..................................
Mpf_ENSMPUP00000001809 .ALAHGRHl...SS...........................RR..................................
Mpf_ENSMPUP00000005803 .KFYLGVK....KKmkpp.......................TS..................................
Mpf_ENSMPUP00000013182 .-------....--...........................--..................................
Mpf_ENSMPUP00000005315 .EKCEELRk...SKsrsk.......................KN..................................
Mpf_ENSMPUP00000014585 .NATFETEk...IG...........................NP..................................
Mpf_ENSMPUP00000015166 .VMSINKK....AQ...........................R-..................................
Mpf_ENSMPUP00000002409 .-------....--...........................--..................................
Mpf_ENSMPUP00000005807 .KIRDVEKgf..MS...........................NK..................................
Mpf_ENSMPUP00000013796 .HVNLEEK....EK...........................QI..................................
Mpf_ENSMPUP00000017782 .NATFQPAk...IG...........................HP..................................
Mpf_ENSMPUP00000019464 .TVELAEAp...VS...........................EE..................................
Mpf_ENSMPUP00000012725 .-------....--...........................--..................................
Mpf_ENSMPUP00000010996 .TRIRAMDkdt.KK...........................KI..................................
Mpf_ENSMPUP00000007938 .KVYLGIR....KKfkpp.......................TP..................................
Mpf_ENSMPUP00000009654 .HDVQPPEg...RS...........................RD..................................
Mpf_ENSMPUP00000005385 .EVTPDVNi...SG...........................QK..................................
Mpf_ENSMPUP00000006310 .EVVPDVNv...AG...........................RK..................................
Mpf_ENSMPUP00000007963 eQVDAGLTf...NKkelq.......................DS..................................
Mpf_ENSMPUP00000002310 .TVKVPGKr...PP...........................RAtsacapisspktnglskdmsslhispnsgnvtsa
Mpf_ENSMPUP00000000486 .QSISVLGn...LE...........................AR..................................
Mpf_ENSMPUP00000007805 .-------....--...........................--..................................
Mpf_ENSMPUP00000010246 .RRIYKRR....HGl..........................MP..................................
Mpf_ENSMPUP00000004460 .SNVKCVTrl..PKet.........................KR..................................
Mpf_ENSMPUP00000014791 .LVEDIPD....SKy..........................IK..................................
Mpf_ENSMPUP00000003154 .VMSIKKK....-A...........................RR..................................
Mpf_ENSMPUP00000005214 .QLHRVFGh...SG...........................GP..................................
Mpf_ENSMPUP00000003932 fSVSQRAD....AK...........................YR..................................
Mpf_ENSMPUP00000008710 .TVKVPGKr...LP...........................RAtpatapgtspranglaserstsqlgggtgapysa
Mpf_ENSMPUP00000005632 .KALLTGKd...CPhvrekgsgkqnkdl.............YE..................................
Mpf_ENSMPUP00000002828 .SFQTVDE....SEa..........................APsiplvldeeldamkikisqikndiqrekrankgs
Mpf_ENSMPUP00000017859 .HVIFVENa...PDt..........................RK..................................
Mpf_ENSMPUP00000013754 .MVQLPDD....PE...........................HP..................................
Mpf_ENSMPUP00000004548 .CVRRKTEs...ID...........................KR..................................
Mpf_ENSMPUP00000000646 .EKLALTT....SG...........................CP..................................
Mpf_ENSMPUP00000004473 .TVSVLDPver.PD...........................SR..................................
Mpf_ENSMPUP00000000402 .NVYYGQDy...RNkykap......................TD..................................
Mpf_ENSMPUP00000007412 .RVQKMEP....SDpgllggggtrsss..............VP..................................
Mpf_ENSMPUP00000004935 .-------....--...........................--..................................
Mpf_ENSMPUP00000011513 .KVEEVDRs...CDsdedyeasgrslls.............TH..................................
Mpf_ENSMPUP00000001759 .IRRKTDS....ID...........................KR..................................
Mpf_ENSMPUP00000008353 .ESVGPAHs...DG...........................R-..................................
Mpf_ENSMPUP00000012083 .NIYYGIQ....CKmrykap.....................TD..................................
Mpf_ENSMPUP00000006956 .TKRHTDS....ID...........................RR..................................
Mpf_ENSMPUP00000014860 .NVYVVTQg...RKlygmp......................TD..................................
Mpf_ENSMPUP00000009647 .HMQLFQN....SY...........................YQ..................................
Mpf_ENSMPUP00000005803 .NVKQVDRt...VK...........................--..................................
Mpf_ENSMPUP00000005109 .MVMMADD....PE...........................HP..................................
Mpf_ENSMPUP00000006149 .KNVARLPk...ST...........................KK..................................
Mpf_ENSMPUP00000001981 .TVKVPGKr...PP...........................RAisafgpsasinglvkdmstvqmgegpeattptps
Mpf_ENSMPUP00000017916 .QFHLFEN....EY...........................YS..................................
Mpf_ENSMPUP00000003318 wTASCVDE....VGegntn......................AL..................................
Mpf_ENSMPUP00000017175 .QVLLFEN....QY...........................YP..................................
Mpf_ENSMPUP00000016038 .AVWRHVG....PGfprkefq....................NN..................................
Mpf_ENSMPUP00000016192 .QVKDLSRk...LQgv.........................PG..................................
Mpf_ENSMPUP00000015325 .TLLEDPEn...TEedakganqdidh...............LD..................................
Mpf_ENSMPUP00000000660 .YVSLAGK....KKhgap.......................TN..................................
Mpf_ENSMPUP00000005493 .-------....--...........................--..................................
Mpf_ENSMPUP00000009754 .KVYLGVK....KKlrpp.......................TC..................................
Mpf_ENSMPUP00000013796 .SVCPLEG....S-...........................RE..................................
Mpf_ENSMPUP00000010667 .-------....--...........................--..................................
Mpf_ENSMPUP00000013126 .VSSLLPS....PPaps........................CR..................................
Mpf_ENSMPUP00000018046 .EESSVFSli..AGkkqysap....................TD..................................
Mpf_ENSMPUP00000006359 .-------....--...........................--..................................
Mpf_ENSMPUP00000015086 .-------....--...........................YP..................................
Mpf_ENSMPUP00000008387 .TLIEEPDa...SDddskgsgqvfgh...............LD..................................
Mpf_ENSMPUP00000015207 .-------....--...........................DM..................................
Mpf_ENSMPUP00000004217 .TEKPVIEl...WK...........................-K..................................
Mpf_ENSMPUP00000015689 .-------....--...........................--..................................
Mpf_ENSMPUP00000015159 dSIEKRVSg...DS...........................--..................................
Mpf_ENSMPUP00000018833 .-------....--...........................--..................................
Mpf_ENSMPUP00000007866 .TRVRAGE....PDqaag.......................RP..................................
Mpf_ENSMPUP00000007938 .SVRETKS....RS...........................--..................................
Mpf_ENSMPUP00000010694 .RFSQYVPg...TDls.........................RQ..................................
Mpf_ENSMPUP00000013131 .ESVECRDi...FQ...........................--..................................
Mpf_ENSMPUP00000000312 .WAEPLSEe...AG...........................GV..................................
Mpf_ENSMPUP00000019132 .KAVECVEs...TG...........................RH..................................
Mpf_ENSMPUP00000015959 .-------....LE...........................EP..................................
Mpf_ENSMPUP00000012612 .MAKHLDS....GA...........................RT..................................
Mpf_ENSMPUP00000007938 .VCLGVSP....PPtdpgdldr...................FP..................................
Mpf_ENSMPUP00000007989 .QAQQVPD....PS...........................GP..................................
Mpf_ENSMPUP00000016156 .-------....--...........................--..................................
Mpf_ENSMPUP00000013721 .KILTSLDqy..LElvgnslpgtssksgtapilkcp.....TQ..................................
Mpf_ENSMPUP00000005447 .FHVRPVT....QGdvyraetee..................IP..................................
Mpf_ENSMPUP00000015768 .TVLTSQR....EYlhlldtlcpvssgehtqeesdpllempVN..................................
Mpf_ENSMPUP00000004215 .LRVAEASge..ASspr........................DT..................................
Mpf_ENSMPUP00000010108 .CSVTGPErr..PKet.........................GL..................................
Mpf_ENSMPUP00000002188 .-------....--...........................NL..................................
Mpf_ENSMPUP00000013446 fHVRPVTQ....TDvyradake...................IP..................................
Mpf_ENSMPUP00000012407 .SDVIHAQs...RD...........................LP..................................
Mpf_ENSMPUP00000017043 .KIKVGKKe...TE...........................TK..................................
Mpf_ENSMPUP00000007898 .KLQEGSS....ED...........................LK..................................
Mpf_ENSMPUP00000017064 .KKVLDIRet..ED...........................CH..................................
Mpf_ENSMPUP00000009754 .NVKEADR....RS...........................--..................................
Mpf_ENSMPUP00000016461 .TVLVPVL....NE...........................TK..................................
Mpf_ENSMPUP00000008230 .VSVVPVSv...ESppep.......................GA..................................
Mpf_ENSMPUP00000001993 .EVGIHGQ....EKmqsvqkmfkcl................PD..................................
Mpf_ENSMPUP00000014500 .NITVEDS....CN...........................--..................................
Mpf_ENSMPUP00000002405 .-------....--...........................QE..................................
Mpf_ENSMPUP00000002933 .SELANTAk...AD...........................VP..................................
Mpf_ENSMPUP00000007268 .-------....--...........................QD..................................
Mpf_ENSMPUP00000010983 .DSVCASDs...PD...........................RP..................................
Mpf_ENSMPUP00000010498 .CGLEPGLpy..EG...........................LA..................................
Mpf_ENSMPUP00000018101 .SSVWLSNf...IPvrrke......................MP..................................
Mpf_ENSMPUP00000002033 .-------....--...........................--..................................
Mpf_ENSMPUP00000010694 .MCKILKD....SDlldr.......................RK..................................
Mpf_ENSMPUP00000008353 .RDILPDTs...LG...........................GP..................................
Mpf_ENSMPUP00000009754 .QELSVQG....DS...........................EN..................................
Mpf_ENSMPUP00000015718 .SDVIHASr...KD...........................IP..................................
Mpf_ENSMPUP00000002358 .SDVIHASr...RD...........................IP..................................
Mpf_ENSMPUP00000005077 .-------....LG...........................QD..................................
Mpf_ENSMPUP00000009107 .QCERPGHq...HG...........................RK..................................
Mpf_ENSMPUP00000016101 .-------....--...........................--..................................
Mpf_ENSMPUP00000011911 .VSVLPADg...EScpk........................DT..................................
Mpf_ENSMPUP00000007938 .SVVSAADt...PD...........................KK..................................
Mpf_ENSMPUP00000009676 .-------....--...........................--..................................
Mpf_ENSMPUP00000005809 .VCTVKST....DS...........................--..................................
Mpf_ENSMPUP00000016410 .KVEEVKK....--...........................HQ..................................
Mpf_ENSMPUP00000006638 .HVSVHSQ....DN...........................KS..................................
Mpf_ENSMPUP00000005803 .TISTVVQn...GE...........................KI..................................
Mpf_ENSMPUP00000010983 .-------....--...........................--..................................
Mpf_ENSMPUP00000000717 .VVSINKQ....DN...........................--..................................
Mpf_ENSMPUP00000002793 .-------....--...........................--..................................
Mpf_ENSMPUP00000007833 .KVEEVKR....RQ...........................HS..................................
Mpf_ENSMPUP00000002271 .-------....--...........................--..................................
Mpf_ENSMPUP00000010974 .-------....--...........................NK..................................
Mpf_ENSMPUP00000010755 .EVRVGKRs...TE...........................AR..................................
Mpf_ENSMPUP00000013112 .-------....--...........................--..................................


                                                                                                    
                                                                                                    
d1wg7a_                .............................................................................
Mpf_ENSMPUP00000000236 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000006133 .............................................................................
Mpf_ENSMPUP00000009494 .............................................................................
Mpf_ENSMPUP00000004093 .............................................................................
Mpf_ENSMPUP00000012215 .............................................................................
Mpf_ENSMPUP00000016175 .............................................................................
Mpf_ENSMPUP00000009909 .............................................................................
Mpf_ENSMPUP00000010977 .............................................................................
Mpf_ENSMPUP00000016638 .............................................................................
Mpf_ENSMPUP00000018612 .............................................................................
Mpf_ENSMPUP00000018966 .............................................................................
Mpf_ENSMPUP00000004660 .............................................................................
Mpf_ENSMPUP00000002149 .............................................................................
Mpf_ENSMPUP00000018066 .............................................................................
Mpf_ENSMPUP00000017958 .............................................................................
Mpf_ENSMPUP00000011450 .............................................................................
Mpf_ENSMPUP00000016402 .............................................................................
Mpf_ENSMPUP00000004951 .............................................................................
Mpf_ENSMPUP00000011363 .............................................................................
Mpf_ENSMPUP00000015445 .............................................................................
Mpf_ENSMPUP00000015195 .............................................................................
Mpf_ENSMPUP00000011751 .............................................................................
Mpf_ENSMPUP00000009831 .............................................................................
Mpf_ENSMPUP00000004111 .............................................................................
Mpf_ENSMPUP00000005349 .............................................................................
Mpf_ENSMPUP00000006137 .............................................................................
Mpf_ENSMPUP00000009095 .............................................................................
Mpf_ENSMPUP00000005832 .............................................................................
Mpf_ENSMPUP00000014567 .............................................................................
Mpf_ENSMPUP00000015198 .............................................................................
Mpf_ENSMPUP00000008441 .............................................................................
Mpf_ENSMPUP00000005146 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000000642 .............................................................................
Mpf_ENSMPUP00000015373 .............................................................................
Mpf_ENSMPUP00000003213 .............................................................................
Mpf_ENSMPUP00000012196 .............................................................................
Mpf_ENSMPUP00000012194 .............................................................................
Mpf_ENSMPUP00000003212 .............................................................................
Mpf_ENSMPUP00000001158 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013386 .............................................................................
Mpf_ENSMPUP00000016712 .............................................................................
Mpf_ENSMPUP00000003302 .............................................................................
Mpf_ENSMPUP00000003768 .............................................................................
Mpf_ENSMPUP00000008012 .............................................................................
Mpf_ENSMPUP00000002625 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000015670 .............................................................................
Mpf_ENSMPUP00000008341 .............................................................................
Mpf_ENSMPUP00000017573 .............................................................................
Mpf_ENSMPUP00000012859 .............................................................................
Mpf_ENSMPUP00000012131 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013200 .............................................................................
Mpf_ENSMPUP00000003522 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000011494 .............................................................................
Mpf_ENSMPUP00000012716 .............................................................................
Mpf_ENSMPUP00000002913 .............................................................................
Mpf_ENSMPUP00000003504 .............................................................................
Mpf_ENSMPUP00000004361 .............................................................................
Mpf_ENSMPUP00000017389 .............................................................................
Mpf_ENSMPUP00000015829 .............................................................................
Mpf_ENSMPUP00000003644 .............................................................................
Mpf_ENSMPUP00000006376 .............................................................................
Mpf_ENSMPUP00000014536 .............................................................................
Mpf_ENSMPUP00000011501 .............................................................................
Mpf_ENSMPUP00000017670 .............................................................................
Mpf_ENSMPUP00000006727 .............................................................................
Mpf_ENSMPUP00000000961 .............................................................................
Mpf_ENSMPUP00000004942 .............................................................................
Mpf_ENSMPUP00000002151 .............................................................................
Mpf_ENSMPUP00000014680 .............................................................................
Mpf_ENSMPUP00000005563 .............................................................................
Mpf_ENSMPUP00000011333 .............................................................................
Mpf_ENSMPUP00000000969 .............................................................................
Mpf_ENSMPUP00000010395 .............................................................................
Mpf_ENSMPUP00000015361 .............................................................................
Mpf_ENSMPUP00000001991 .............................................................................
Mpf_ENSMPUP00000005637 .............................................................................
Mpf_ENSMPUP00000007307 .............................................................................
Mpf_ENSMPUP00000008193 .............................................................................
Mpf_ENSMPUP00000007177 .............................................................................
Mpf_ENSMPUP00000010360 .............................................................................
Mpf_ENSMPUP00000010611 .............................................................................
Mpf_ENSMPUP00000007161 .............................................................................
Mpf_ENSMPUP00000006134 .............................................................................
Mpf_ENSMPUP00000004983 .............................................................................
Mpf_ENSMPUP00000001920 .............................................................................
Mpf_ENSMPUP00000013542 .............................................................................
Mpf_ENSMPUP00000008337 .............................................................................
Mpf_ENSMPUP00000013626 .............................................................................
Mpf_ENSMPUP00000001949 .............................................................................
Mpf_ENSMPUP00000017721 .............................................................................
Mpf_ENSMPUP00000001109 .............................................................................
Mpf_ENSMPUP00000001935 .............................................................................
Mpf_ENSMPUP00000006252 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000005196 .............................................................................
Mpf_ENSMPUP00000012589 .............................................................................
Mpf_ENSMPUP00000010571 .............................................................................
Mpf_ENSMPUP00000011589 .............................................................................
Mpf_ENSMPUP00000005676 .............................................................................
Mpf_ENSMPUP00000002533 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000013399 .............................................................................
Mpf_ENSMPUP00000010530 .............................................................................
Mpf_ENSMPUP00000006089 .............................................................................
Mpf_ENSMPUP00000016498 .............................................................................
Mpf_ENSMPUP00000007327 .............................................................................
Mpf_ENSMPUP00000001749 .............................................................................
Mpf_ENSMPUP00000016475 .............................................................................
Mpf_ENSMPUP00000013206 .............................................................................
Mpf_ENSMPUP00000006140 .............................................................................
Mpf_ENSMPUP00000005780 .............................................................................
Mpf_ENSMPUP00000001869 .............................................................................
Mpf_ENSMPUP00000012475 .............................................................................
Mpf_ENSMPUP00000008316 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000017717 .............................................................................
Mpf_ENSMPUP00000010272 .............................................................................
Mpf_ENSMPUP00000003964 .............................................................................
Mpf_ENSMPUP00000017478 .............................................................................
Mpf_ENSMPUP00000010168 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000000151 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000007012 .............................................................................
Mpf_ENSMPUP00000012096 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000003498 .............................................................................
Mpf_ENSMPUP00000006723 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000015653 .............................................................................
Mpf_ENSMPUP00000014937 .............................................................................
Mpf_ENSMPUP00000006713 .............................................................................
Mpf_ENSMPUP00000005370 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000011052 .............................................................................
Mpf_ENSMPUP00000000930 .............................................................................
Mpf_ENSMPUP00000016865 .............................................................................
Mpf_ENSMPUP00000000090 .............................................................................
Mpf_ENSMPUP00000012035 .............................................................................
Mpf_ENSMPUP00000009068 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000013402 .............................................................................
Mpf_ENSMPUP00000012726 .............................................................................
Mpf_ENSMPUP00000010329 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000013895 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000017452 .............................................................................
Mpf_ENSMPUP00000004281 .............................................................................
Mpf_ENSMPUP00000017577 .............................................................................
Mpf_ENSMPUP00000004977 .............................................................................
Mpf_ENSMPUP00000017884 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000000871 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000001861 .............................................................................
Mpf_ENSMPUP00000008418 .............................................................................
Mpf_ENSMPUP00000006249 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000015858 .............................................................................
Mpf_ENSMPUP00000002835 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000137 .............................................................................
Mpf_ENSMPUP00000001907 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000001742 .............................................................................
Mpf_ENSMPUP00000000172 .............................................................................
Mpf_ENSMPUP00000005480 .............................................................................
Mpf_ENSMPUP00000018515 .............................................................................
Mpf_ENSMPUP00000009502 .............................................................................
Mpf_ENSMPUP00000013672 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000001410 .............................................................................
Mpf_ENSMPUP00000003424 .............................................................................
Mpf_ENSMPUP00000007040 .............................................................................
Mpf_ENSMPUP00000019493 .............................................................................
Mpf_ENSMPUP00000018830 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000012786 .............................................................................
Mpf_ENSMPUP00000014114 .............................................................................
Mpf_ENSMPUP00000007256 .............................................................................
Mpf_ENSMPUP00000005608 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000016435 .............................................................................
Mpf_ENSMPUP00000001167 .............................................................................
Mpf_ENSMPUP00000001585 .............................................................................
Mpf_ENSMPUP00000002351 .............................................................................
Mpf_ENSMPUP00000011499 .............................................................................
Mpf_ENSMPUP00000005375 .............................................................................
Mpf_ENSMPUP00000015986 .............................................................................
Mpf_ENSMPUP00000004747 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000002257 .............................................................................
Mpf_ENSMPUP00000006734 .............................................................................
Mpf_ENSMPUP00000003502 .............................................................................
Mpf_ENSMPUP00000011019 .............................................................................
Mpf_ENSMPUP00000003673 .............................................................................
Mpf_ENSMPUP00000000383 .............................................................................
Mpf_ENSMPUP00000008997 .............................................................................
Mpf_ENSMPUP00000010040 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000016774 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000007610 .............................................................................
Mpf_ENSMPUP00000017612 .............................................................................
Mpf_ENSMPUP00000007907 .............................................................................
Mpf_ENSMPUP00000014021 .............................................................................
Mpf_ENSMPUP00000008982 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000002728 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000003752 .............................................................................
Mpf_ENSMPUP00000001306 .............................................................................
Mpf_ENSMPUP00000005338 .............................................................................
Mpf_ENSMPUP00000001689 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000006220 .............................................................................
Mpf_ENSMPUP00000016350 .............................................................................
Mpf_ENSMPUP00000018773 .............................................................................
Mpf_ENSMPUP00000017599 .............................................................................
Mpf_ENSMPUP00000016349 .............................................................................
Mpf_ENSMPUP00000015036 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007257 .............................................................................
Mpf_ENSMPUP00000005203 .............................................................................
Mpf_ENSMPUP00000000650 .............................................................................
Mpf_ENSMPUP00000007937 .............................................................................
Mpf_ENSMPUP00000007017 .............................................................................
Mpf_ENSMPUP00000012780 .............................................................................
Mpf_ENSMPUP00000002522 .............................................................................
Mpf_ENSMPUP00000004905 .............................................................................
Mpf_ENSMPUP00000011326 .............................................................................
Mpf_ENSMPUP00000009449 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000012737 .............................................................................
Mpf_ENSMPUP00000002136 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000013550 .............................................................................
Mpf_ENSMPUP00000017362 .............................................................................
Mpf_ENSMPUP00000006996 .............................................................................
Mpf_ENSMPUP00000004785 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000016592 .............................................................................
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000003712 .............................................................................
Mpf_ENSMPUP00000006850 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000014962 .............................................................................
Mpf_ENSMPUP00000016814 .............................................................................
Mpf_ENSMPUP00000000139 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000006069 .............................................................................
Mpf_ENSMPUP00000017142 .............................................................................
Mpf_ENSMPUP00000013991 .............................................................................
Mpf_ENSMPUP00000010353 .............................................................................
Mpf_ENSMPUP00000000014 .............................................................................
Mpf_ENSMPUP00000009546 .............................................................................
Mpf_ENSMPUP00000012020 .............................................................................
Mpf_ENSMPUP00000016751 .............................................................................
Mpf_ENSMPUP00000000216 .............................................................................
Mpf_ENSMPUP00000010854 .............................................................................
Mpf_ENSMPUP00000016813 .............................................................................
Mpf_ENSMPUP00000002870 .............................................................................
Mpf_ENSMPUP00000003651 .............................................................................
Mpf_ENSMPUP00000002370 .............................................................................
Mpf_ENSMPUP00000006780 .............................................................................
Mpf_ENSMPUP00000002802 .............................................................................
Mpf_ENSMPUP00000011336 .............................................................................
Mpf_ENSMPUP00000003120 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000004980 .............................................................................
Mpf_ENSMPUP00000015621 .............................................................................
Mpf_ENSMPUP00000003141 .............................................................................
Mpf_ENSMPUP00000013099 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000004910 .............................................................................
Mpf_ENSMPUP00000016233 .............................................................................
Mpf_ENSMPUP00000002953 .............................................................................
Mpf_ENSMPUP00000011716 .............................................................................
Mpf_ENSMPUP00000007767 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000014164 .............................................................................
Mpf_ENSMPUP00000005886 .............................................................................
Mpf_ENSMPUP00000013797 .............................................................................
Mpf_ENSMPUP00000004108 .............................................................................
Mpf_ENSMPUP00000009167 .............................................................................
Mpf_ENSMPUP00000016226 .............................................................................
Mpf_ENSMPUP00000014024 .............................................................................
Mpf_ENSMPUP00000008448 .............................................................................
Mpf_ENSMPUP00000010607 .............................................................................
Mpf_ENSMPUP00000015774 .............................................................................
Mpf_ENSMPUP00000008639 .............................................................................
Mpf_ENSMPUP00000012941 .............................................................................
Mpf_ENSMPUP00000016218 .............................................................................
Mpf_ENSMPUP00000007001 .............................................................................
Mpf_ENSMPUP00000001986 .............................................................................
Mpf_ENSMPUP00000010415 .............................................................................
Mpf_ENSMPUP00000003836 .............................................................................
Mpf_ENSMPUP00000007027 .............................................................................
Mpf_ENSMPUP00000002688 .............................................................................
Mpf_ENSMPUP00000001373 .............................................................................
Mpf_ENSMPUP00000013700 rlkkkmfenefllllnspt..........................................................
Mpf_ENSMPUP00000016589 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000001960 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000016747 .............................................................................
Mpf_ENSMPUP00000013323 .............................................................................
Mpf_ENSMPUP00000007350 .............................................................................
Mpf_ENSMPUP00000017588 .............................................................................
Mpf_ENSMPUP00000007745 .............................................................................
Mpf_ENSMPUP00000006409 .............................................................................
Mpf_ENSMPUP00000015574 .............................................................................
Mpf_ENSMPUP00000008365 .............................................................................
Mpf_ENSMPUP00000001054 .............................................................................
Mpf_ENSMPUP00000017488 .............................................................................
Mpf_ENSMPUP00000005234 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000009077 .............................................................................
Mpf_ENSMPUP00000001767 .............................................................................
Mpf_ENSMPUP00000007827 .............................................................................
Mpf_ENSMPUP00000000541 .............................................................................
Mpf_ENSMPUP00000001809 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000013182 .............................................................................
Mpf_ENSMPUP00000005315 .............................................................................
Mpf_ENSMPUP00000014585 .............................................................................
Mpf_ENSMPUP00000015166 .............................................................................
Mpf_ENSMPUP00000002409 .............................................................................
Mpf_ENSMPUP00000005807 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000017782 .............................................................................
Mpf_ENSMPUP00000019464 .............................................................................
Mpf_ENSMPUP00000012725 .............................................................................
Mpf_ENSMPUP00000010996 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009654 .............................................................................
Mpf_ENSMPUP00000005385 .............................................................................
Mpf_ENSMPUP00000006310 .............................................................................
Mpf_ENSMPUP00000007963 .............................................................................
Mpf_ENSMPUP00000002310 sgsqmasgislgsfgsrpdgmqqrsysvssadqwseatviansaissdtglgdsvcsspsissttspkldpppspha
Mpf_ENSMPUP00000000486 .............................................................................
Mpf_ENSMPUP00000007805 .............................................................................
Mpf_ENSMPUP00000010246 .............................................................................
Mpf_ENSMPUP00000004460 .............................................................................
Mpf_ENSMPUP00000014791 .............................................................................
Mpf_ENSMPUP00000003154 .............................................................................
Mpf_ENSMPUP00000005214 .............................................................................
Mpf_ENSMPUP00000003932 .............................................................................
Mpf_ENSMPUP00000008710 snpawagprpeglhqrscsvssadqwsdalppasgpaevlssspklepppsphsnrkkhrrkkstgtprpdgpssaa
Mpf_ENSMPUP00000005632 .............................................................................
Mpf_ENSMPUP00000002828 kaierlkkklseqesllllmsps......................................................
Mpf_ENSMPUP00000017859 .............................................................................
Mpf_ENSMPUP00000013754 .............................................................................
Mpf_ENSMPUP00000004548 .............................................................................
Mpf_ENSMPUP00000000646 .............................................................................
Mpf_ENSMPUP00000004473 .............................................................................
Mpf_ENSMPUP00000000402 .............................................................................
Mpf_ENSMPUP00000007412 .............................................................................
Mpf_ENSMPUP00000004935 .............................................................................
Mpf_ENSMPUP00000011513 .............................................................................
Mpf_ENSMPUP00000001759 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000012083 .............................................................................
Mpf_ENSMPUP00000006956 .............................................................................
Mpf_ENSMPUP00000014860 .............................................................................
Mpf_ENSMPUP00000009647 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000005109 .............................................................................
Mpf_ENSMPUP00000006149 .............................................................................
Mpf_ENSMPUP00000001981 pspspsslqpppdqtskhllkpdrnlaralstdctpsgdlsplsrepppspmvkkqrrkklttpsktegsagqaeee
Mpf_ENSMPUP00000017916 .............................................................................
Mpf_ENSMPUP00000003318 .............................................................................
Mpf_ENSMPUP00000017175 .............................................................................
Mpf_ENSMPUP00000016038 .............................................................................
Mpf_ENSMPUP00000016192 .............................................................................
Mpf_ENSMPUP00000015325 .............................................................................
Mpf_ENSMPUP00000000660 .............................................................................
Mpf_ENSMPUP00000005493 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000013796 .............................................................................
Mpf_ENSMPUP00000010667 .............................................................................
Mpf_ENSMPUP00000013126 .............................................................................
Mpf_ENSMPUP00000018046 .............................................................................
Mpf_ENSMPUP00000006359 .............................................................................
Mpf_ENSMPUP00000015086 .............................................................................
Mpf_ENSMPUP00000008387 .............................................................................
Mpf_ENSMPUP00000015207 .............................................................................
Mpf_ENSMPUP00000004217 .............................................................................
Mpf_ENSMPUP00000015689 .............................................................................
Mpf_ENSMPUP00000015159 .............................................................................
Mpf_ENSMPUP00000018833 .............................................................................
Mpf_ENSMPUP00000007866 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000013131 .............................................................................
Mpf_ENSMPUP00000000312 .............................................................................
Mpf_ENSMPUP00000019132 .............................................................................
Mpf_ENSMPUP00000015959 .............................................................................
Mpf_ENSMPUP00000012612 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000007989 .............................................................................
Mpf_ENSMPUP00000016156 .............................................................................
Mpf_ENSMPUP00000013721 .............................................................................
Mpf_ENSMPUP00000005447 .............................................................................
Mpf_ENSMPUP00000015768 .............................................................................
Mpf_ENSMPUP00000004215 .............................................................................
Mpf_ENSMPUP00000010108 .............................................................................
Mpf_ENSMPUP00000002188 .............................................................................
Mpf_ENSMPUP00000013446 .............................................................................
Mpf_ENSMPUP00000012407 .............................................................................
Mpf_ENSMPUP00000017043 .............................................................................
Mpf_ENSMPUP00000007898 .............................................................................
Mpf_ENSMPUP00000017064 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000016461 .............................................................................
Mpf_ENSMPUP00000008230 .............................................................................
Mpf_ENSMPUP00000001993 .............................................................................
Mpf_ENSMPUP00000014500 .............................................................................
Mpf_ENSMPUP00000002405 .............................................................................
Mpf_ENSMPUP00000002933 .............................................................................
Mpf_ENSMPUP00000007268 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000010498 .............................................................................
Mpf_ENSMPUP00000018101 .............................................................................
Mpf_ENSMPUP00000002033 .............................................................................
Mpf_ENSMPUP00000010694 .............................................................................
Mpf_ENSMPUP00000008353 .............................................................................
Mpf_ENSMPUP00000009754 .............................................................................
Mpf_ENSMPUP00000015718 .............................................................................
Mpf_ENSMPUP00000002358 .............................................................................
Mpf_ENSMPUP00000005077 .............................................................................
Mpf_ENSMPUP00000009107 .............................................................................
Mpf_ENSMPUP00000016101 .............................................................................
Mpf_ENSMPUP00000011911 .............................................................................
Mpf_ENSMPUP00000007938 .............................................................................
Mpf_ENSMPUP00000009676 .............................................................................
Mpf_ENSMPUP00000005809 .............................................................................
Mpf_ENSMPUP00000016410 .............................................................................
Mpf_ENSMPUP00000006638 .............................................................................
Mpf_ENSMPUP00000005803 .............................................................................
Mpf_ENSMPUP00000010983 .............................................................................
Mpf_ENSMPUP00000000717 .............................................................................
Mpf_ENSMPUP00000002793 .............................................................................
Mpf_ENSMPUP00000007833 .............................................................................
Mpf_ENSMPUP00000002271 .............................................................................
Mpf_ENSMPUP00000010974 .............................................................................
Mpf_ENSMPUP00000010755 .............................................................................
Mpf_ENSMPUP00000013112 .............................................................................


                                                   90                                               
                                                    |                                               
d1wg7a_                .............................FA..FEL.........................................
Mpf_ENSMPUP00000000236 .............................FD..FEI.........................................
Mpf_ENSMPUP00000001054 .............................AV..CEI.........................................
Mpf_ENSMPUP00000001986 .............................SV..WEL.........................................
Mpf_ENSMPUP00000006133 .............................--..---.........................................
Mpf_ENSMPUP00000009494 .............................--..---.........................................
Mpf_ENSMPUP00000004093 .............................--..---.........................................
Mpf_ENSMPUP00000012215 .............................--..---.........................................
Mpf_ENSMPUP00000016175 .............................FV..IRI.........................................
Mpf_ENSMPUP00000009909 .............................--..---.........................................
Mpf_ENSMPUP00000010977 .............................--..---.........................................
Mpf_ENSMPUP00000016638 .............................FV..IRI.........................................
Mpf_ENSMPUP00000018612 .............................--..---.........................................
Mpf_ENSMPUP00000018966 .............................--..---.........................................
Mpf_ENSMPUP00000004660 .............................CC..FEI.........................................
Mpf_ENSMPUP00000002149 .............................YP..FQV.........................................
Mpf_ENSMPUP00000018066 .............................--..---.........................................
Mpf_ENSMPUP00000017958 .............................H-..---.........................................
Mpf_ENSMPUP00000011450 .............................SI..LAL.........................................
Mpf_ENSMPUP00000016402 .............................--..---.........................................
Mpf_ENSMPUP00000004951 .............................--..---.........................................
Mpf_ENSMPUP00000011363 .............................--..---.........................................
Mpf_ENSMPUP00000015445 .............................MT..FTK.........................................
Mpf_ENSMPUP00000015195 .............................SC..FEL.........................................
Mpf_ENSMPUP00000011751 .............................NA..FRL.........................................
Mpf_ENSMPUP00000009831 .............................NA..FKL.........................................
Mpf_ENSMPUP00000004111 .............................--..---.........................................
Mpf_ENSMPUP00000005349 .............................YP..FQV.........................................
Mpf_ENSMPUP00000006137 .............................--..---.........................................
Mpf_ENSMPUP00000009095 .............................NM..FQV.........................................
Mpf_ENSMPUP00000005832 .............................--..-R-.........................................
Mpf_ENSMPUP00000014567 .............................--..---.........................................
Mpf_ENSMPUP00000015198 .............................-T..FFV.........................................
Mpf_ENSMPUP00000008441 .............................--..---.........................................
Mpf_ENSMPUP00000005146 .............................--..FVI.........................................
Mpf_ENSMPUP00000010667 .............................--..---.........................................
Mpf_ENSMPUP00000000642 .............................NA..FKL.........................................
Mpf_ENSMPUP00000015373 .............................--..---.........................................
Mpf_ENSMPUP00000003213 .............................--..---.........................................
Mpf_ENSMPUP00000012196 .............................IS..FCA.........................................
Mpf_ENSMPUP00000012194 .............................--..---.........................................
Mpf_ENSMPUP00000003212 .............................--..---.........................................
Mpf_ENSMPUP00000001158 .............................--..FVI.........................................
Mpf_ENSMPUP00000010667 .............................--..---.........................................
Mpf_ENSMPUP00000013386 .............................YP..FQV.........................................
Mpf_ENSMPUP00000016712 .............................--..---.........................................
Mpf_ENSMPUP00000003302 .............................--..FVI.........................................
Mpf_ENSMPUP00000003768 .............................--..---.........................................
Mpf_ENSMPUP00000008012 .............................--..---.........................................
Mpf_ENSMPUP00000002625 .............................YP..FQI.........................................
Mpf_ENSMPUP00000010667 .............................--..---.........................................
Mpf_ENSMPUP00000006140 .............................FA..FIM.........................................
Mpf_ENSMPUP00000015670 .............................--..---.........................................
Mpf_ENSMPUP00000008341 .............................DV..FNM.........................................
Mpf_ENSMPUP00000017573 .............................--..---.........................................
Mpf_ENSMPUP00000012859 .............................--..---.........................................
Mpf_ENSMPUP00000012131 .............................NM..FQV.........................................
Mpf_ENSMPUP00000000172 .............................--..---.........................................
Mpf_ENSMPUP00000013200 .............................--..FTI.........................................
Mpf_ENSMPUP00000003522 .............................-F..FVI.........................................
Mpf_ENSMPUP00000011499 .............................--..---.........................................
Mpf_ENSMPUP00000011494 .............................YG..LDI.........................................
Mpf_ENSMPUP00000012716 .............................CL..FLI.........................................
Mpf_ENSMPUP00000002913 .............................--..---.........................................
Mpf_ENSMPUP00000003504 .............................CM..FCV.........................................
Mpf_ENSMPUP00000004361 .............................NT..FRV.........................................
Mpf_ENSMPUP00000017389 .............................--..---.........................................
Mpf_ENSMPUP00000015829 .............................NT..FVL.........................................
Mpf_ENSMPUP00000003644 .............................--..---.........................................
Mpf_ENSMPUP00000006376 .............................--..---.........................................
Mpf_ENSMPUP00000014536 .............................--..---.........................................
Mpf_ENSMPUP00000011501 .............................CG..IEI.........................................
Mpf_ENSMPUP00000017670 .............................--..---.........................................
Mpf_ENSMPUP00000006727 .............................--..---.........................................
Mpf_ENSMPUP00000000961 .............................--..---.........................................
Mpf_ENSMPUP00000004942 .............................--..---.........................................
Mpf_ENSMPUP00000002151 .............................--..---.........................................
Mpf_ENSMPUP00000014680 .............................--..---.........................................
Mpf_ENSMPUP00000005563 .............................AL..FVI.........................................
Mpf_ENSMPUP00000011333 .............................YA..FKA.........................................
Mpf_ENSMPUP00000000969 .............................FV..FRL.........................................
Mpf_ENSMPUP00000010395 .............................HA..FEI.........................................
Mpf_ENSMPUP00000015361 .............................--..---.........................................
Mpf_ENSMPUP00000001991 .............................--..---.........................................
Mpf_ENSMPUP00000005637 .............................HF..FQL.........................................
Mpf_ENSMPUP00000007307 .............................H-..---.........................................
Mpf_ENSMPUP00000008193 .............................--..---.........................................
Mpf_ENSMPUP00000007177 .............................AF..YVL.........................................
Mpf_ENSMPUP00000010360 .............................--..FEI.........................................
Mpf_ENSMPUP00000010611 .............................HV..FKL.........................................
Mpf_ENSMPUP00000007161 .............................RL..IEL.........................................
Mpf_ENSMPUP00000006134 .............................--..---.........................................
Mpf_ENSMPUP00000004983 .............................NA..FEL.........................................
Mpf_ENSMPUP00000001920 .............................GM..LQL.........................................
Mpf_ENSMPUP00000013542 .............................--..-R-.........................................
Mpf_ENSMPUP00000008337 .............................FL..ISA.........................................
Mpf_ENSMPUP00000013626 .............................--..---.........................................
Mpf_ENSMPUP00000001949 .............................HA..FKI.........................................
Mpf_ENSMPUP00000017721 .............................RY..LEI.........................................
Mpf_ENSMPUP00000001109 .............................--..LEI.........................................
Mpf_ENSMPUP00000001935 .............................HC..---.........................................
Mpf_ENSMPUP00000006252 .............................--..---.........................................
Mpf_ENSMPUP00000005676 .............................--..---.........................................
Mpf_ENSMPUP00000005196 .............................HC..FEI.........................................
Mpf_ENSMPUP00000012589 .............................FE..LRV.........................................
Mpf_ENSMPUP00000010571 .............................--..---.........................................
Mpf_ENSMPUP00000011589 .............................HT..FKVttcwvdeagagpthclspqa.....................
Mpf_ENSMPUP00000005676 .............................--..---.........................................
Mpf_ENSMPUP00000002533 .............................HV..MQV.........................................
Mpf_ENSMPUP00000004215 .............................--..---.........................................
Mpf_ENSMPUP00000013399 .............................--..---.........................................
Mpf_ENSMPUP00000010530 .............................NA..FEI.........................................
Mpf_ENSMPUP00000006089 .............................--..FEI.........................................
Mpf_ENSMPUP00000016498 .............................--..---.........................................
Mpf_ENSMPUP00000007327 .............................--..---.........................................
Mpf_ENSMPUP00000001749 .............................--..FEI.........................................
Mpf_ENSMPUP00000016475 .............................NC..FEL.........................................
Mpf_ENSMPUP00000013206 .............................YS..FKA.........................................
Mpf_ENSMPUP00000006140 .............................FA..YVA.........................................
Mpf_ENSMPUP00000005780 .............................-M..FLI.........................................
Mpf_ENSMPUP00000001869 .............................NT..FEI.........................................
Mpf_ENSMPUP00000012475 .............................NC..FEL.........................................
Mpf_ENSMPUP00000008316 .............................FA..LEL.........................................
Mpf_ENSMPUP00000001167 .............................--..---.........................................
Mpf_ENSMPUP00000008230 .............................--..---.........................................
Mpf_ENSMPUP00000017717 .............................P-..---.........................................
Mpf_ENSMPUP00000010272 .............................--..FEI.........................................
Mpf_ENSMPUP00000003964 .............................NC..FEL.........................................
Mpf_ENSMPUP00000017478 .............................NG..WKI.........................................
Mpf_ENSMPUP00000010168 .............................HC..FEI.........................................
Mpf_ENSMPUP00000009546 .............................NL..FEI.........................................
Mpf_ENSMPUP00000002870 .............................NL..FEI.........................................
Mpf_ENSMPUP00000000151 .............................LC..FEL.........................................
Mpf_ENSMPUP00000000216 .............................HT..FQV.........................................
Mpf_ENSMPUP00000007012 .............................HM..FLL.........................................
Mpf_ENSMPUP00000012096 .............................YG..FYL.........................................
Mpf_ENSMPUP00000004281 .............................CK..FAL.........................................
Mpf_ENSMPUP00000004460 .............................--..---.........................................
Mpf_ENSMPUP00000011499 .............................YV..FKL.........................................
Mpf_ENSMPUP00000003498 .............................FT..FTA.........................................
Mpf_ENSMPUP00000006723 .............................HV..FKL.........................................
Mpf_ENSMPUP00000006149 .............................--..---.........................................
Mpf_ENSMPUP00000011052 .............................CK..FAL.........................................
Mpf_ENSMPUP00000015653 .............................YV..FQL.........................................
Mpf_ENSMPUP00000014937 .............................--..---.........................................
Mpf_ENSMPUP00000006713 .............................LC..FTV.........................................
Mpf_ENSMPUP00000005370 .............................HC..FEI.........................................
Mpf_ENSMPUP00000017142 .............................PI..FHL.........................................
Mpf_ENSMPUP00000011052 .............................CK..FAL.........................................
Mpf_ENSMPUP00000000930 .............................--..---.........................................
Mpf_ENSMPUP00000016865 .............................--..---.........................................
Mpf_ENSMPUP00000000090 .............................YG..FYL.........................................
Mpf_ENSMPUP00000012035 .............................NV..FRL.........................................
Mpf_ENSMPUP00000009068 .............................HL..FEI.........................................
Mpf_ENSMPUP00000000172 .............................HV..FKL.........................................
Mpf_ENSMPUP00000013402 .............................--..---.........................................
Mpf_ENSMPUP00000012726 .............................NT..FVV.........................................
Mpf_ENSMPUP00000010329 .............................LS..FSV.........................................
Mpf_ENSMPUP00000005886 .............................--..---.........................................
Mpf_ENSMPUP00000011911 .............................--..---.........................................
Mpf_ENSMPUP00000013895 .............................PV..FHI.........................................
Mpf_ENSMPUP00000009754 .............................--..FEV.........................................
Mpf_ENSMPUP00000017452 .............................FL..ISM.........................................
Mpf_ENSMPUP00000004281 .............................CK..FAL.........................................
Mpf_ENSMPUP00000017577 .............................HV..FKL.........................................
Mpf_ENSMPUP00000004977 .............................-M..FLI.........................................
Mpf_ENSMPUP00000017884 .............................--..---.........................................
Mpf_ENSMPUP00000007027 .............................-T..FQL.........................................
Mpf_ENSMPUP00000012725 .............................AF..FDL.........................................
Mpf_ENSMPUP00000000871 .............................QS..LSI.........................................
Mpf_ENSMPUP00000006220 .............................NL..FEI.........................................
Mpf_ENSMPUP00000008418 .............................--..---.........................................
Mpf_ENSMPUP00000003932 .............................--..---.........................................
Mpf_ENSMPUP00000001861 .............................--..F--.........................................
Mpf_ENSMPUP00000008418 .............................FA..FVA.........................................
Mpf_ENSMPUP00000006249 .............................FV..FEV.........................................
Mpf_ENSMPUP00000003836 .............................FV..FNC.........................................
Mpf_ENSMPUP00000015858 .............................HV..MQV.........................................
Mpf_ENSMPUP00000002835 .............................RC..FSV.........................................
Mpf_ENSMPUP00000004473 .............................PT..FII.........................................
Mpf_ENSMPUP00000000137 .............................YM..AKA.........................................
Mpf_ENSMPUP00000001907 .............................CR..FAL.........................................
Mpf_ENSMPUP00000014024 .............................HS..FLV.........................................
Mpf_ENSMPUP00000001742 .............................NS..FTI.........................................
Mpf_ENSMPUP00000000172 .............................HC..FTI.........................................
Mpf_ENSMPUP00000005480 .............................NS..FTV.........................................
Mpf_ENSMPUP00000018515 .............................NG..WLI.........................................
Mpf_ENSMPUP00000009502 .............................NC..FCL.........................................
Mpf_ENSMPUP00000013672 .............................--..---.........................................
Mpf_ENSMPUP00000011336 .............................RT..FLV.........................................
Mpf_ENSMPUP00000001410 .............................CA..FSV.........................................
Mpf_ENSMPUP00000003424 .............................HV..FKL.........................................
Mpf_ENSMPUP00000007040 .............................--..---.........................................
Mpf_ENSMPUP00000019493 .............................DM..FKL.........................................
Mpf_ENSMPUP00000018830 .............................NR..WMI.........................................
Mpf_ENSMPUP00000003141 .............................--..---.........................................
Mpf_ENSMPUP00000010983 .............................NG..IDI.........................................
Mpf_ENSMPUP00000010498 .............................--..---.........................................
Mpf_ENSMPUP00000012786 .............................NV..LKL.........................................
Mpf_ENSMPUP00000014114 .............................FC..FEV.........................................
Mpf_ENSMPUP00000007256 .............................--..---.........................................
Mpf_ENSMPUP00000005608 .............................--..FDI.........................................
Mpf_ENSMPUP00000002033 .............................AF..FDV.........................................
Mpf_ENSMPUP00000016751 .............................FG..FVL.........................................
Mpf_ENSMPUP00000016435 .............................QG..FTI.........................................
Mpf_ENSMPUP00000001167 .............................HL..VAL.........................................
Mpf_ENSMPUP00000001585 .............................NCakFTL.........................................
Mpf_ENSMPUP00000002351 .............................--..FEI.........................................
Mpf_ENSMPUP00000011499 .............................HC..LTL.........................................
Mpf_ENSMPUP00000005375 .............................--..---.........................................
Mpf_ENSMPUP00000015986 .............................--..---.........................................
Mpf_ENSMPUP00000004747 .............................--..---.........................................
Mpf_ENSMPUP00000009754 .............................HT..FEV.........................................
Mpf_ENSMPUP00000002257 .............................HA..FQT.........................................
Mpf_ENSMPUP00000006734 .............................-S..FLL.........................................
Mpf_ENSMPUP00000003502 .............................WT..---.........................................
Mpf_ENSMPUP00000011019 .............................--..---.........................................
Mpf_ENSMPUP00000003673 .............................KC..LLL.........................................
Mpf_ENSMPUP00000000383 .............................SA..LEI.........................................
Mpf_ENSMPUP00000008997 .............................NV..LKL.........................................
Mpf_ENSMPUP00000010040 .............................FC..FEV.........................................
Mpf_ENSMPUP00000007257 .............................RV..FQL.........................................
Mpf_ENSMPUP00000016774 .............................HV..FYL.........................................
Mpf_ENSMPUP00000001960 .............................HK..LKI.........................................
Mpf_ENSMPUP00000007610 .............................CC..FSI.........................................
Mpf_ENSMPUP00000017612 .............................-G..FKV.........................................
Mpf_ENSMPUP00000007907 .............................SA..FSI.........................................
Mpf_ENSMPUP00000014021 .............................--..F--.........................................
Mpf_ENSMPUP00000008982 .............................--..FTI.........................................
Mpf_ENSMPUP00000005803 .............................--..FEV.........................................
Mpf_ENSMPUP00000002728 .............................CC..FTI.........................................
Mpf_ENSMPUP00000007017 .............................NL..FKV.........................................
Mpf_ENSMPUP00000003752 .............................-K..---.........................................
Mpf_ENSMPUP00000001306 .............................PI..FHI.........................................
Mpf_ENSMPUP00000005338 .............................--..FTL.........................................
Mpf_ENSMPUP00000001689 .............................HA..FEL.........................................
Mpf_ENSMPUP00000010415 .............................HE..LKI.........................................
Mpf_ENSMPUP00000006220 .............................FV..FKI.........................................
Mpf_ENSMPUP00000016350 .............................NI..FAV.........................................
Mpf_ENSMPUP00000018773 .............................--..---.........................................
Mpf_ENSMPUP00000017599 .............................NT..FVI.........................................
Mpf_ENSMPUP00000016349 .............................NI..FAV.........................................
Mpf_ENSMPUP00000015036 .............................HV..FRL.........................................
Mpf_ENSMPUP00000007938 .............................--..FQV.........................................
Mpf_ENSMPUP00000007257 .............................NE..LKI.........................................
Mpf_ENSMPUP00000005203 .............................--..---.........................................
Mpf_ENSMPUP00000000650 .............................--..FTL.........................................
Mpf_ENSMPUP00000007937 .............................NC..FQI.........................................
Mpf_ENSMPUP00000007017 .............................LL..IKL.........................................
Mpf_ENSMPUP00000012780 .............................--..IVL.........................................
Mpf_ENSMPUP00000002522 .............................--..--L.........................................
Mpf_ENSMPUP00000004905 .............................IY..FSL.........................................
Mpf_ENSMPUP00000011326 .............................FA..FEL.........................................
Mpf_ENSMPUP00000009449 .............................HV..FQL.........................................
Mpf_ENSMPUP00000000014 .............................YG..FQI.........................................
Mpf_ENSMPUP00000012737 .............................YG..FQI.........................................
Mpf_ENSMPUP00000002136 .............................NT..FII.........................................
Mpf_ENSMPUP00000017782 .............................HG..ITI.........................................
Mpf_ENSMPUP00000013550 .............................KC..ILL.........................................
Mpf_ENSMPUP00000017362 .............................FC..FKL.........................................
Mpf_ENSMPUP00000006996 .............................-T..FTI.........................................
Mpf_ENSMPUP00000004785 .............................LT..FCV.........................................
Mpf_ENSMPUP00000014164 .............................HE..LRF.........................................
Mpf_ENSMPUP00000016592 .............................YA..FEL.........................................
Mpf_ENSMPUP00000000486 .............................SC..FQV.........................................
Mpf_ENSMPUP00000003712 .............................FC..FEV.........................................
Mpf_ENSMPUP00000006850 .............................LT..FCV.........................................
Mpf_ENSMPUP00000015574 .............................--..---.........................................
Mpf_ENSMPUP00000014962 .............................--..---.........................................
Mpf_ENSMPUP00000016814 .............................-S..FLV.........................................
Mpf_ENSMPUP00000000139 .............................NT..FAV.........................................
Mpf_ENSMPUP00000012020 .............................YC..FQI.........................................
Mpf_ENSMPUP00000006069 .............................SM..VKV.........................................
Mpf_ENSMPUP00000017142 .............................YA..LKI.........................................
Mpf_ENSMPUP00000013991 .............................HS..FCV.........................................
Mpf_ENSMPUP00000010353 .............................IA..VEV.........................................
Mpf_ENSMPUP00000000014 .............................FS..LCI.........................................
Mpf_ENSMPUP00000009546 .............................FC..FVI.........................................
Mpf_ENSMPUP00000012020 .............................VG..FVV.........................................
Mpf_ENSMPUP00000016751 .............................YC..FQI.........................................
Mpf_ENSMPUP00000000216 .............................HS..FKL.........................................
Mpf_ENSMPUP00000010854 .............................FP..FKI.........................................
Mpf_ENSMPUP00000016813 .............................AF..FNA.........................................
Mpf_ENSMPUP00000002870 .............................FC..FVM.........................................
Mpf_ENSMPUP00000003651 .............................NV..FQI.........................................
Mpf_ENSMPUP00000002370 .............................NG..WKI.........................................
Mpf_ENSMPUP00000006780 .............................MF..FNA.........................................
Mpf_ENSMPUP00000002802 .............................RA..FEI.........................................
Mpf_ENSMPUP00000011336 .............................HV..FKI.........................................
Mpf_ENSMPUP00000003120 .............................--..MEL.........................................
Mpf_ENSMPUP00000005803 .............................FT..FEI.........................................
Mpf_ENSMPUP00000004980 .............................--..MDL.........................................
Mpf_ENSMPUP00000015621 .............................NT..FII.........................................
Mpf_ENSMPUP00000003141 .............................--..---.........................................
Mpf_ENSMPUP00000013099 .............................-C..FDL.........................................
Mpf_ENSMPUP00000010983 .............................WN..VTV.........................................
Mpf_ENSMPUP00000004910 .............................FC..FKLfhpldqsvwavkgpkgesvgs....................
Mpf_ENSMPUP00000016233 .............................--..---.........................................
Mpf_ENSMPUP00000002953 .............................NA..VEI.........................................
Mpf_ENSMPUP00000011716 .............................CM..LQI.........................................
Mpf_ENSMPUP00000007767 .............................NT..FEL.........................................
Mpf_ENSMPUP00000014585 .............................AG..LTI.........................................
Mpf_ENSMPUP00000014164 .............................FA..FRI.........................................
Mpf_ENSMPUP00000005886 .............................--..---.........................................
Mpf_ENSMPUP00000013797 .............................HA..FQI.........................................
Mpf_ENSMPUP00000004108 .............................HT..FTV.........................................
Mpf_ENSMPUP00000009167 .............................CC..FTI.........................................
Mpf_ENSMPUP00000016226 .............................HA..FQV.........................................
Mpf_ENSMPUP00000014024 .............................-V..FQL.........................................
Mpf_ENSMPUP00000008448 .............................--..---.........................................
Mpf_ENSMPUP00000010607 .............................--..---.........................................
Mpf_ENSMPUP00000015774 .............................-C..FDL.........................................
Mpf_ENSMPUP00000008639 .............................RC..LTI.........................................
Mpf_ENSMPUP00000012941 .............................NV..FEL.........................................
Mpf_ENSMPUP00000016218 .............................NI..FRV.........................................
Mpf_ENSMPUP00000007001 .............................NL..FRL.........................................
Mpf_ENSMPUP00000001986 .............................NV..FCL.........................................
Mpf_ENSMPUP00000010415 .............................LT..FRL.........................................
Mpf_ENSMPUP00000003836 .............................SV..IEL.........................................
Mpf_ENSMPUP00000007027 .............................CT..LVI.........................................
Mpf_ENSMPUP00000002688 .............................HL..FTL.........................................
Mpf_ENSMPUP00000001373 .............................--..FDL.........................................
Mpf_ENSMPUP00000013700 .............................IP..FRI.........................................
Mpf_ENSMPUP00000016589 .............................--..---.........................................
Mpf_ENSMPUP00000015325 .............................HY..FTV.........................................
Mpf_ENSMPUP00000001960 .............................YS..FRI.........................................
Mpf_ENSMPUP00000006310 .............................--..---.........................................
Mpf_ENSMPUP00000016747 .............................NF..FRV.........................................
Mpf_ENSMPUP00000013323 .............................-C..IDL.........................................
Mpf_ENSMPUP00000007350 .............................YA..MKI.........................................
Mpf_ENSMPUP00000017588 .............................HC..FVI.........................................
Mpf_ENSMPUP00000007745 .............................LA..FSI.........................................
Mpf_ENSMPUP00000006409 .............................-T..FEI.........................................
Mpf_ENSMPUP00000015574 .............................HL..IVL.........................................
Mpf_ENSMPUP00000008365 .............................NV..LEL.........................................
Mpf_ENSMPUP00000001054 .............................FV..FCL.........................................
Mpf_ENSMPUP00000017488 .............................LA..FSI.........................................
Mpf_ENSMPUP00000005234 .............................NV..FIL.........................................
Mpf_ENSMPUP00000013182 .............................FC..IKL.........................................
Mpf_ENSMPUP00000011513 .............................--..---.........................................
Mpf_ENSMPUP00000005385 .............................--..---.........................................
Mpf_ENSMPUP00000009077 .............................FI..FNM.........................................
Mpf_ENSMPUP00000001767 .............................--..---.........................................
Mpf_ENSMPUP00000007827 .............................FC..FDV.........................................
Mpf_ENSMPUP00000000541 .............................HR..FIL.........................................
Mpf_ENSMPUP00000001809 .............................NV..LHI.........................................
Mpf_ENSMPUP00000005803 .............................WG..LTA.........................................
Mpf_ENSMPUP00000013182 .............................--..---.........................................
Mpf_ENSMPUP00000005315 .............................HSk.FTL.........................................
Mpf_ENSMPUP00000014585 .............................HG..LQI.........................................
Mpf_ENSMPUP00000015166 .............................--..IDL.........................................
Mpf_ENSMPUP00000002409 .............................--..---.........................................
Mpf_ENSMPUP00000005807 .............................HV..FAI.........................................
Mpf_ENSMPUP00000013796 .............................RS..FLI.........................................
Mpf_ENSMPUP00000017782 .............................HG..LQV.........................................
Mpf_ENSMPUP00000019464 .............................FA..FAI.........................................
Mpf_ENSMPUP00000012725 .............................--..---.........................................
Mpf_ENSMPUP00000010996 .............................HN..FSV.........................................
Mpf_ENSMPUP00000007938 .............................WG..FTL.........................................
Mpf_ENSMPUP00000009654 .............................GL..LTV.........................................
Mpf_ENSMPUP00000005385 .............................FN..IKL.........................................
Mpf_ENSMPUP00000006310 .............................FG..IKL.........................................
Mpf_ENSMPUP00000007963 .............................FV..FDI.........................................
Mpf_ENSMPUP00000002310 nrkkhrrkkstsnfkadglsgtaeeqeenFE..FII.........................................
Mpf_ENSMPUP00000000486 .............................-L..VDT.........................................
Mpf_ENSMPUP00000007805 .............................--..---.........................................
Mpf_ENSMPUP00000010246 .............................LG..LEV.........................................
Mpf_ENSMPUP00000004460 .............................QA..VAI.........................................
Mpf_ENSMPUP00000014791 .............................NA..FIL.........................................
Mpf_ENSMPUP00000003154 .............................--..IDL.........................................
Mpf_ENSMPUP00000005214 .............................CGglLSL.........................................
Mpf_ENSMPUP00000003932 .............................HL..IAL.........................................
Mpf_ENSMPUP00000008710 .......................eeaeesFE..FVV.........................................
Mpf_ENSMPUP00000005632 .............................LA..FSI.........................................
Mpf_ENSMPUP00000002828 .............................MA..FRV.........................................
Mpf_ENSMPUP00000017859 .............................ET..WIL.........................................
Mpf_ENSMPUP00000013754 .............................DI..FQL.........................................
Mpf_ENSMPUP00000004548 .............................FC..FDI.........................................
Mpf_ENSMPUP00000000646 .............................--..LVI.........................................
Mpf_ENSMPUP00000004473 .............................HV..WRL.........................................
Mpf_ENSMPUP00000000402 .............................HC..LVL.........................................
Mpf_ENSMPUP00000007412 .............................HP..FQV.........................................
Mpf_ENSMPUP00000004935 .............................--..VTI.........................................
Mpf_ENSMPUP00000011513 .............................YT..IVI.........................................
Mpf_ENSMPUP00000001759 .............................FC..FDI.........................................
Mpf_ENSMPUP00000008353 .............................--..FEL.........................................
Mpf_ENSMPUP00000012083 .............................YC..FVL.........................................
Mpf_ENSMPUP00000006956 .............................FC..FDV.........................................
Mpf_ENSMPUP00000014860 .............................FG..FCI.........................................
Mpf_ENSMPUP00000009647 .............................FG..IKL.........................................
Mpf_ENSMPUP00000005803 .............................QS..FEI.........................................
Mpf_ENSMPUP00000005109 .............................DL..FLL.........................................
Mpf_ENSMPUP00000006149 .............................HA..IGI.........................................
Mpf_ENSMPUP00000001981 ............................nFE..FLI.........................................
Mpf_ENSMPUP00000017916 .............................HG..ITL.........................................
Mpf_ENSMPUP00000003318 .............................KS..FVL.........................................
Mpf_ENSMPUP00000017175 .............................NG..IRL.........................................
Mpf_ENSMPUP00000016038 .............................FV..FVV.........................................
Mpf_ENSMPUP00000016192 .............................HV..FLL.........................................
Mpf_ENSMPUP00000015325 .............................FK..IGV.........................................
Mpf_ENSMPUP00000000660 .............................YG..FCF.........................................
Mpf_ENSMPUP00000005493 .............................--..---.........................................
Mpf_ENSMPUP00000009754 .............................WG..FTV.........................................
Mpf_ENSMPUP00000013796 .............................HA..FQItgvwgawtvgrgypepaggqwsrmvpagpahspp.......
Mpf_ENSMPUP00000010667 .............................--..---.........................................
Mpf_ENSMPUP00000013126 .............................--..-N-.........................................
Mpf_ENSMPUP00000018046 .............................YG..FCI.........................................
Mpf_ENSMPUP00000006359 .............................--..---.........................................
Mpf_ENSMPUP00000015086 .............................EK..LII.........................................
Mpf_ENSMPUP00000008387 .............................FK..IVV.........................................
Mpf_ENSMPUP00000015207 .............................FQ..LHI.........................................
Mpf_ENSMPUP00000004217 .............................H-..---.........................................
Mpf_ENSMPUP00000015689 .............................--..---.........................................
Mpf_ENSMPUP00000015159 .............................GT..ITL.........................................
Mpf_ENSMPUP00000018833 .............................--..---.........................................
Mpf_ENSMPUP00000007866 .............................LT..LSI.........................................
Mpf_ENSMPUP00000007938 .............................--..FDL.........................................
Mpf_ENSMPUP00000010694 .............................NA..FQV.........................................
Mpf_ENSMPUP00000013131 .............................--..LHL.........................................
Mpf_ENSMPUP00000000312 .............................NG..LKI.........................................
Mpf_ENSMPUP00000019132 .............................IY..FTL.........................................
Mpf_ENSMPUP00000015959 .............................HC..FQV.........................................
Mpf_ENSMPUP00000012612 .............................FC..LEL.........................................
Mpf_ENSMPUP00000007938 .............................FS..FEL.........................................
Mpf_ENSMPUP00000007989 .............................PT..FRL.........................................
Mpf_ENSMPUP00000016156 .............................--..---.........................................
Mpf_ENSMPUP00000013721 .............................FP..LIL.........................................
Mpf_ENSMPUP00000005447 .............................KI..FQIlyanegecrkdvemepvqqaektnfqnhkghefiptlyhfp
Mpf_ENSMPUP00000015768 .............................FP..LFL.........................................
Mpf_ENSMPUP00000004215 .............................SA..FFL.........................................
Mpf_ENSMPUP00000010108 .............................WS..VTV.........................................
Mpf_ENSMPUP00000002188 .............................YT..FVL.........................................
Mpf_ENSMPUP00000013446 .............................RI..FQIlyanegeskkeqefpvepvgeksnyichkghefiptlyhfp
Mpf_ENSMPUP00000012407 .............................CI..FRV.........................................
Mpf_ENSMPUP00000017043 .............................YG..LRI.........................................
Mpf_ENSMPUP00000007898 .............................FCv.LYL.........................................
Mpf_ENSMPUP00000017064 .............................NA..FAL.........................................
Mpf_ENSMPUP00000009754 .............................--..FDL.........................................
Mpf_ENSMPUP00000016461 .............................HS..FAL.........................................
Mpf_ENSMPUP00000008230 .............................AA..FRL.........................................
Mpf_ENSMPUP00000001993 .............................EV..MSI.........................................
Mpf_ENSMPUP00000014500 .............................--..FII.........................................
Mpf_ENSMPUP00000002405 .............................FC..FEV.........................................
Mpf_ENSMPUP00000002933 .............................YV..LKM.........................................
Mpf_ENSMPUP00000007268 .............................YC..FEV.........................................
Mpf_ENSMPUP00000010983 .............................NS..FVI.........................................
Mpf_ENSMPUP00000010498 .............................HT..LAI.........................................
Mpf_ENSMPUP00000018101 .............................CV..FTV.........................................
Mpf_ENSMPUP00000002033 .............................--..---.........................................
Mpf_ENSMPUP00000010694 .............................HC..FTV.........................................
Mpf_ENSMPUP00000008353 .............................SF..FKI.........................................
Mpf_ENSMPUP00000009754 .............................QV..LVL.........................................
Mpf_ENSMPUP00000015718 .............................CI..FRV.........................................
Mpf_ENSMPUP00000002358 .............................CI..FRV.........................................
Mpf_ENSMPUP00000005077 .............................FC..FEV.........................................
Mpf_ENSMPUP00000009107 .............................HA..FSL.........................................
Mpf_ENSMPUP00000016101 .............................--..---.........................................
Mpf_ENSMPUP00000011911 .............................SA..FLL.........................................
Mpf_ENSMPUP00000007938 .............................EH..LVL.........................................
Mpf_ENSMPUP00000009676 .............................--..---.........................................
Mpf_ENSMPUP00000005809 .............................CL..FFI.........................................
Mpf_ENSMPUP00000016410 .............................HC..LAF.........................................
Mpf_ENSMPUP00000006638 .............................--..LEL.........................................
Mpf_ENSMPUP00000005803 .............................DV..LLL.........................................
Mpf_ENSMPUP00000010983 .............................--..---.........................................
Mpf_ENSMPUP00000000717 .............................--..---.........................................
Mpf_ENSMPUP00000002793 .............................--..---.........................................
Mpf_ENSMPUP00000007833 .............................LA..FSS.........................................
Mpf_ENSMPUP00000002271 .............................--..---.........................................
Mpf_ENSMPUP00000010974 .............................HV..FAI.........................................
Mpf_ENSMPUP00000010755 .............................YG..VRI.........................................
Mpf_ENSMPUP00000013112 .............................--..---.........................................


                                                                                                100 
                                                                                                  | 
d1wg7a_                .................................................KMQD.....................KSS
Mpf_ENSMPUP00000000236 .................................................ETKQ.....................GTQ
Mpf_ENSMPUP00000001054 .................................................VHVKsesegrp..............ERV
Mpf_ENSMPUP00000001986 .................................................IHTKseiegrp..............ETV
Mpf_ENSMPUP00000006133 .................................................----.....................---
Mpf_ENSMPUP00000009494 .................................................--ST.....................QRI
Mpf_ENSMPUP00000004093 .................................................----.....................---
Mpf_ENSMPUP00000012215 .................................................----.....................---
Mpf_ENSMPUP00000016175 .................................................E---.....................---
Mpf_ENSMPUP00000009909 .................................................----.....................---
Mpf_ENSMPUP00000010977 .................................................---T.....................QRI
Mpf_ENSMPUP00000016638 .................................................----.....................---
Mpf_ENSMPUP00000018612 .................................................----.....................---
Mpf_ENSMPUP00000018966 .................................................----.....................---
Mpf_ENSMPUP00000004660 .................................................SAPD.....................KRI
Mpf_ENSMPUP00000002149 .................................................VYDE.....................-GP
Mpf_ENSMPUP00000018066 .................................................--PV.....................-SS
Mpf_ENSMPUP00000017958 .................................................----.....................---
Mpf_ENSMPUP00000011450 .................................................VCKEptqnk................PDL
Mpf_ENSMPUP00000016402 .................................................----.....................---
Mpf_ENSMPUP00000004951 .................................................----.....................---
Mpf_ENSMPUP00000011363 .................................................----.....................---
Mpf_ENSMPUP00000015445 .................................................TSQKfgqwadsra............NTV
Mpf_ENSMPUP00000015195 .................................................TSQD.....................RRS
Mpf_ENSMPUP00000011751 .................................................LCGTt....................GES
Mpf_ENSMPUP00000009831 .................................................HNKEt....................EEI
Mpf_ENSMPUP00000004111 .................................................--ST.....................KRV
Mpf_ENSMPUP00000005349 .................................................VHDA.....................-NT
Mpf_ENSMPUP00000006137 .................................................----.....................---
Mpf_ENSMPUP00000009095 .................................................IQPE.....................-RA
Mpf_ENSMPUP00000005832 .................................................----.....................---
Mpf_ENSMPUP00000014567 .................................................----.....................---
Mpf_ENSMPUP00000015198 .................................................HTPN.....................-RT
Mpf_ENSMPUP00000008441 .................................................---D.....................---
Mpf_ENSMPUP00000005146 .................................................KPIDkk...................APD
Mpf_ENSMPUP00000010667 .................................................----.....................---
Mpf_ENSMPUP00000000642 .................................................VSKTt....................DEV
Mpf_ENSMPUP00000015373 .................................................----.....................---
Mpf_ENSMPUP00000003213 .................................................----.....................---
Mpf_ENSMPUP00000012196 .................................................DDKTd....................KRI
Mpf_ENSMPUP00000012194 .................................................----.....................---
Mpf_ENSMPUP00000003212 .................................................----.....................---
Mpf_ENSMPUP00000001158 .................................................KPID.....................---
Mpf_ENSMPUP00000010667 .................................................----.....................---
Mpf_ENSMPUP00000013386 .................................................VHDN.....................-YL
Mpf_ENSMPUP00000016712 .................................................----.....................---
Mpf_ENSMPUP00000003302 .................................................KPIDkk...................APD
Mpf_ENSMPUP00000003768 .................................................----.....................---
Mpf_ENSMPUP00000008012 .................................................----.....................---
Mpf_ENSMPUP00000002625 .................................................VYKD.....................-GL
Mpf_ENSMPUP00000010667 .................................................----.....................---
Mpf_ENSMPUP00000006140 .................................................DTGNqr...................F--
Mpf_ENSMPUP00000015670 .................................................----.....................---
Mpf_ENSMPUP00000008341 .................................................DFPD.....................-NN
Mpf_ENSMPUP00000017573 .................................................----.....................---
Mpf_ENSMPUP00000012859 .................................................----.....................---
Mpf_ENSMPUP00000012131 .................................................IHME.....................-KP
Mpf_ENSMPUP00000000172 .................................................----.....................---
Mpf_ENSMPUP00000013200 .................................................KPLD.....................KKI
Mpf_ENSMPUP00000003522 .................................................CTSElgp..................PQI
Mpf_ENSMPUP00000011499 .................................................--D-.....................---
Mpf_ENSMPUP00000011494 .................................................TCKD.....................MRN
Mpf_ENSMPUP00000012716 .................................................KCFD.....................-KT
Mpf_ENSMPUP00000002913 .................................................----.....................R--
Mpf_ENSMPUP00000003504 .................................................KTAT.....................-RT
Mpf_ENSMPUP00000004361 .................................................VGRK.....................---
Mpf_ENSMPUP00000017389 .................................................----.....................---
Mpf_ENSMPUP00000015829 .................................................KVEN.....................GAE
Mpf_ENSMPUP00000003644 .................................................----.....................---
Mpf_ENSMPUP00000006376 .................................................----.....................ISF
Mpf_ENSMPUP00000014536 .................................................----.....................---
Mpf_ENSMPUP00000011501 .................................................VCKD.....................MRN
Mpf_ENSMPUP00000017670 .................................................----.....................---
Mpf_ENSMPUP00000006727 .................................................----.....................---
Mpf_ENSMPUP00000000961 .................................................----.....................---
Mpf_ENSMPUP00000004942 .................................................-I--.....................---
Mpf_ENSMPUP00000002151 .................................................----.....................---
Mpf_ENSMPUP00000014680 .................................................----.....................---
Mpf_ENSMPUP00000005563 .................................................SMSDng...................AQI
Mpf_ENSMPUP00000011333 .................................................AHPN.....................MRT
Mpf_ENSMPUP00000000969 .................................................DHPK.....................---
Mpf_ENSMPUP00000010395 .................................................ILKD.....................ENS
Mpf_ENSMPUP00000015361 .................................................K---.....................---
Mpf_ENSMPUP00000001991 .................................................---Q.....................---
Mpf_ENSMPUP00000005637 .................................................KN--.....................---
Mpf_ENSMPUP00000007307 .................................................----.....................--T
Mpf_ENSMPUP00000008193 .................................................----.....................---
Mpf_ENSMPUP00000007177 .................................................FTWDqe...................AQI
Mpf_ENSMPUP00000010360 .................................................WCNGr....................EEV
Mpf_ENSMPUP00000010611 .................................................RLND.....................GNE
Mpf_ENSMPUP00000007161 .................................................HSPDs....................RNT
Mpf_ENSMPUP00000006134 .................................................----.....................---
Mpf_ENSMPUP00000004983 .................................................VSKD.....................ENS
Mpf_ENSMPUP00000001920 .................................................KIAGa....................PEP
Mpf_ENSMPUP00000013542 .................................................----.....................---
Mpf_ENSMPUP00000008337 .................................................SLRG.....................PEM
Mpf_ENSMPUP00000013626 .................................................----.....................---
Mpf_ENSMPUP00000001949 .................................................SHPQ.....................IKT
Mpf_ENSMPUP00000017721 .................................................CSADg....................QDT
Mpf_ENSMPUP00000001109 .................................................HSPDa....................KHT
Mpf_ENSMPUP00000001935 .................................................----.....................---
Mpf_ENSMPUP00000006252 .................................................----.....................---
Mpf_ENSMPUP00000005676 .................................................----.....................---
Mpf_ENSMPUP00000005196 .................................................VTAN.....................-VT
Mpf_ENSMPUP00000012589 .................................................LGKDcn...................ETS
Mpf_ENSMPUP00000010571 .................................................-FEG.....................-KT
Mpf_ENSMPUP00000011589 .................................................EHAG.....................VRT
Mpf_ENSMPUP00000005676 .................................................----.....................---
Mpf_ENSMPUP00000002533 .................................................LTQDaagv.................LHT
Mpf_ENSMPUP00000004215 .................................................----.....................---
Mpf_ENSMPUP00000013399 .................................................-T--.....................---
Mpf_ENSMPUP00000010530 .................................................SGSM.....................IER
Mpf_ENSMPUP00000006089 .................................................WFRRrka..................RDT
Mpf_ENSMPUP00000016498 .................................................----.....................---
Mpf_ENSMPUP00000007327 .................................................----.....................---
Mpf_ENSMPUP00000001749 .................................................WYAGk....................EEV
Mpf_ENSMPUP00000016475 .................................................YNPShkg..................Q-V
Mpf_ENSMPUP00000013206 .................................................VHTGmraliynssaggsqaeqsg..MRT
Mpf_ENSMPUP00000006140 .................................................RDKDtri..................LKC
Mpf_ENSMPUP00000005780 .................................................SASSag...................PEM
Mpf_ENSMPUP00000001869 .................................................TGNI.....................-ER
Mpf_ENSMPUP00000012475 .................................................YIPDnkdqvikackteadgrvvegnHTV
Mpf_ENSMPUP00000008316 .................................................ANKE.....................-ET
Mpf_ENSMPUP00000001167 .................................................----.....................---
Mpf_ENSMPUP00000008230 .................................................----.....................---
Mpf_ENSMPUP00000017717 .................................................----.....................---
Mpf_ENSMPUP00000010272 .................................................WFRRrrks.................QDT
Mpf_ENSMPUP00000003964 .................................................YIPNnkgqlikackteadgrvvegnHMV
Mpf_ENSMPUP00000017478 .................................................HNTAk....................NKW
Mpf_ENSMPUP00000010168 .................................................ITDT.....................-MV
Mpf_ENSMPUP00000009546 .................................................ITSS.....................-RT
Mpf_ENSMPUP00000002870 .................................................VTSS.....................-RT
Mpf_ENSMPUP00000000151 .................................................WFRRrra..................REA
Mpf_ENSMPUP00000000216 .................................................SGKE.....................-RT
Mpf_ENSMPUP00000007012 .................................................IEDQg....................AQG
Mpf_ENSMPUP00000012096 .................................................IHLQg....................KQG
Mpf_ENSMPUP00000004281 .................................................WSGRtpss.................DNK
Mpf_ENSMPUP00000004460 .................................................----.....................---
Mpf_ENSMPUP00000011499 .................................................HFKS.....................-HV
Mpf_ENSMPUP00000003498 .................................................EHPG.....................MRT
Mpf_ENSMPUP00000006723 .................................................RLSN.....................GSE
Mpf_ENSMPUP00000006149 .................................................----.....................---
Mpf_ENSMPUP00000011052 .................................................TSRTggv..................VET
Mpf_ENSMPUP00000015653 .................................................THDM.....................YKP
Mpf_ENSMPUP00000014937 .................................................----.....................---
Mpf_ENSMPUP00000006713 .................................................THYKhs...................KQQ
Mpf_ENSMPUP00000005370 .................................................TTAN.....................-VV
Mpf_ENSMPUP00000017142 .................................................YHKK.....................TLF
Mpf_ENSMPUP00000011052 .................................................WVGRtpts.................DNK
Mpf_ENSMPUP00000000930 .................................................----.....................---
Mpf_ENSMPUP00000016865 .................................................----.....................---
Mpf_ENSMPUP00000000090 .................................................IHTQg....................QNG
Mpf_ENSMPUP00000012035 .................................................TTPD.....................-CE
Mpf_ENSMPUP00000009068 .................................................SPGGagerekvpan...........PEA
Mpf_ENSMPUP00000000172 .................................................QFKS.....................-HV
Mpf_ENSMPUP00000013402 .................................................----.....................---
Mpf_ENSMPUP00000012726 .................................................KVEG.....................PSE
Mpf_ENSMPUP00000010329 .................................................FHYKnp...................KLQ
Mpf_ENSMPUP00000005886 .................................................----.....................-VC
Mpf_ENSMPUP00000011911 .................................................----.....................---
Mpf_ENSMPUP00000013895 .................................................SHID.....................-RV
Mpf_ENSMPUP00000009754 .................................................ITNN.....................-RT
Mpf_ENSMPUP00000017452 .................................................GMKD.....................PEM
Mpf_ENSMPUP00000004281 .................................................MNREt....................SER
Mpf_ENSMPUP00000017577 .................................................QTQD.....................GSE
Mpf_ENSMPUP00000004977 .................................................SAAP.....................PEM
Mpf_ENSMPUP00000017884 .................................................----.....................---
Mpf_ENSMPUP00000007027 .................................................ISEK.....................-KT
Mpf_ENSMPUP00000012725 .................................................KTSK.....................-RV
Mpf_ENSMPUP00000000871 .................................................KTS-.....................---
Mpf_ENSMPUP00000006220 .................................................ITAD.....................EVH
Mpf_ENSMPUP00000008418 .................................................----.....................---
Mpf_ENSMPUP00000003932 .................................................----.....................---
Mpf_ENSMPUP00000001861 .................................................----.....................---
Mpf_ENSMPUP00000008418 .................................................GDKDscm..................LKC
Mpf_ENSMPUP00000006249 .................................................IPASwdqsrtg..............QDS
Mpf_ENSMPUP00000003836 .................................................TPQSg....................NRT
Mpf_ENSMPUP00000015858 .................................................IYEDdagk.................AQT
Mpf_ENSMPUP00000002835 .................................................VFKDq....................RNT
Mpf_ENSMPUP00000004473 .................................................TGRR.....................-RC
Mpf_ENSMPUP00000000137 .................................................LYKK.....................KKR
Mpf_ENSMPUP00000001907 .................................................TSRGpegg.................IQR
Mpf_ENSMPUP00000014024 .................................................SGKQ.....................-RT
Mpf_ENSMPUP00000001742 .................................................ITPF.....................-RR
Mpf_ENSMPUP00000000172 .................................................CAAQ.....................-KT
Mpf_ENSMPUP00000005480 .................................................ITPC.....................-RK
Mpf_ENSMPUP00000018515 .................................................KTPT.....................-KS
Mpf_ENSMPUP00000009502 .................................................VFPF.....................-RT
Mpf_ENSMPUP00000013672 .................................................----.....................---
Mpf_ENSMPUP00000011336 .................................................SGKQ.....................-RS
Mpf_ENSMPUP00000001410 .................................................IYGEn....................YES
Mpf_ENSMPUP00000003424 .................................................GLQD.....................GKE
Mpf_ENSMPUP00000007040 .................................................----.....................---
Mpf_ENSMPUP00000019493 .................................................LMFP.....................-ES
Mpf_ENSMPUP00000018830 .................................................KTAR.....................-KS
Mpf_ENSMPUP00000003141 .................................................----.....................-IC
Mpf_ENSMPUP00000010983 .................................................IMAD.....................-RT
Mpf_ENSMPUP00000010498 .................................................----.....................---
Mpf_ENSMPUP00000012786 .................................................KTAD.....................WRV
Mpf_ENSMPUP00000014114 .................................................VSPT.....................-KS
Mpf_ENSMPUP00000007256 .................................................----.....................---
Mpf_ENSMPUP00000005608 .................................................SVND.....................-SV
Mpf_ENSMPUP00000002033 .................................................KTTR.....................-RV
Mpf_ENSMPUP00000016751 .................................................RTSG.....................GRS
Mpf_ENSMPUP00000016435 .................................................VFHGr....................RSN
Mpf_ENSMPUP00000001167 .................................................YTRD.....................-EH
Mpf_ENSMPUP00000001585 .................................................VLPK.....................-EE
Mpf_ENSMPUP00000002351 .................................................AHRNg....................PEK
Mpf_ENSMPUP00000011499 .................................................RGQR.....................-QS
Mpf_ENSMPUP00000005375 .................................................---S.....................---
Mpf_ENSMPUP00000015986 .................................................----.....................---
Mpf_ENSMPUP00000004747 .................................................----.....................---
Mpf_ENSMPUP00000009754 .................................................YTEG.....................ERL
Mpf_ENSMPUP00000002257 .................................................DNSK.....................VCQ
Mpf_ENSMPUP00000006734 .................................................IYLNefhsa................VGA
Mpf_ENSMPUP00000003502 .................................................----.....................---
Mpf_ENSMPUP00000011019 .................................................----.....................---
Mpf_ENSMPUP00000003673 .................................................KIRG.....................GKQ
Mpf_ENSMPUP00000000383 .................................................FHVD.....................---
Mpf_ENSMPUP00000008997 .................................................KTAD.....................WRV
Mpf_ENSMPUP00000010040 .................................................VSPS.....................-KS
Mpf_ENSMPUP00000007257 .................................................LHKN.....................MLF
Mpf_ENSMPUP00000016774 .................................................RTAD.....................WRV
Mpf_ENSMPUP00000001960 .................................................TPMN.....................ADV
Mpf_ENSMPUP00000007610 .................................................YHGSh....................RES
Mpf_ENSMPUP00000017612 .................................................SDLTip...................KHR
Mpf_ENSMPUP00000007907 .................................................LHGEn....................YES
Mpf_ENSMPUP00000014021 .................................................----.....................---
Mpf_ENSMPUP00000008982 .................................................TSSIt....................GKK
Mpf_ENSMPUP00000005803 .................................................VTTQ.....................-RT
Mpf_ENSMPUP00000002728 .................................................YHGNh....................MES
Mpf_ENSMPUP00000007017 .................................................ITKD.....................DTH
Mpf_ENSMPUP00000003752 .................................................----.....................---
Mpf_ENSMPUP00000001306 .................................................SHID.....................-RV
Mpf_ENSMPUP00000005338 .................................................DFGD.....................---
Mpf_ENSMPUP00000001689 .................................................KMLD.....................KYS
Mpf_ENSMPUP00000010415 .................................................TQQG.....................TDP
Mpf_ENSMPUP00000006220 .................................................TTTK.....................QQD
Mpf_ENSMPUP00000016350 .................................................CTKH.....................-RG
Mpf_ENSMPUP00000018773 .................................................----.....................---
Mpf_ENSMPUP00000017599 .................................................RCLQ.....................WTT
Mpf_ENSMPUP00000016349 .................................................CTKH.....................-RG
Mpf_ENSMPUP00000015036 .................................................TTAD.....................FCE
Mpf_ENSMPUP00000007938 .................................................ITGQ.....................-RV
Mpf_ENSMPUP00000007257 .................................................ESVE.....................-RS
Mpf_ENSMPUP00000005203 .................................................-P--.....................---
Mpf_ENSMPUP00000000650 .................................................DFGE.....................---
Mpf_ENSMPUP00000007937 .................................................VVQHfsee.................HYI
Mpf_ENSMPUP00000007017 .................................................KTRT.....................STE
Mpf_ENSMPUP00000012780 .................................................TSGA.....................-RT
Mpf_ENSMPUP00000002522 .................................................----.....................---
Mpf_ENSMPUP00000004905 .................................................VLRN.....................-QE
Mpf_ENSMPUP00000011326 .................................................KMQD.....................KSS
Mpf_ENSMPUP00000009449 .................................................RTAD.....................WRL
Mpf_ENSMPUP00000000014 .................................................HTKE.....................-GE
Mpf_ENSMPUP00000012737 .................................................HTKD.....................-AV
Mpf_ENSMPUP00000002136 .................................................RCLQ.....................WTT
Mpf_ENSMPUP00000017782 .................................................VTPE.....................-RR
Mpf_ENSMPUP00000013550 .................................................RIKG.....................GKQ
Mpf_ENSMPUP00000017362 .................................................FHPL.....................EQS
Mpf_ENSMPUP00000006996 .................................................TVDQ.....................-KT
Mpf_ENSMPUP00000004785 .................................................KTHD.....................-RL
Mpf_ENSMPUP00000014164 .................................................SQGA.....................TEV
Mpf_ENSMPUP00000016592 .................................................KMND.....................LTY
Mpf_ENSMPUP00000000486 .................................................IFPQ.....................-DV
Mpf_ENSMPUP00000003712 .................................................VSPT.....................-KS
Mpf_ENSMPUP00000006850 .................................................KTYE.....................-RL
Mpf_ENSMPUP00000015574 .................................................----.....................---
Mpf_ENSMPUP00000014962 .................................................----.....................---
Mpf_ENSMPUP00000016814 .................................................IHLTefdcv................SSA
Mpf_ENSMPUP00000000139 .................................................CTEH.....................-RG
Mpf_ENSMPUP00000012020 .................................................TTPN.....................GKS
Mpf_ENSMPUP00000006069 .................................................YLQD.....................VKV
Mpf_ENSMPUP00000017142 .................................................ETSQ.....................-SC
Mpf_ENSMPUP00000013991 .................................................ITPQ.....................-RK
Mpf_ENSMPUP00000010353 .................................................FSGD.....................GRN
Mpf_ENSMPUP00000000014 .................................................LTPE.....................-KE
Mpf_ENSMPUP00000009546 .................................................NALS.....................-QR
Mpf_ENSMPUP00000012020 .................................................RTPEstggea...............LST
Mpf_ENSMPUP00000016751 .................................................TSFDg....................KKS
Mpf_ENSMPUP00000000216 .................................................TQSK.....................-SV
Mpf_ENSMPUP00000010854 .................................................VHISkk...................HRT
Mpf_ENSMPUP00000016813 .................................................VKEG.....................-DT
Mpf_ENSMPUP00000002870 .................................................NAGM.....................-RK
Mpf_ENSMPUP00000003651 .................................................TTVS.....................GNE
Mpf_ENSMPUP00000002370 .................................................HNTAk....................NKW
Mpf_ENSMPUP00000006780 .................................................VKEG.....................-DT
Mpf_ENSMPUP00000002802 .................................................FTDN.....................-KT
Mpf_ENSMPUP00000011336 .................................................TQSH.....................-LS
Mpf_ENSMPUP00000003120 .................................................IIPG.....................EQH
Mpf_ENSMPUP00000005803 .................................................YLPS.....................ERA
Mpf_ENSMPUP00000004980 .................................................IIPG.....................EQY
Mpf_ENSMPUP00000015621 .................................................RCLQ.....................WTT
Mpf_ENSMPUP00000003141 .................................................----.....................---
Mpf_ENSMPUP00000013099 .................................................ISHD.....................-RT
Mpf_ENSMPUP00000010983 .................................................YGRK.....................-HC
Mpf_ENSMPUP00000004910 .................................................I---.....................--T
Mpf_ENSMPUP00000016233 .................................................----.....................---
Mpf_ENSMPUP00000002953 .................................................FLTN.....................GRT
Mpf_ENSMPUP00000011716 .................................................VCRD.....................GKT
Mpf_ENSMPUP00000007767 .................................................ITVRpqredd...............RET
Mpf_ENSMPUP00000014585 .................................................VTPE.....................-RR
Mpf_ENSMPUP00000014164 .................................................LRNR.....................QEV
Mpf_ENSMPUP00000005886 .................................................L---.....................---
Mpf_ENSMPUP00000013797 .................................................TGPL.....................PAP
Mpf_ENSMPUP00000004108 .................................................NAAS.....................GEQ
Mpf_ENSMPUP00000009167 .................................................FYGTqfv..................LST
Mpf_ENSMPUP00000016226 .................................................ILAD.....................RPC
Mpf_ENSMPUP00000014024 .................................................QQSG.....................-QL
Mpf_ENSMPUP00000008448 .................................................----.....................---
Mpf_ENSMPUP00000010607 .................................................----.....................---
Mpf_ENSMPUP00000015774 .................................................VTHN.....................-RT
Mpf_ENSMPUP00000008639 .................................................AFKGr....................RKN
Mpf_ENSMPUP00000012941 .................................................KTRQ.....................GTE
Mpf_ENSMPUP00000016218 .................................................RFQDpsp..................GQS
Mpf_ENSMPUP00000007001 .................................................FLLHnaqgt................QAE
Mpf_ENSMPUP00000001986 .................................................SNSF.....................GDV
Mpf_ENSMPUP00000010415 .................................................LRNG.....................QEV
Mpf_ENSMPUP00000003836 .................................................EPPSee...................FKT
Mpf_ENSMPUP00000007027 .................................................HPPE.....................HSP
Mpf_ENSMPUP00000002688 .................................................TILSnhase................KVE
Mpf_ENSMPUP00000001373 .................................................ISHN.....................-RT
Mpf_ENSMPUP00000013700 .................................................HNRN.....................GKS
Mpf_ENSMPUP00000016589 .................................................----.....................---
Mpf_ENSMPUP00000015325 .................................................NFSHen...................QKA
Mpf_ENSMPUP00000001960 .................................................LHRG.....................EEV
Mpf_ENSMPUP00000006310 .................................................----.....................---
Mpf_ENSMPUP00000016747 .................................................SFKNgsq..................SQT
Mpf_ENSMPUP00000013323 .................................................DTEE.....................-HI
Mpf_ENSMPUP00000007350 .................................................SHQDf....................HGN
Mpf_ENSMPUP00000017588 .................................................LYGMefr..................LKT
Mpf_ENSMPUP00000007745 .................................................LYDS.....................NCQ
Mpf_ENSMPUP00000006409 .................................................KTPS.....................-RV
Mpf_ENSMPUP00000015574 .................................................YTRD.....................-RS
Mpf_ENSMPUP00000008365 .................................................RSRD.....................GSE
Mpf_ENSMPUP00000001054 .................................................SNSL.....................GDA
Mpf_ENSMPUP00000017488 .................................................LYDP.....................DET
Mpf_ENSMPUP00000005234 .................................................RLLEnaddr................EAT
Mpf_ENSMPUP00000013182 .................................................LVPSpeg..................MSE
Mpf_ENSMPUP00000011513 .................................................----.....................---
Mpf_ENSMPUP00000005385 .................................................----.....................---
Mpf_ENSMPUP00000009077 .................................................CSKD.....................---
Mpf_ENSMPUP00000001767 .................................................----.....................---
Mpf_ENSMPUP00000007827 .................................................EAVDr....................PGV
Mpf_ENSMPUP00000000541 .................................................QRSPgnk..................VSD
Mpf_ENSMPUP00000001809 .................................................RTVP.....................GHE
Mpf_ENSMPUP00000005803 .................................................YSEK.....................-HH
Mpf_ENSMPUP00000013182 .................................................----.....................---
Mpf_ENSMPUP00000005315 .................................................AHSKqpgnt................APN
Mpf_ENSMPUP00000014585 .................................................TYRRegh..................VRN
Mpf_ENSMPUP00000015166 .................................................DTED.....................-NI
Mpf_ENSMPUP00000002409 .................................................----.....................---
Mpf_ENSMPUP00000005807 .................................................FNTE.....................---
Mpf_ENSMPUP00000013796 .................................................EGPL.....................INT
Mpf_ENSMPUP00000017782 .................................................TYLKdns..................TRN
Mpf_ENSMPUP00000019464 .................................................CFDApg...................VRP
Mpf_ENSMPUP00000012725 .................................................----.....................---
Mpf_ENSMPUP00000010996 .................................................INPVagq..................AVT
Mpf_ENSMPUP00000007938 .................................................ILEK.....................-MQ
Mpf_ENSMPUP00000009654 .................................................NLRE.....................GSR
Mpf_ENSMPUP00000005385 .................................................LIPVaeg..................MNE
Mpf_ENSMPUP00000006310 .................................................LIPVadg..................MNE
Mpf_ENSMPUP00000007963 .................................................KTSE.....................-RT
Mpf_ENSMPUP00000002310 .................................................VSLT.....................GQT
Mpf_ENSMPUP00000000486 .................................................VLYD.....................NTQ
Mpf_ENSMPUP00000007805 .................................................----.....................---
Mpf_ENSMPUP00000010246 .................................................FCTE.....................---
Mpf_ENSMPUP00000004460 .................................................IFTD.....................DSA
Mpf_ENSMPUP00000014791 .................................................HGPK.....................-CE
Mpf_ENSMPUP00000003154 .................................................DTEE.....................-HI
Mpf_ENSMPUP00000005214 .................................................SFPH.....................-EK
Mpf_ENSMPUP00000003932 .................................................FTQD.....................-EY
Mpf_ENSMPUP00000008710 .................................................VSLT.....................GQT
Mpf_ENSMPUP00000005632 .................................................SYDHgea..................EAY
Mpf_ENSMPUP00000002828 .................................................HNRN.....................GKS
Mpf_ENSMPUP00000017859 .................................................----.....................---
Mpf_ENSMPUP00000013754 .................................................NNPDk....................GNV
Mpf_ENSMPUP00000004548 .................................................ETNEr....................PGT
Mpf_ENSMPUP00000000646 .................................................QCKN.....................FRI
Mpf_ENSMPUP00000004473 .................................................QQAQ.....................-QT
Mpf_ENSMPUP00000000402 .................................................KHPQiqkks................QYI
Mpf_ENSMPUP00000007412 .................................................TLLHnsegl................QEK
Mpf_ENSMPUP00000004935 .................................................HKQD.....................GKN
Mpf_ENSMPUP00000011513 .................................................HPKD.....................QGP
Mpf_ENSMPUP00000001759 .................................................EVVEr....................HGI
Mpf_ENSMPUP00000008353 .................................................VFSG.....................-RK
Mpf_ENSMPUP00000012083 .................................................KHPQiqkes................QYI
Mpf_ENSMPUP00000006956 .................................................EAADrp...................GAA
Mpf_ENSMPUP00000014860 .................................................KPNKlrngh................KGL
Mpf_ENSMPUP00000009647 .................................................LSAVpgger................KVL
Mpf_ENSMPUP00000005803 .................................................ITPY.....................-RS
Mpf_ENSMPUP00000005109 .................................................TDSEk....................GNS
Mpf_ENSMPUP00000006149 .................................................YFND.....................DTS
Mpf_ENSMPUP00000001981 .................................................VSST.....................GQT
Mpf_ENSMPUP00000017916 .................................................VTPLsgsek................KQV
Mpf_ENSMPUP00000003318 .................................................GWPT.....................-VN
Mpf_ENSMPUP00000017175 .................................................TSAVpgadi................KVL
Mpf_ENSMPUP00000016038 .................................................KTTS.....................-RT
Mpf_ENSMPUP00000016192 .................................................QLLHgpha.................KHQ
Mpf_ENSMPUP00000015325 .................................................EPKDsp...................SFT
Mpf_ENSMPUP00000000660 .................................................KPNKaggp.................RDL
Mpf_ENSMPUP00000005493 .................................................---G.....................---
Mpf_ENSMPUP00000009754 .................................................VHETekhe.................KQQ
Mpf_ENSMPUP00000013796 .................................................LPPGpl...................PAP
Mpf_ENSMPUP00000010667 .................................................----.....................-KL
Mpf_ENSMPUP00000013126 .................................................VYKD.....................YRQ
Mpf_ENSMPUP00000018046 .................................................KPNKvrnet................KEL
Mpf_ENSMPUP00000006359 .................................................----.....................-SH
Mpf_ENSMPUP00000015086 .................................................HCKD.....................LRV
Mpf_ENSMPUP00000008387 .................................................EPPDsa...................PFT
Mpf_ENSMPUP00000015207 .................................................ACKD.....................SKV
Mpf_ENSMPUP00000004217 .................................................----.....................---
Mpf_ENSMPUP00000015689 .................................................----.....................---
Mpf_ENSMPUP00000015159 .................................................RCKD.....................LRV
Mpf_ENSMPUP00000018833 .................................................----.....................---
Mpf_ENSMPUP00000007866 .................................................SNRYged..................EVT
Mpf_ENSMPUP00000007938 .................................................LTPH.....................-RC
Mpf_ENSMPUP00000010694 .................................................IAVDg....................VCS
Mpf_ENSMPUP00000013131 .................................................TCKD.....................CKV
Mpf_ENSMPUP00000000312 .................................................TTPE.....................-EQ
Mpf_ENSMPUP00000019132 .................................................VTEG.....................GGE
Mpf_ENSMPUP00000015959 .................................................TWTG.....................-GS
Mpf_ENSMPUP00000012612 .................................................YNPScrgqkikacktdgegkvvegkHES
Mpf_ENSMPUP00000007938 .................................................ILTG.....................GRI
Mpf_ENSMPUP00000007989 .................................................SLLSnhqgr................PTH
Mpf_ENSMPUP00000016156 .................................................----.....................---
Mpf_ENSMPUP00000013721 .................................................WHPS.....................ARH
Mpf_ENSMPUP00000005447 anceacakplwhvfkpppalecrrchvkchrdhldkkedlispckvsydVTSA.....................-RD
Mpf_ENSMPUP00000015768 .................................................QHPF.....................RRH
Mpf_ENSMPUP00000004215 .................................................ETKE.....................-RQ
Mpf_ENSMPUP00000010108 .................................................SGRK.....................-HS
Mpf_ENSMPUP00000002188 .................................................KVKD.....................RTD
Mpf_ENSMPUP00000013446 tnceacmkplwhmfkpppalecrrchikchkdhmdkkeeiiapckvyydISTA.....................-KN
Mpf_ENSMPUP00000012407 .................................................TASQltvppa...............VCT
Mpf_ENSMPUP00000017043 .................................................DNLS.....................-RT
Mpf_ENSMPUP00000007898 .................................................AEKA.....................ECL
Mpf_ENSMPUP00000017064 .................................................LVRPptera................NVL
Mpf_ENSMPUP00000009754 .................................................TTPY.....................-RI
Mpf_ENSMPUP00000016461 .................................................YTPE.....................-RT
Mpf_ENSMPUP00000008230 .................................................DTAQ.....................-RS
Mpf_ENSMPUP00000001993 .................................................RTTN.....................-RE
Mpf_ENSMPUP00000014500 .................................................SNGG.....................AQT
Mpf_ENSMPUP00000002405 .................................................TTSS.....................-GT
Mpf_ENSMPUP00000002933 .................................................ESHPhttcwp...............GRT
Mpf_ENSMPUP00000007268 .................................................TTSS.....................-GS
Mpf_ENSMPUP00000010983 .................................................ITAN.....................-RV
Mpf_ENSMPUP00000010498 .................................................LCLS.....................-QA
Mpf_ENSMPUP00000018101 .................................................TASQlsaprn...............RYS
Mpf_ENSMPUP00000002033 .................................................----.....................---
Mpf_ENSMPUP00000010694 .................................................QSES.....................GED
Mpf_ENSMPUP00000008353 .................................................ITAK.....................-AV
Mpf_ENSMPUP00000009754 .................................................VERR.....................-RT
Mpf_ENSMPUP00000015718 .................................................TASQlsasds...............RCS
Mpf_ENSMPUP00000002358 .................................................TASLlgtpsk...............TSS
Mpf_ENSMPUP00000005077 .................................................TYLS.....................-GS
Mpf_ENSMPUP00000009107 .................................................RLSS.....................RVE
Mpf_ENSMPUP00000016101 .................................................----.....................---
Mpf_ENSMPUP00000011911 .................................................TTTE.....................-RS
Mpf_ENSMPUP00000007938 .................................................VETG.....................-RT
Mpf_ENSMPUP00000009676 .................................................----.....................---
Mpf_ENSMPUP00000005809 .................................................KCFD.....................-DT
Mpf_ENSMPUP00000016410 .................................................SSSGpq...................SQT
Mpf_ENSMPUP00000006638 .................................................TLPS.....................-RA
Mpf_ENSMPUP00000005803 .................................................VEKG.....................-RT
Mpf_ENSMPUP00000010983 .................................................----.....................---
Mpf_ENSMPUP00000000717 .................................................----.....................-KK
Mpf_ENSMPUP00000002793 .................................................----.....................--T
Mpf_ENSMPUP00000007833 .................................................AGAQ.....................AQT
Mpf_ENSMPUP00000002271 .................................................----.....................HES
Mpf_ENSMPUP00000010974 .................................................FNTEqrnvykd..............LRQ
Mpf_ENSMPUP00000010755 .................................................DTSH.....................-RS
Mpf_ENSMPUP00000013112 .................................................----.....................---


                                                                         110        120         130 
                                                                           |          |           | 
d1wg7a_                ...................YL.......................LAADSE..VE.MEEWITILNKILQL..NFEAAM
Mpf_ENSMPUP00000000236 ...................YT.......................FSSIER..E-.--------------..------
Mpf_ENSMPUP00000001054 ...................FH.......................LCCSSP..ES.RKDFLKAVHSILR-..------
Mpf_ENSMPUP00000001986 ...................FQ.......................LCCSDS..ES.KTNIVKVIRSILRE..------
Mpf_ENSMPUP00000006133 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009494 ...................KV.......................LNADSQ..ET.MM------------..------
Mpf_ENSMPUP00000004093 ...................KL.......................FRFASE..ND.LPEWK---------..------
Mpf_ENSMPUP00000012215 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000016175 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009909 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010977 ...................KV.......................LNADTQ..ET.MMD-----------..------
Mpf_ENSMPUP00000016638 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000018612 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000018966 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004660 ...................YQ.......................FTAASP..KD.AEEWVQQLNFVL--..------
Mpf_ENSMPUP00000002149 ...................LY.......................VFSPTE..EL.RKRWIHQLKNVIRY..NSDLVQ
Mpf_ENSMPUP00000018066 ...................VI.......................FCALDP..QD.RK------------..------
Mpf_ENSMPUP00000017958 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011450 ...................HL.......................FQCD--..--.--------------..------
Mpf_ENSMPUP00000016402 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004951 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011363 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015445 ...................FG.......................LGFSSE..QQ.LTKFAEKFQEVKE-..------
Mpf_ENSMPUP00000015195 ...................YE.......................FTAANP..AE.ARDWVDQIS-----..------
Mpf_ENSMPUP00000011751 ...................HL.......................LCARKS..EQ.KQRWLKAFAKEREQ..------
Mpf_ENSMPUP00000009831 ...................HL.......................FFAKKL..EE.KIRWLRAFREERKM..VQEDEK
Mpf_ENSMPUP00000004111 ...................KV.......................LTADSQ..EA.MMD-----------..------
Mpf_ENSMPUP00000005349 ...................LY.......................IFAPSA..QS.RDRWVKKLKEEIKN..NNNIMI
Mpf_ENSMPUP00000006137 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009095 ...................LY.......................IQANNC..VE.AKAWIDILTKVSQS..NQKRLA
Mpf_ENSMPUP00000005832 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000014567 ...................--.......................-C----..--.--------------..------
Mpf_ENSMPUP00000015198 ...................YY.......................LMDPS-..GN.AHKWCKKIQEVWRH..RY----
Mpf_ENSMPUP00000008441 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005146 ...................FV.......................FYA---..--.--------------..------
Mpf_ENSMPUP00000010667 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000000642 ...................HL.......................FCARKQ..ED.KVRWLQACEDERRR..VREDRE
Mpf_ENSMPUP00000015373 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000003213 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000012196 ...................FT.......................FICKDS..E-.--------------..------
Mpf_ENSMPUP00000012194 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000003212 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001158 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010667 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013386 ...................LY.......................VFAPDR..ES.RQRWVLALKEETRN..NNSLVP
Mpf_ENSMPUP00000016712 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000003302 ...................FV.......................FYA---..--.--------------..------
Mpf_ENSMPUP00000003768 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008012 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000002625 ...................LY.......................VYASNE..ES.RSQWLKALQKEIRG..NPHLLI
Mpf_ENSMPUP00000010667 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006140 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015670 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008341 ...................FL.......................LKTL--..--.--------------..------
Mpf_ENSMPUP00000017573 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000012859 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000012131 ...................LY.......................VQANNC..VE.ANEWIDVLCRVSRC..NQNRLS
Mpf_ENSMPUP00000000172 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013200 ...................DV.......................FKFNSS..KL.R-------------..------
Mpf_ENSMPUP00000003522 ...................YE.......................LVALTS..SD.KNTWMELLEEAV--..------
Mpf_ENSMPUP00000011499 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011494 ...................LR.......................FAL---..--.--------------..------
Mpf_ENSMPUP00000012716 ...................FE.......................ISASDK..KK.KQEWIQAIHST---..------
Mpf_ENSMPUP00000002913 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000003504 ...................YE.......................MSASDT..RQ.RQEWTAAIQTAIR-..------
Mpf_ENSMPUP00000004361 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000017389 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015829 ...................YI.......................LETIDS..LQ.KHSWVADIQGCVD-..------
Mpf_ENSMPUP00000003644 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006376 ...................TY.......................MVAENP..EV.TKQWVEGLRSIIHN..F-----
Mpf_ENSMPUP00000014536 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011501 ...................LR.......................LAYKQE..EQ.--------------..------
Mpf_ENSMPUP00000017670 ...................--.......................------..--.---W----------..------
Mpf_ENSMPUP00000006727 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000000961 ...................--.......................------..--.--L-----------..------
Mpf_ENSMPUP00000004942 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000002151 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000014680 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005563 ...................YE.......................LVAQTV..SE.KTVWQDLICR----..------
Mpf_ENSMPUP00000011333 ...................YY.......................FCTDTG..KE.MELWMKAM------..------
Mpf_ENSMPUP00000000969 ...................--.......................------..AC.KHL-----------..------
Mpf_ENSMPUP00000010395 ...................VI.......................FSAKSA..EE.KNNWMAALISLQYR..STLERM
Mpf_ENSMPUP00000015361 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001991 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005637 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000007307 ...................FV.......................FRLDSA..R-.--------------..------
Mpf_ENSMPUP00000008193 ...................--.......................--C---..--.--------------..------
Mpf_ENSMPUP00000007177 ...................YE.......................LVAQTV..SE.RKNWCSLITE----..------
Mpf_ENSMPUP00000010360 ...................YI.......................VQAPTP..EV.KAAWVSEIRKVLTS..QLQAC-
Mpf_ENSMPUP00000010611 ...................YL.......................FQAKDD..EE.MNTWIQAISSAIS-..------
Mpf_ENSMPUP00000007161 ...................LI.......................LRCKDT..AT.AHSWFVAIHTN---..------
Mpf_ENSMPUP00000006134 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004983 ...................II.......................FAAKSA..EE.KNNWMAALISLHYR..STLDRM
Mpf_ENSMPUP00000001920 ...................LT.......................VTAPS-..--.--------------..------
Mpf_ENSMPUP00000013542 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008337 ...................YE.......................IYTSSK..EE.RNTWMAHIRRAVE-..------
Mpf_ENSMPUP00000013626 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001949 ...................FY.......................FAAENA..QE.MSVWLNKLGFA---..------
Mpf_ENSMPUP00000017721 ...................LF.......................LRAKDE..AS.AKSWAAAIQAQ---..------
Mpf_ENSMPUP00000001109 ...................VI.......................LRSKDS..AT.AQAWFSAIHS----..------
Mpf_ENSMPUP00000001935 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006252 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005676 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005196 ...................YF.......................------..--.--------------..------
Mpf_ENSMPUP00000012589 ...................FF.......................FEARSK..TA.C-------------..------
Mpf_ENSMPUP00000010571 ...................FY.......................LYVSQK..EE.--------------..------
Mpf_ENSMPUP00000011589 ...................YF.......................FSAESS..EE.QEAWIQAMGEAA--..------
Mpf_ENSMPUP00000005676 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000002533 ...................TY.......................LQCKNV..NE.LNQWLSALRKASAP..NPDKLA
Mpf_ENSMPUP00000004215 ...................--.......................------..--.-----SALEEAISA..------
Mpf_ENSMPUP00000013399 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010530 ...................IL.......................VSCSNQ..QD.LHEWVDHLQKQT--..------
Mpf_ENSMPUP00000006089 ...................FV.......................LQAASL..AT.KQAWTADISRLLW-..------
Mpf_ENSMPUP00000016498 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000007327 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001749 ...................YI.......................VQAPNV..DV.KMTWLKEIRSILLK..Q-----
Mpf_ENSMPUP00000016475 ikackteadgrvvegnhvvYR.......................ISAPSP..EE.KEEWMKSIRASISR..------
Mpf_ENSMPUP00000013206 ...................YY.......................FSADTQ..ED.MNAWVRAMNQAA--..------
Mpf_ENSMPUP00000006140 ...................HV.......................FRCDTP..A-.--------------..------
Mpf_ENSMPUP00000005780 ...................YE.......................IHTNSK..EE.RNNWMRRIQQAVE-..------
Mpf_ENSMPUP00000001869 ...................IV.......................IHCNSS..QD.FQEWLEQLCRL---..------
Mpf_ENSMPUP00000012475 ...................YR.......................ISAPTP..EE.KEEWIKCIKAAI--..------
Mpf_ENSMPUP00000008316 ...................IQ.......................FQTEDM..ET.AK------------..------
Mpf_ENSMPUP00000001167 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008230 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000017717 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010272 ...................YI.......................LQASSA..EV.KSAWTHVIGQILW-..------
Mpf_ENSMPUP00000003964 ...................YR.......................ISAPTQ..EE.KEEWIKSIQAA---..------
Mpf_ENSMPUP00000017478 ...................FV.......................CMAKTA..EE.KQKWLDAIIR----..------
Mpf_ENSMPUP00000010168 ...................YFvgenngdsshnpv..........LAATGVgvDV.AQSWEKAIRQA---..------
Mpf_ENSMPUP00000009546 ...................FY.......................IQADSP..ED.MHSWIKEIGAAV--..------
Mpf_ENSMPUP00000002870 ...................FY.......................VQADSP..EE.MHSWIKAVSGAI--..------
Mpf_ENSMPUP00000000151 ...................YT.......................LQAASP..EI.KLKWTSSIAQLLWR..------
Mpf_ENSMPUP00000000216 ...................LE.......................LQASSE..QD.KEEWIKALQDTIDA..FHQRHE
Mpf_ENSMPUP00000007012 ...................YE.......................LFFKTR..EL.KKKWMEQFEMAISNi.YPE---
Mpf_ENSMPUP00000012096 ...................FQ.......................FFCKTE..DM.KRKWMEQFEMAMSN..IKPDKA
Mpf_ENSMPUP00000004281 ...................TV.......................LKASNI..ET.KQEWIKNIREVIQE..------
Mpf_ENSMPUP00000004460 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011499 ...................YY.......................FRAESE..YT.FERWMEVIRSA---..------
Mpf_ENSMPUP00000003498 ...................YV.......................LAADTL..ED.LRGWLRALGRA---..------
Mpf_ENSMPUP00000006723 ...................WL.......................FHGKDE..EE.MLSWLQGVSTAINE..------
Mpf_ENSMPUP00000006149 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011052 ...................FI.......................LHSSSP..SV.RQTWIHEINQILEN..------
Mpf_ENSMPUP00000015653 ...................FI.......................FAADTL..ED.LSMWVRHLITCI--..------
Mpf_ENSMPUP00000014937 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006713 ...................YN.......................IQAKTA..EE.KRSWTHHIKRLILE..NH----
Mpf_ENSMPUP00000005370 ...................YY.......................------..--.--------------..------
Mpf_ENSMPUP00000017142 ...................YS.......................FKAEDN..NS.AQRWIKAMEDA---..------
Mpf_ENSMPUP00000011052 ...................IV.......................LKASSI..EN.KQDWIKHIREVIQ-..------
Mpf_ENSMPUP00000000930 ...................--.......................------..LI.KSIWAMAISQHQFY..------
Mpf_ENSMPUP00000016865 ...................--.......................------..LI.KSIWVMAISQHQFY..LDRKQS
Mpf_ENSMPUP00000000090 ...................LE.......................FYCKTK..DL.KKKWLEQFEMALSN..IRPDYA
Mpf_ENSMPUP00000012035 ...................CL.......................FQAEDR..DD.MLAWIKTIQESSTL..NEEDTG
Mpf_ENSMPUP00000009068 ...................LL.......................LMASSQ..RD.MEDWVQAIRRVIWA..PLGGGI
Mpf_ENSMPUP00000000172 ...................YF.......................FRAESK..YT.FGRWMEVIERA---..------
Mpf_ENSMPUP00000013402 ...................--.......................------..--.A-------------..------
Mpf_ENSMPUP00000012726 ...................YV.......................LETADA..LH.VKAWVSDIQECLS-..------
Mpf_ENSMPUP00000010329 ...................HT.......................VQAKSQ..QD.KRLWVLHLKRLILE..NHAAKI
Mpf_ENSMPUP00000005886 ...................YV.......................FQCTNE..AL.--------------..------
Mpf_ENSMPUP00000011911 ...................--.......................------..-A.--------------..------
Mpf_ENSMPUP00000013895 ...................YT.......................LRTDNI..NE.RTAWVQKIKAASEQ..YIDTE-
Mpf_ENSMPUP00000009754 ...................FA.......................FRAESD..AE.RKEWMQALQQAV--..------
Mpf_ENSMPUP00000017452 ...................VE.......................VHASSK..EE.RNSWIHIIQDTI--..------
Mpf_ENSMPUP00000004281 ...................VI.......................LQAANA..DI.QQAWVQDINQVLET..------
Mpf_ENSMPUP00000017577 ...................FL.......................LQAKDE..EE.MNGWLEAV------..------
Mpf_ENSMPUP00000004977 ...................YE.......................VHTASR..DD.RSTWIRVIQQSV--..------
Mpf_ENSMPUP00000017884 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000007027 ...................YY.......................LTADSP..GL.LEEWIRALQSLL--..------
Mpf_ENSMPUP00000012725 ...................YN.......................FCAQDG..QS.AQQWMDRIQSCI--..------
Mpf_ENSMPUP00000000871 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006220 ...................YF.......................LQAATP..KE.RTEWIKAIQVAS--..------
Mpf_ENSMPUP00000008418 ...................--.......................-----R..GD.QDSWVPAMLSVSDS..L-----
Mpf_ENSMPUP00000003932 ...................--.......................------..V-.--------------..------
Mpf_ENSMPUP00000001861 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008418 ...................HV.......................FRCD--..--.--------------..------
Mpf_ENSMPUP00000006249 ...................YV.......................LMASSQ..AE.MEEWVKFLKRV---..------
Mpf_ENSMPUP00000003836 ...................FC.......................FCATSN..QE.MKRWLQAMDKA---..------
Mpf_ENSMPUP00000015858 ...................MY.......................LQCKCV..NE.LNQWLSALRKVSIS..NPGLLG
Mpf_ENSMPUP00000002835 ...................LD.......................LIAPSP..AE.AQHWVQGLRKI---..------
Mpf_ENSMPUP00000004473 ...................LE.......................LQTRTE..EE.KKEWIQVIEATIER..HK----
Mpf_ENSMPUP00000000137 ...................FF.......................FSKVHF..KD.MNRWLNRINML---..------
Mpf_ENSMPUP00000001907 ...................YV.......................LQSADP..AV.SQAWIKQVAQ----..------
Mpf_ENSMPUP00000014024 ...................LE.......................LQARSQ..EE.MISWIQACQAAIDQ..IEKR--
Mpf_ENSMPUP00000001742 ...................LM.......................LCAENR..KE.MEDWMSSLKSVQTRepY-----
Mpf_ENSMPUP00000000172 ...................VV.......................VAASTR..LE.KEKWICDLNTAIDA..------
Mpf_ENSMPUP00000005480 ...................LI.......................LCADNR..KE.MEEWIAALKTVQNRehFEPTQY
Mpf_ENSMPUP00000018515 ...................FA.......................VYAATA..TE.KSEWMNHINKCV--..------
Mpf_ENSMPUP00000009502 ...................FY.......................LCAKTG..VE.ADEWIKILR-----..------
Mpf_ENSMPUP00000013672 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011336 ...................LE.......................LQARTE..EE.KKDWVQAINSTLL-..------
Mpf_ENSMPUP00000001410 ...................LD.......................LVANTA..DV.ANIWVTGLRYL---..------
Mpf_ENSMPUP00000003424 ...................YL.......................FQAKDE..E-.--------------..------
Mpf_ENSMPUP00000007040 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000019493 ...................RI.......................FQAENA..KI.KREWLEVLEETKRA..------
Mpf_ENSMPUP00000018830 ...................FV.......................VSAASA..TE.RQEWISHIEECVR-..------
Mpf_ENSMPUP00000003141 ...................YV.......................FQCASE..S-.--------------..------
Mpf_ENSMPUP00000010983 ...................FH.......................LIAESP..ED.ASQWFSVLSQV---..------
Mpf_ENSMPUP00000010498 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000012786 ...................LL.......................FQAQSP..EE.MQGWINKINCVAAV..FSAPPF
Mpf_ENSMPUP00000014114 ...................CM.......................LQADSE..KL.RQAWVRAVQASIAS..------
Mpf_ENSMPUP00000007256 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005608 ...................WY.......................LRAQDP..DH.RQQWIDAIEQ----..------
Mpf_ENSMPUP00000002033 ...................YN.......................FCAQDV..PS.AQQWVDQIQSC---..------
Mpf_ENSMPUP00000016751 ...........esnlssvcYI.......................FESNNE..GE.K-------------..------
Mpf_ENSMPUP00000016435 ...................LD.......................LVANSA..EE.AKIWMQGLQL----..------
Mpf_ENSMPUP00000001167 ...................FA.......................IAADNE..AE.QDSWYQALL-----..------
Mpf_ENSMPUP00000001585 ...................VQ.......................LKTRNP..TT.GKSWTALCRLVFKL..SVPQH-
Mpf_ENSMPUP00000002351 ...................YI.......................LQAASK..EI.RDCWFSEISKLLME..Q-----
Mpf_ENSMPUP00000011499 ...................VV.......................VAASSR..SE.MEKWVEDIQMAID-..------
Mpf_ENSMPUP00000005375 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015986 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004747 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009754 ...................YL.......................FGLESA..EL.AREWVKCIAKA---..------
Mpf_ENSMPUP00000002257 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000006734 ...................YT.......................FQASGQ..AL.CRGWVDAIYNAQ--..------
Mpf_ENSMPUP00000003502 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000011019 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000003673 ...................FV.......................LQCDSD..PE.LVQWKKELRDAYRE..AQQLV-
Mpf_ENSMPUP00000000383 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008997 ...................FL.......................FQAPSK..EE.MLSWILRINLVAAI..FSAPSF
Mpf_ENSMPUP00000010040 ...................CL.......................LQADSE..RL.LHRWVSAVQSSIA-..------
Mpf_ENSMPUP00000007257 ...................YV.......................FKADDA..HS.AQKWIEAFQ-----..------
Mpf_ENSMPUP00000016774 ...................FL.......................FQAPSL..EQ.MQSWVTRINVVAA-..------
Mpf_ENSMPUP00000001960 ...................IV.......................LGLQSR..DQ.AEQWLRVIQEV---..------
Mpf_ENSMPUP00000007610 ...................LD.......................LVSPSG..DE.ARTWVTGLRYL---..------
Mpf_ENSMPUP00000017612 ...................HL.......................LQAKNQ..EE.KRLWIHCLQRLFFE..NHP---
Mpf_ENSMPUP00000007907 ...................LD.......................LVANSA..DV.ANIWVSGLRYL---..------
Mpf_ENSMPUP00000014021 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000008982 ...................HT.......................FVTDSA..KT.C-------------..------
Mpf_ENSMPUP00000005803 ...................FV.......................FRVEKE..EE.RNDWISILLNA---..------
Mpf_ENSMPUP00000002728 ...................LD.......................LITSNP..EE.ARTWITGLKY----..------
Mpf_ENSMPUP00000007017 ...................YY.......................IQASSK..AE.RAEWIEAIK-----..------
Mpf_ENSMPUP00000003752 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001306 ...................YT.......................LRAESI..NE.R-------------..------
Mpf_ENSMPUP00000005338 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001689 ...................HY.......................LAAETE..QE.MEEWLLTLKKIIQI..NTDSL-
Mpf_ENSMPUP00000010415 ...................LV.......................LAVQSK..EQ.AEQWLKVIR-----..------
Mpf_ENSMPUP00000006220 ...................HF.......................FQAAFL..EE.RDAWVRDIKKAIK-..------
Mpf_ENSMPUP00000016350 ...................VL.......................LQALND..KD.MNDWLYAFN-----..------
Mpf_ENSMPUP00000018773 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000017599 ................vieRT.......................FHVDSP..DE.REEWMRAIQMVANS..------
Mpf_ENSMPUP00000016349 ...................VL.......................LQALND..KD.MNDWLYAFN-----..------
Mpf_ENSMPUP00000015036 ...................YL.......................FQAEDR..DD.MLGWIRAIRENSRA..------
Mpf_ENSMPUP00000007938 ...................FV.......................FRTESE..AQ.RDTWCSTLQSCLR-..------
Mpf_ENSMPUP00000007257 ...................FI.......................LSASSA..TE.RDEWLEAISRSIEE..------
Mpf_ENSMPUP00000005203 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000000650 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000007937 ...................FY.......................FAGETP..EQ.AEDWMKGLQAF---..------
Mpf_ENSMPUP00000007017 ...................YF.......................LEACSR..EE.RDAWAFEITGAIHA..GQPGKV
Mpf_ENSMPUP00000012780 ...................YH.......................LKASSE..VE.RQQWITALELAKAK..AVRMMS
Mpf_ENSMPUP00000002522 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004905 ...................IK.......................FKAESL..ES.REMWKGFILTVVEL..RV----
Mpf_ENSMPUP00000011326 ...................YL.......................LAADSE..AE.MEEWITILNKILQL..NFEAAM
Mpf_ENSMPUP00000009449 ...................YL.......................FQAPTA..KE.MSSWIVRINLAAAT..HSAPPF
Mpf_ENSMPUP00000000014 ...................FT.......................LSAMTS..GI.RRNWIQTIMKHVHP..------
Mpf_ENSMPUP00000012737 ...................YT.......................LSAMTS..GI.RRNWIEALRKTVR-..------
Mpf_ENSMPUP00000002136 ................vieRT.......................FHVETP..EE.REEWTTAIQTVADG..L-----
Mpf_ENSMPUP00000017782 ...................FL.......................LACETE..ME.QRAWVEAFRKVVDR..PM----
Mpf_ENSMPUP00000013550 ...................FV.......................LQCESD..PE.FVQWKKELTETFTE..AQ----
Mpf_ENSMPUP00000017362 ...................IWavkgpkgeavgsitqplpssyliIRATSE..SD.GRCWMDALELAL--..------
Mpf_ENSMPUP00000006996 ...................FH.......................FQARDA..DE.REKWIHALEETILR..H-----
Mpf_ENSMPUP00000004785 ...................YY.......................MVAPSA..EA.MRIWMDVI------..------
Mpf_ENSMPUP00000014164 ...................LV.......................LALQSR..EQ.AEEWLKVIREV---..------
Mpf_ENSMPUP00000016592 ...................FV.......................LAAETE..SD.MDEWIHTLNRI---..------
Mpf_ENSMPUP00000000486 ...................LR.......................LRAETR..QR.AEEWMEALKTAANV..ARSTEQ
Mpf_ENSMPUP00000003712 ...................CM.......................LQADSE..KL.RQAWIKAVQTSIAT..------
Mpf_ENSMPUP00000006850 ...................FY.......................MVAPSP..EA.MRIWMDVIVTAA--..------
Mpf_ENSMPUP00000015574 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000014962 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000016814 ...................LI.......................VQCPSA..TD.RAQWLEK-------..------
Mpf_ENSMPUP00000000139 ...................IL.......................LQANSD..KD.MHDWLYAFN-----..------
Mpf_ENSMPUP00000012020 ..................gII.......................LQAESR..KE.NEEWICAINN----..------
Mpf_ENSMPUP00000006069 ...................LT.......................LLLE--..--.--------------..------
Mpf_ENSMPUP00000017142 ...................LT.......................LSASSC..AE.RDEWHSCLSRAL--..------
Mpf_ENSMPUP00000013991 ...................VT.......................LAAPNR..KD.MEEWINVIKTVQQG..EIR---
Mpf_ENSMPUP00000010353 ...................YL.......................L-----..--.--------------..------
Mpf_ENSMPUP00000000014 ...................HF.......................IRAETK..EI.ISGWLEMLMVYPRT..NKQNQK
Mpf_ENSMPUP00000009546 ...................YF.......................LQANDQ..KD.LKDWVEALNQASKI..------
Mpf_ENSMPUP00000012020 ...................YV.......................FESNSE..GE.K-------------..------
Mpf_ENSMPUP00000016751 ...................SI.......................LQAESK..KD.HEEWICTINN----..------
Mpf_ENSMPUP00000000216 ...................HS.......................FAADSE..EL.KQKWLKIIFL----..------
Mpf_ENSMPUP00000010854 ...................WF.......................FSASSE..DE.RKSWMALLRKE---..------
Mpf_ENSMPUP00000016813 ...................VI.......................FASDDE..QD.RILWVQAMYRATGQ..SHKPVP
Mpf_ENSMPUP00000002870 ...................YF.......................LQANDQ..QD.LVEWVNVLNKAIKI..------
Mpf_ENSMPUP00000003651 ...................FL.......................LQSDID..FI.ILDWFHAIKNAIDR..LPK---
Mpf_ENSMPUP00000002370 ...................FV.......................CMAKTP..EE.KHEWFEAILK----..------
Mpf_ENSMPUP00000006780 ...................VI.......................FASDDE..QD.RVLWVQAMYRATGQ..SYKPI-
Mpf_ENSMPUP00000002802 ...................YV.......................FKAKDE..KN.AEEWLQCINVAV--..------
Mpf_ENSMPUP00000011336 ...................WY.......................FSPETE..EL.QRRWMAVLGR----..------
Mpf_ENSMPUP00000003120 ...................FY.......................MKAVNA..AE.RQRWLVALG-----..------
Mpf_ENSMPUP00000005803 ...................FL.......................FGAETS..QA.QRKWTEAIAKHFVP..FV----
Mpf_ENSMPUP00000004980 ...................FY.......................LKARSV..AE.RQRWLVALGSAK--..------
Mpf_ENSMPUP00000015621 ................vieRT.......................FHVDTP..EE.REEWTEAIQAVADR..LQ----
Mpf_ENSMPUP00000003141 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013099 ...................YH.......................FQAEDE..QE.CQIWMSVLQNSKEE..ALNNAF
Mpf_ENSMPUP00000010983 ...................YR.......................LYTKLL..NE.ATRWSSAIQNVTDT..KAPIDT
Mpf_ENSMPUP00000004910 ............qplpssyLI.......................FRAASE..SD.GRCWLDALELAL--..------
Mpf_ENSMPUP00000016233 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000002953 ...................LL.......................LAFDNT..KV.--------------..------
Mpf_ENSMPUP00000011716 ...................IS.......................LCAEST..DD.CLAWKFTLQDSR--..------
Mpf_ENSMPUP00000007767 ...................LVsqcrdtlcvtknw..........LSADTK..EE.RDLWMQKLNQI---..------
Mpf_ENSMPUP00000014585 ...................FL.......................FTCPSE..KE.QREWLESFQDVL--..------
Mpf_ENSMPUP00000014164 ...................AI.......................LEANCS..ED.MGRWLG--------..------
Mpf_ENSMPUP00000005886 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013797 ...................LH.......................VLCPSQ..AE.LGHWLYHLEKQIA-..------
Mpf_ENSMPUP00000004108 ...................YK.......................LRATDA..KE.RQHWVSRLQICTQH..HTEAIG
Mpf_ENSMPUP00000009167 ...................LS.......................LAADSK..ED.ASKWLSGLK-----..------
Mpf_ENSMPUP00000016226 ...................LE.......................LSADSE..AD.MADWMQHLCQA---..------
Mpf_ENSMPUP00000014024 ...................YT.......................FKAETE..EL.RDRWVKAMERA---..------
Mpf_ENSMPUP00000008448 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010607 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015774 ...................YH.......................FQAEDE..HE.CEAWVSVLQNSKD-..------
Mpf_ENSMPUP00000008639 ...................LD.......................LAAATA..EE.AQRWVRGL------..------
Mpf_ENSMPUP00000012941 ...................LL.......................IQSDND..TV.INDWFKVLSSTISN..QTETDE
Mpf_ENSMPUP00000016218 ...................HT.......................LQANDV..FH.KQQWFNCIRAAI--..------
Mpf_ENSMPUP00000007001 ...................FL.......................FSTETQ..SE.KLRWISALA-----..------
Mpf_ENSMPUP00000001986 ...................YL.......................FQASSQ..TD.LENWVTAIHSACA-..------
Mpf_ENSMPUP00000010415 ...................AV.......................LEASSS..ED.MGRWIGIL------..------
Mpf_ENSMPUP00000003836 ...................FY.......................FCAENK..TE.NQRWIMALKASIK-..------
Mpf_ENSMPUP00000007027 ...................TY.......................LLIGTK..HE.KDTWLYHLTVAAGG..SSA---
Mpf_ENSMPUP00000002688 ...................ML.......................LGAETQ..SE.RARWITALG-----..------
Mpf_ENSMPUP00000001373 ...................YH.......................FQAEDE..QD.YVAWISVLTNSKEE..ALTMAF
Mpf_ENSMPUP00000013700 ...................YL.......................FLLSSD..YE.RSEWREAIQKLQ--..------
Mpf_ENSMPUP00000016589 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015325 ...................LE.......................LRTEDA..KD.CDEWVAAIAHA---..------
Mpf_ENSMPUP00000001960 ...................AK.......................LEAKSS..EE.MGHWLGLL------..------
Mpf_ENSMPUP00000006310 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000016747 ...................HS.......................LQANDT..FN.KQQWLNCIRQA---..------
Mpf_ENSMPUP00000013323 ...................YH.......................LKVKSE..EI.FDEWVSKLRH----..------
Mpf_ENSMPUP00000007350 ...................IL.......................LAAESE..FE.QTQWLEMLQESG--..------
Mpf_ENSMPUP00000017588 ...................LS.......................LQATSE..DE.VNMWVKGLT-----..------
Mpf_ENSMPUP00000007745 ...................LN.......................FIAPDK..HE.YCIWTDGLNA----..------
Mpf_ENSMPUP00000006409 ...................IT.......................LKAATK..QV.MLYWLQQLQTKRW-..------
Mpf_ENSMPUP00000015574 ...................LG.......................VAAACE..AE.QQAWYSALL-----..------
Mpf_ENSMPUP00000008365 ...................YL.......................IQHDSE..AI.ISTWHKAIGEGIQE..LSADLP
Mpf_ENSMPUP00000001054 ...................FL.......................FQTTSQ..TE.LENWITAIHSACAA..AVARHH
Mpf_ENSMPUP00000017488 ...................LN.......................FIAPNK..YE.YCIWIDGLSA----..------
Mpf_ENSMPUP00000005234 ...................YM.......................LKATSQ..SE.MKRWMTSL------..------
Mpf_ENSMPUP00000013182 ...................VY.......................LRCQDE..KQ.YAHWMAGCRLA---..------
Mpf_ENSMPUP00000011513 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005385 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009077 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000001767 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000007827 ...................IT.......................MQALSE..ED.RRLWMEAM------..------
Mpf_ENSMPUP00000000541 ...................IK.......................FQATSG..EE.KESWIKALNE----..------
Mpf_ENSMPUP00000001809 ...................FL.......................LQSDQE..IE.WRAWHRALRAVIER..L-----
Mpf_ENSMPUP00000005803 ...................WH.......................ICCDSL..QT.QMEWMANVFIAQHE..------
Mpf_ENSMPUP00000013182 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005315 ...................LI.......................FLAVSP..EE.KESWISALNSAITR..AKNRIL
Mpf_ENSMPUP00000014585 ...................LF.......................VYHESG..KE.IVDWFNALRAA---..------
Mpf_ENSMPUP00000015166 ...................YH.......................LKIKSQ..DL.FQSWVAQLRAHR--..------
Mpf_ENSMPUP00000002409 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005807 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013796 ...................IR.......................VLCASY..ED.YSHWLLCLQT----..------
Mpf_ENSMPUP00000017782 ...................IF.......................VYHEDG..KE.IVDWFNALRAA---..------
Mpf_ENSMPUP00000019464 ...................HL.......................LAADGP..AA.QEAWVKALSRASFS..YMRL--
Mpf_ENSMPUP00000012725 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000010996 ...................HI.......................FVADNR..ED.LQKWMEAFWQHFFD..LSQWKH
Mpf_ENSMPUP00000007938 ...................LY.......................LSCTNE..DE.MWDWTTSI------..------
Mpf_ENSMPUP00000009654 ...................LH.......................LCAETK..DD.AIAWKTALLEA---..------
Mpf_ENSMPUP00000005385 ...................IW.......................LRCDNE..KQ.YAHWMAACRLAS--..------
Mpf_ENSMPUP00000006310 ...................VY.......................LRCDHE..NQ.YAQWMAACILAS--..------
Mpf_ENSMPUP00000007963 ...................FY.......................LVAETE..ED.MNKWVQSICQICGF..NQAEES
Mpf_ENSMPUP00000002310 ...................WH.......................FEATTY..EE.RDAWVQAIESQILA..SLQ---
Mpf_ENSMPUP00000000486 ...................LQ.......................LKAESP..WE.ALDWGQKLWEVVHA..AVP---
Mpf_ENSMPUP00000007805 ...................--.......................--A---..--.--------------..------
Mpf_ENSMPUP00000010246 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000004460 ...................RT.......................FTCDSE..LE.AEEWYKTLS-----..------
Mpf_ENSMPUP00000014791 ...................WI.......................CATEVE..DD.KFLWLSVLQSAIKS..------
Mpf_ENSMPUP00000003154 ...................YH.......................LKVKSQ..DW.FDAWVSKLRHHRLY..RQ----
Mpf_ENSMPUP00000005214 ...................LL.......................LMCTDQ..EE.LLHWHHSLTLAISS..------
Mpf_ENSMPUP00000003932 ...................FA.......................MVAENE..SE.QESWYLLLS-----..------
Mpf_ENSMPUP00000008710 ...................WH.......................FEASTA..EE.RELWVQSVQAQILA..SL----
Mpf_ENSMPUP00000005632 ...................LN.......................FIAPSK..RE.FHLWTDGLSA----..------
Mpf_ENSMPUP00000002828 ...................YT.......................FLISSD..YE.RAEWRENIREQQ--..------
Mpf_ENSMPUP00000017859 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013754 ...................YK.......................FQTGSR..FH.AILWHKHLDDACKS..NRPQ--
Mpf_ENSMPUP00000004548 ...................IT.......................LQALSE..AN.RRLWMEAM------..------
Mpf_ENSMPUP00000000646 ...................VH.......................FIVPRE..RD.CHDIYNSLLQLSK-..------
Mpf_ENSMPUP00000004473 ...................LY.......................LSTPSA..DL.RQQWLEALSAA---..------
Mpf_ENSMPUP00000000402 ...................KY.......................LCCDDM..RT.LHQWVNGIRIAKYG..------
Mpf_ENSMPUP00000007412 ...................IL.......................LSSDSA..SD.RARWITAL------..------
Mpf_ENSMPUP00000004935 ...................LE.......................IELSSL..KE.A-------------..------
Mpf_ENSMPUP00000011513 ...................TY.......................LLIGSK..HE.KDTWLYHLTVAAGS..------
Mpf_ENSMPUP00000001759 ...................IT.......................LQAFSE..AN.RKLWLEAM------..------
Mpf_ENSMPUP00000008353 ...................LA.......................LRASSQ..DE.AEDWLDRVREALQK..CRPQQE
Mpf_ENSMPUP00000012083 ...................KY.......................LCCDDA..RT.LNQWVMGIRIAK--..------
Mpf_ENSMPUP00000006956 ...................LT.......................MQAFSE..EE.RKQWLEAL------..------
Mpf_ENSMPUP00000014860 ...................RV.......................FCSEDE..QS.RGCWLAAFRLFKYG..------
Mpf_ENSMPUP00000009647 ...................II.......................FNAPSL..QD.RLRFTSDLRESIAE..VQEM--
Mpf_ENSMPUP00000005803 ...................FS.......................FTAESE..KE.KQEWIEAVQQSIAE..TL----
Mpf_ENSMPUP00000005109 ...................YK.......................FQAGNR..MN.AMLWFKHLSAACQS..NKQQ--
Mpf_ENSMPUP00000006149 ...................KT.......................FACESD..LE.ADEWCKVLQM----..------
Mpf_ENSMPUP00000001981 ...................WH.......................FEAASF..EE.RDAWVQAIESQILA..S-----
Mpf_ENSMPUP00000017916 ...................LH.......................FCALGS..DE.MQKFVEDLKESIA-..------
Mpf_ENSMPUP00000003318 ...................FV.......................ATFSSP..EQ.KDKWLSLLQRY---..------
Mpf_ENSMPUP00000017175 ...................IN.......................FNAPNP..QD.RKKFTDDLRESIAE..VQEM--
Mpf_ENSMPUP00000016038 ...................FY.......................LVAKTE..VE.MLVWVYSISQVCNL..------
Mpf_ENSMPUP00000016192 ...................FL.......................LRARTE..SE.KQRWISALC-----..------
Mpf_ENSMPUP00000015325 ...................VI.......................LVASSR..QE.KAAWTSDISQCVD-..------
Mpf_ENSMPUP00000000660 ...................KM.......................LCAEEE..QS.RTCWVTAIRLLK--..------
Mpf_ENSMPUP00000005493 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000009754 ...................WY.......................LCCETQ..ME.LREWFATFLFVQHD..GLVWPS
Mpf_ENSMPUP00000013796 ...................LH.......................VLCPSQ..AE.LGHWLYHLEKQIA-..------
Mpf_ENSMPUP00000010667 ...................FR.......................FDAESK..E-.--------------..------
Mpf_ENSMPUP00000013126 ...................LE.......................LACETQ..EE.VDSWKASFLRA---..------
Mpf_ENSMPUP00000018046 ...................RL.......................LCAEDE..QG.RTCWMTACRLLKY-..------
Mpf_ENSMPUP00000006359 ...................LN.......................LVAFQE..EV.AKEWTNEVF-----..------
Mpf_ENSMPUP00000015086 ...................FH.......................F-----..--.--------------..------
Mpf_ENSMPUP00000008387 ...................VV.......................LLAPSR..QE.KAAWMSDISQCVD-..------
Mpf_ENSMPUP00000015207 ...................VR.......................CHFSTF..KQ.CQEWLSRLSRATAR..PAKP--
Mpf_ENSMPUP00000004217 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000015689 ...................--.......................L-----..--.--------------..------
Mpf_ENSMPUP00000015159 ...................L-.......................------..--.--------------..------
Mpf_ENSMPUP00000018833 ...................--.......................------..--.-----------I--..------
Mpf_ENSMPUP00000007866 ...................HT.......................LQTESR..GA.LHSWMEALWQLFFD..MSQWKQ
Mpf_ENSMPUP00000007938 ...................FS.......................FTAESG..GA.RQSWAAALQEAVTE..TLSDYE
Mpf_ENSMPUP00000010694 ...................GI.......................IQCLSA..ED.CVDWLQAIAT----..------
Mpf_ENSMPUP00000013131 ...................IR.......................CQFSTF..EQ.CQEWLKRLNNAIRP..PAK---
Mpf_ENSMPUP00000000312 ...................FT.......................LVSSTP..QE.KTKWLRAISQAVDQ..ALR---
Mpf_ENSMPUP00000019132 ...................ID.......................FRCP--..--.--------------..------
Mpf_ENSMPUP00000015959 ...................RC.......................FSCRSA..AE.RDRWIEDLRRHFQP..SQDNLE
Mpf_ENSMPUP00000012612 ...................YR.......................ISASSA..EE.RDQWIEAIRASITR..------
Mpf_ENSMPUP00000007938 ...................QH.......................FGTDGA..DS.LEAWTSA-------..------
Mpf_ENSMPUP00000007989 ...................RL.......................LQASSL..SD.MQRWLGA-------..------
Mpf_ENSMPUP00000016156 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000013721 ...................YY.......................FCMMTE..AE.QDKWQAVLQDCIRH..------
Mpf_ENSMPUP00000005447 ...................ML.......................LLACSQ..DE.QKKWVTHLVKKI--..------
Mpf_ENSMPUP00000015768 ...................LC.......................FSAATG..EA.QRAWRLALQ-----..------
Mpf_ENSMPUP00000004215 ...................YQ.......................LAAP-A..SE.RSDWIQAIC-----..------
Mpf_ENSMPUP00000010108 ...................VR.......................LCSPRQ..AE.AERWGLALREVI--..------
Mpf_ENSMPUP00000002188 ...................II.......................FEVGDE..QQ.LNSWMAELRECT--..------
Mpf_ENSMPUP00000013446 ...................LL.......................LLANST..EE.QQKWVSRLVKK---..------
Mpf_ENSMPUP00000012407 ...................VL.......................LLAESE..AE.RERWLQVLGELQRL..LL----
Mpf_ENSMPUP00000017043 ...................LI.......................LKCNSY..RH.ARWWGGAIEEFI--..------
Mpf_ENSMPUP00000007898 ...................FT.......................LEAHSQ..EQ.K-------------..------
Mpf_ENSMPUP00000017064 ...................LS.......................FQMTSE..ELpKENWLKMLCRHV--..------
Mpf_ENSMPUP00000009754 ...................FS.......................FSAESE..LE.KEQWLEAMQGAIAE..ALST--
Mpf_ENSMPUP00000016461 ..............rqrwpVR.......................LAAATE..QD.MNDWLALLNLSCCE..------
Mpf_ENSMPUP00000008230 ...................HL.......................LAADAP..SS.-AAWVQTLCRNAFP..K-----
Mpf_ENSMPUP00000001993 ...................YF.......................LIGQDR..EK.IKDWVSFVSSF---..------
Mpf_ENSMPUP00000014500 ...................YH.......................LKASSE..VE.RQRWVTALELAKAK..A-----
Mpf_ENSMPUP00000002405 ...................KC.......................FACRSA..AE.RDKWIENLQRAVKP..NKDNS-
Mpf_ENSMPUP00000002933 ...................LY.......................LLAPSF..PD.KQRWVTALESVV--..------
Mpf_ENSMPUP00000007268 ...................KC.......................FSCRSA..AE.RDKWMENLRRAVHP..NKDN--
Mpf_ENSMPUP00000010983 ...................LH.......................CNADTP..EE.MHHWITLLQRS---..------
Mpf_ENSMPUP00000010498 ...................VM.......................LGFESR..EA.MCAWDTRIRYALGE..------
Mpf_ENSMPUP00000018101 ...................VP.......................ILADSE..NE.KWEWVRVLRDL---..------
Mpf_ENSMPUP00000002033 ...................--.......................------..--.----------E---..------
Mpf_ENSMPUP00000010694 ...................LY.......................FSVELE..SD.LAQWERAFQTA---..------
Mpf_ENSMPUP00000008353 ...................LK.......................LQAGSA..EE.AALWRDLVRKVLAS..YLET--
Mpf_ENSMPUP00000009754 ...................LY.......................IQGERR..LD.FTGWLGAIQKAAAS..SGDTLS
Mpf_ENSMPUP00000015718 ...................VL.......................MLAESE..NE.RNKWVGVLSEL---..------
Mpf_ENSMPUP00000002358 ...................LL.......................ILTENE..NE.KRKWVGILE-----..------
Mpf_ENSMPUP00000005077 ...................KC.......................FSCNSA..SE.RDKWMENLRRTVQP..NKDNC-
Mpf_ENSMPUP00000009107 ...................TP.......................WAAPSE..GQ.AESRIPALSSAAAQ..SL----
Mpf_ENSMPUP00000016101 ...................VV.......................FITPNP..LS.KISWVNRLHLAKIG..LRE---
Mpf_ENSMPUP00000011911 ...................HL.......................LAA---..QH.RQEWMGPICQLAFQ..G-----
Mpf_ENSMPUP00000007938 ...................LY.......................LQGEGR..LD.FSAWNTAIEGAAGG..G-----
Mpf_ENSMPUP00000009676 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000005809 ...................I-.......................------..--.--------------..------
Mpf_ENSMPUP00000016410 ...................YY.......................ICFDTF..TE.YLRWLRQVSKVASQ..------
Mpf_ENSMPUP00000006638 ...................M-.......................------..--.--------------..------
Mpf_ENSMPUP00000005803 ...................LY.......................IHGHSK..LD.FTVWHTAIEKAAG-..------
Mpf_ENSMPUP00000010983 ...................--.......................------..--.--------------..------
Mpf_ENSMPUP00000000717 ...................ME.......................LKLSSH..EE.ALSFVSLI------..------
Mpf_ENSMPUP00000002793 ...................AV.......................FNTFTP..AI.KESWLNSLQMAKLA..------
Mpf_ENSMPUP00000007833 ...................YH.......................VSFETL..AE.CQRWQ---------..------
Mpf_ENSMPUP00000002271 ...................YL.......................LMASTQ..ND.MEDWVKSIRRVIWG..P-----
Mpf_ENSMPUP00000010974 ...................IE.......................LACDSQ..ED.VDSWKASFLRA---..------
Mpf_ENSMPUP00000010755 ...................LI.......................LKCGSY..RQ.ARWWGQEITEL---..------
Mpf_ENSMPUP00000013112 ...................--.......................------..--.--------------..------


                             140       150                                                          
                               |         |                                                          
d1wg7a_                QEKRNGDSHE---------ddesgpssg.................................................
Mpf_ENSMPUP00000000236 -------------------eygklfdfvnakklnikn........................................
Mpf_ENSMPUP00000001054 -------------------dkhrrq....................................................
Mpf_ENSMPUP00000001986 -------------------nfrrh.....................................................
Mpf_ENSMPUP00000006133 -------------------silgrsnlkfagmpitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyva
Mpf_ENSMPUP00000009494 -------------------dhplrtisyiadignivvlmarrrlprsnsqenveashpsqdgkrqykmvchvfesed
Mpf_ENSMPUP00000004093 -------------------ergtgdvkllkhkekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvwntha
Mpf_ENSMPUP00000012215 -------------------gmnikltistcsltlmnidnqqiianhhmqsisfasggdpdttdyvayvakdpvnqra
Mpf_ENSMPUP00000016175 -------------------dgngrrafigigfvdrgdafdfnvalqdhfkwvkq.......................
Mpf_ENSMPUP00000009909 -------------------rgswkkkapnkalasilgksnlrfagmsiavsistdglnlsvpatrqiianhhmqsis
Mpf_ENSMPUP00000010977 -------------------halrtisyiadignivvlmarrrmprsasqdciettpgaqegkkqykmichvfeseda
Mpf_ENSMPUP00000016638 -------------------qdgtgrsafigigftdrgdafdfnvslqdhfkwvkq......................
Mpf_ENSMPUP00000018612 -------------------llkhtekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpk
Mpf_ENSMPUP00000018966 -------------------llkhtekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpk
Mpf_ENSMPUP00000004660 -------------------q.........................................................
Mpf_ENSMPUP00000002149 KYHPCFWIDGQYLCCS---qtaknamgcqil..............................................
Mpf_ENSMPUP00000018066 -------------------witdgpcsrvfgfvarkqgsatdnvchlfaehdpeqpasaivnfvskvmi........
Mpf_ENSMPUP00000017958 -------------------gfiimnrlsmenrtepitkdldfqlqdpfllyrnarlsiygiwfydkeecqriaelmk
Mpf_ENSMPUP00000011450 -------------------eikanlisediesaisds........................................
Mpf_ENSMPUP00000016402 -------------------kwmkteggvpaklfgfvarkqgsttdnachlfaeldpnqpasaivnfvsknkck....
Mpf_ENSMPUP00000004951 -------------------itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksq
Mpf_ENSMPUP00000011363 -------------------kniiaeheirniscaaqdpedlstfayitkdlksnhhychvftafdvnlayeiiltlg
Mpf_ENSMPUP00000015445 -------------------aarlardksqekietssnhsqvs...................................
Mpf_ENSMPUP00000015195 -------------------fl........................................................
Mpf_ENSMPUP00000011751 -------------------vrldqetgfsitelqrkqamlna...................................
Mpf_ENSMPUP00000009831 IGFEI--------------senqkrqaam................................................
Mpf_ENSMPUP00000004111 -------------------halqtisyiadigsvlvlmarrrlarrpasqapshklykmlchvfhsedaqliaqaig
Mpf_ENSMPUP00000005349 KYHPKFWADGSYQCCR---qteklapgceky..............................................
Mpf_ENSMPUP00000006137 -------------------rwanpdgttskifgfvakkpgspwenvchlfaeldpdqpa..................
Mpf_ENSMPUP00000009095 VYHPSAYLNGHWLCCR---assdtapgcspct.............................................
Mpf_ENSMPUP00000005832 -------------------vvgwkmqpeqqvvincaivrgikynqatpsfhqwrdarqvwglnfgskedaaqfaaam
Mpf_ENSMPUP00000014567 -------------------gmdpeqrkwqkyckpswifgfvaksqtesqenvchlfaeydpvqpasqvislvrtllq
Mpf_ENSMPUP00000015198 -------------------qshpd.....................................................
Mpf_ENSMPUP00000008441 -------------------skqiianhhmqsisfasggdpdttdyvayvakdpvnrrachileccdglaqdvigsig
Mpf_ENSMPUP00000005146 -------------------prlrinkrilqlcmgnhelymrrrkpdtievqqmkaqareekhqkqlerqqletekkr
Mpf_ENSMPUP00000010667 -------------------gigdikilqnydnkqvrivmrrdqvlklcanhritpdmtlqnmkgtervwvwtacdfa
Mpf_ENSMPUP00000000642 MG-----------------meisenqkklamln............................................
Mpf_ENSMPUP00000015373 -------------------vsyfydatrnvyriisiggakaiinstvtpnmtftktsqkfgqwadsrantvyglgfa
Mpf_ENSMPUP00000003213 -------------------irniscaaqdpedlctfayitkdlqtshhychvfstvdvnltyeiiltlgqafevayq
Mpf_ENSMPUP00000012196 -------------------snkhlcyvfdsekcaeeitltigqafdlayrkfl........................
Mpf_ENSMPUP00000012194 -------------------lgvisrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpv
Mpf_ENSMPUP00000003212 -------------------irniscaaqdpedlctfayitkdlqtshhychvfstvdvnltyeiiltlgqafevayq
Mpf_ENSMPUP00000001158 -------------------kkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqme
Mpf_ENSMPUP00000010667 -------------------htmknyyrilmrrdqvfkvcanhvitktmelkplnvsnnalvwtasdyadgeakveql
Mpf_ENSMPUP00000013386 MYHPNFWMDGRWRCCA---qqeklavgcaqy..............................................
Mpf_ENSMPUP00000016712 -------------------rsaspyhgftivnrlnmhnlvepvnkdlefqlhepfllyrnaslsiysiwfydkndch
Mpf_ENSMPUP00000003302 -------------------prlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqleraqlenekkk
Mpf_ENSMPUP00000003768 -------------------sfcapdrnfdrafsyicrdgttrrwichcfmavkdtgerlshavgcafaaclerkq..
Mpf_ENSMPUP00000008012 -------------------gaivrcdavlppgrsrsllllvcqeperthpdvhffqglrlgaelirediqgalhdy.
Mpf_ENSMPUP00000002625 KYHSGFFVDGKFLCC----qqsckaapgctl..............................................
Mpf_ENSMPUP00000010667 -------------------rmlmrreqvlkvcanhwitttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktp
Mpf_ENSMPUP00000006140 -------------------echvfwcepnagnvseavqaacmlryqk..............................
Mpf_ENSMPUP00000015670 -------------------vsprgiiltdnitnqlienvsiyrisyctadkmhdkvfayiaqsqhnenlechaflct
Mpf_ENSMPUP00000008341 -------------------tvvsgpdmvdltfhnfvsykenvgkswaedvlalvkhpltan................
Mpf_ENSMPUP00000017573 -------------------nldkafsyicrdgttrrwichcflalkdsgerlshavgcafaaclerkqrreke....
Mpf_ENSMPUP00000012859 -------------------yarlpkdpkirevlgfggpdarleeklmtvvagpdpvnttflnfmavqddtakvwtee
Mpf_ENSMPUP00000012131 FYHPSAYLNGNWLCCL---etsenalgckpct.............................................
Mpf_ENSMPUP00000000172 -------------------fliklhpevrgpyqdtlefllgsrdecknfwkicveyhtffrlldqpkakakavffsr
Mpf_ENSMPUP00000013200 -------------------vnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqmerqrlarekqmreea
Mpf_ENSMPUP00000003522 -------------------r.........................................................
Mpf_ENSMPUP00000011499 -------------------anssyqdtleflmasrdfcksfwkicvehhaffrlfeepkpkpkpvlfsrgssfrfsg
Mpf_ENSMPUP00000011494 -------------------kqeghsrrdmfeiltryafplahslpifafln..........................
Mpf_ENSMPUP00000012716 -------------------i.........................................................
Mpf_ENSMPUP00000002913 -------------------qvyglnfaskeeattfsnamlfalnimnsqeggpstqrqvqngpspeemdiqrrqv..
Mpf_ENSMPUP00000003504 -------------------l.........................................................
Mpf_ENSMPUP00000004361 -------------------iqdhqvvincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalev
Mpf_ENSMPUP00000017389 -------------------rygydsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvern
Mpf_ENSMPUP00000015829 -------------------pgdse.....................................................
Mpf_ENSMPUP00000003644 -------------------ietkeeldsyrldsiqamdtalntcsynsilsitvqesglpatstllfqcqevgaeql
Mpf_ENSMPUP00000006376 -------------------rann......................................................
Mpf_ENSMPUP00000014536 -------------------kvrpaeleqfestigfklpnhraakrlwkvcvehhtfyrlvspeqppkakfltlgskf
Mpf_ENSMPUP00000011501 -------------------sklgifenlnklafplsngqilfafsyk..............................
Mpf_ENSMPUP00000017670 -------------------kvciehhtffrlvspepppkgflvmgskfrysgrtqaqtrqasalidrpapffersss
Mpf_ENSMPUP00000006727 -------------------eqelynnfvynsprgyfhtfagdtcqvalnfaneeeakkfrkavtdllgrr.......
Mpf_ENSMPUP00000000961 -------------------wkacvehhtffrldrplppqknffahyftlgskfrycgrtevqsvqygkekankdrvf
Mpf_ENSMPUP00000004942 -------------------rpgefeqfestigfklpnhraakrlwkvcvehhtffrlllpeappkkfltlgskfrys
Mpf_ENSMPUP00000002151 -------------------leftmasrdackafwktcveyhaffrlseepkskpktllcskgssfrysgrtqrqlle
Mpf_ENSMPUP00000014680 -------------------rafgyvcggegqhqffaiktgqqaeplvidlkdlfqviynvkkkeeekkk........
Mpf_ENSMPUP00000005563 -------------------m.........................................................
Mpf_ENSMPUP00000011333 -------------------ld........................................................
Mpf_ENSMPUP00000000969 -------------------wkcavehhaffrlrgpvqksshrsgfirlgsrfrysgkteyqttktnkprrstsferr
Mpf_ENSMPUP00000010395 LD-----------------vtmlqeekeeqmrlpsad........................................
Mpf_ENSMPUP00000015361 -------------------irpgeqeqyestigfklpsyraakklwkvcvehhtffrltstdtlpkskflalgskfr
Mpf_ENSMPUP00000001991 -------------------kekkamlafhtstpaackhlwkcgvenqafykyakssqiktvssskiffkgsrfrysg
Mpf_ENSMPUP00000005637 -------------------isfcgyhpknnkyfgfitkhpadhrfachvfvseestkalaesvgrafqqfykqfv..
Mpf_ENSMPUP00000007307 -------------------tckhlwkcavehhsffrlrtpgnsksnrsdfirlgsrfrfsgrteyqathgsr.....
Mpf_ENSMPUP00000008193 -------------------mlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisq.......
Mpf_ENSMPUP00000007177 -------------------ta........................................................
Mpf_ENSMPUP00000010360 -------------------reasqhr...................................................
Mpf_ENSMPUP00000010611 -------------------sdk.......................................................
Mpf_ENSMPUP00000007161 -------------------im........................................................
Mpf_ENSMPUP00000006134 -------------------ecyvrkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgvrkaiedlie.....
Mpf_ENSMPUP00000004983 LDSVLLKEENEQ-------plrlpspd..................................................
Mpf_ENSMPUP00000001920 -------------------ltiaenmadlidgycrlvngatqsfiirp.............................
Mpf_ENSMPUP00000013542 -------------------lyglqtgrllweqelysqlvystptpffhtfagdacqaglnfadegeaqvfralvqek
Mpf_ENSMPUP00000008337 -------------------sc........................................................
Mpf_ENSMPUP00000013626 -------------------kcqkispegkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
Mpf_ENSMPUP00000001949 -------------------v.........................................................
Mpf_ENSMPUP00000017721 -------------------vn........................................................
Mpf_ENSMPUP00000001109 -------------------nvs.......................................................
Mpf_ENSMPUP00000001935 -------------------shffqmknisfcgchprnscyfgfitkhpllsrfachvfvsqesmrpvaqsvgrafle
Mpf_ENSMPUP00000006252 -------------------mqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrs.......
Mpf_ENSMPUP00000005676 -------------------ledetlklvepqsqallhaqpivsirvwgvgrdsgrdfayvardkltqmlkchvfrce
Mpf_ENSMPUP00000005196 -------------------vgetpggapggpsgqgaeaargwetairqalm..........................
Mpf_ENSMPUP00000012589 -------------------khlwkcsvehhtffrmpenesnslsrklskfgsmsykhrysgrtalqmsrdlsiqlpr
Mpf_ENSMPUP00000010571 -------------------kkiiltyfaptpeackhlwkcgienqafyklekssqvrtvsssnlffkgsrfrysgrv
Mpf_ENSMPUP00000011589 -------------------r.........................................................
Mpf_ENSMPUP00000005676 -------------------pshvsvapatltilhqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmf
Mpf_ENSMPUP00000002533 SCHPGAFRSSRWTCCL---qaersaagcsrth.............................................
Mpf_ENSMPUP00000004215 -------------------qknsthpgppsqpatvpavlprpespys..............................
Mpf_ENSMPUP00000013399 -------------------gqgifafkcsraeeifnllqdlmqcnsinvmeepvivtrnshpaelglp.........
Mpf_ENSMPUP00000010530 -------------------k.........................................................
Mpf_ENSMPUP00000006089 -------------------rqaihn....................................................
Mpf_ENSMPUP00000016498 -------------------tfesgrmcdtgeglftfqtregemiyqkvhsatlaiaeqherlmlemeqkarlqtslt
Mpf_ENSMPUP00000007327 -------------------ivafnmlnyrscknlwkscvehhtffqakkllpqeknvlaqywtmgsrnpkksvnnqy
Mpf_ENSMPUP00000001749 -------------------qell......................................................
Mpf_ENSMPUP00000016475 -------------------dpfy......................................................
Mpf_ENSMPUP00000013206 -------------------q.........................................................
Mpf_ENSMPUP00000006140 -------------------kaiatslheicskimae.........................................
Mpf_ENSMPUP00000005780 -------------------sc........................................................
Mpf_ENSMPUP00000001869 -------------------i.........................................................
Mpf_ENSMPUP00000012475 -------------------..........................................................
Mpf_ENSMPUP00000008316 -------------------yvwrlcvarhkfyrlnqcslqtqtvtvnpirrrsssrvslpkpqpyvmppppqrhyng
Mpf_ENSMPUP00000001167 -------------------nirrcghsenfffievgrsavtgpgefwmqvddsvvaqnmhetileamram.......
Mpf_ENSMPUP00000008230 -------------------mfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqkv..................
Mpf_ENSMPUP00000017717 -------------------ifhhwslgdckfgltfqspaeadefqksllaalaal......................
Mpf_ENSMPUP00000010272 -------------------rqalr.....................................................
Mpf_ENSMPUP00000003964 -------------------v.........................................................
Mpf_ENSMPUP00000017478 -------------------ereq......................................................
Mpf_ENSMPUP00000010168 -------------------lm........................................................
Mpf_ENSMPUP00000009546 -------------------q.........................................................
Mpf_ENSMPUP00000002870 -------------------vaq.......................................................
Mpf_ENSMPUP00000000151 -------------------qaahn.....................................................
Mpf_ENSMPUP00000000216 TF-----------------rnaiakdndmqsevstaelgkrap..................................
Mpf_ENSMPUP00000007012 -------------------natanghdfqmfsfeettscracqmllrgtfyq.........................
Mpf_ENSMPUP00000012096 N------------------anhhsfqmytfdkttnckacrmflrgtfyq............................
Mpf_ENSMPUP00000004281 -------------------riihl.....................................................
Mpf_ENSMPUP00000004460 -------------------hnprvklvswplcslrrygrdatrftfeagrmcdageglytfqtqegeqiyqrvhsat
Mpf_ENSMPUP00000011499 -------------------t.........................................................
Mpf_ENSMPUP00000003498 -------------------s.........................................................
Mpf_ENSMPUP00000006723 -------------------sq........................................................
Mpf_ENSMPUP00000006149 -------------------ftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeqherllqsvkns.......
Mpf_ENSMPUP00000011052 -------------------qrnfl.....................................................
Mpf_ENSMPUP00000015653 -------------------s.........................................................
Mpf_ENSMPUP00000014937 -------------------rlimrnqgslrlilnsklwaqmeiqranhknlritatdledysikvfliqasakdtgc
Mpf_ENSMPUP00000006713 -------------------htt.......................................................
Mpf_ENSMPUP00000005370 -------------------vgenvvnpsspppnssvltsgvgadvarmwemaiqhalm...................
Mpf_ENSMPUP00000017142 -------------------s.........................................................
Mpf_ENSMPUP00000011052 -------------------e.........................................................
Mpf_ENSMPUP00000000930 -------------------ldrkqskskihaarslseiaidltetgtlktsklanmgskgkiis.............
Mpf_ENSMPUP00000016865 -------------------kakipsarslddiamdltetgtprvskmvtleaksqfimasn................
Mpf_ENSMPUP00000000090 DS-----------------nfhefkmhtfnrvtsckvcqmllrgtfyq.............................
Mpf_ENSMPUP00000012035 V------------------tnrdlisrr.................................................
Mpf_ENSMPUP00000009068 FGQ----------------rledtvhherkygprlapllveqcvdfirerglteeg.....................
Mpf_ENSMPUP00000000172 -------------------..........................................................
Mpf_ENSMPUP00000013402 -------------------kyisrlfatrhkfykqnkicteqsnspppirrqptwsrsslprqqpyilppmhvqcge
Mpf_ENSMPUP00000012726 -------------------pgpcp.....................................................
Mpf_ENSMPUP00000010329 PA-----------------kakqailemdaihyp...........................................
Mpf_ENSMPUP00000005886 -------------------vdeimltlkqaftvaavq........................................
Mpf_ENSMPUP00000011911 -------------------lytwpyrflrkfgsdkdvfsfeagrrcdsgeglfafssprapdlcravaaaiarqrer
Mpf_ENSMPUP00000013895 -------------------kkk.......................................................
Mpf_ENSMPUP00000009754 -------------------a.........................................................
Mpf_ENSMPUP00000017452 -------------------n.........................................................
Mpf_ENSMPUP00000004281 -------------------qrdfl.....................................................
Mpf_ENSMPUP00000017577 -------------------aasvg.....................................................
Mpf_ENSMPUP00000004977 -------------------r.........................................................
Mpf_ENSMPUP00000017884 -------------------eqaagigksakivvhlhpappnkepgpfqssknsyiklsfkehgqiefyrrlseemtq
Mpf_ENSMPUP00000007027 -------------------kv........................................................
Mpf_ENSMPUP00000012725 -------------------..........................................................
Mpf_ENSMPUP00000000871 -------------------slaeaenmadlvdgycrlqgehkgsliihp............................
Mpf_ENSMPUP00000006220 -------------------r.........................................................
Mpf_ENSMPUP00000008418 -------------------mtahriqaeagaeeeplwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcqph
Mpf_ENSMPUP00000003932 -------------------asvvvqllsirrcghseqyfflevgrstvigpgelwmqvddcvvaqnmhelflekmra
Mpf_ENSMPUP00000001861 -------------------kkidtkvlayteglhgkwmfseiravfsrryllqntalevfmanrtsvmfnfpdqatv
Mpf_ENSMPUP00000008418 -------------------vpakaiasalhglcaqilservgvn.................................
Mpf_ENSMPUP00000006249 -------------------a.........................................................
Mpf_ENSMPUP00000003836 -------------------a.........................................................
Mpf_ENSMPUP00000015858 SYHPGVFRGDKWSCCHQ--kdksdlgcdkt...............................................
Mpf_ENSMPUP00000002835 -------------------i.........................................................
Mpf_ENSMPUP00000004473 -------------------qn........................................................
Mpf_ENSMPUP00000000137 -------------------t.........................................................
Mpf_ENSMPUP00000001907 -------------------ilesqrdfl.................................................
Mpf_ENSMPUP00000014024 -------------------netfkaavqgpegdtqeqeqlqseelglrapqwvrdkmvtmcmrcr............
Mpf_ENSMPUP00000001742 -------------------evaqfnvehfsgmhnwyacsharpt.................................
Mpf_ENSMPUP00000000172 -------------------ak........................................................
Mpf_ENSMPUP00000005480 SMDHFSGM-----------hnwyacsharpt..............................................
Mpf_ENSMPUP00000018515 -------------------td........................................................
Mpf_ENSMPUP00000009502 -------------------..........................................................
Mpf_ENSMPUP00000013672 -------------------rdamqsfmmpfylmkdceikqpvfganyikgtvkaeagggwegaasykltftaggaie
Mpf_ENSMPUP00000011336 -------------------kheqt.....................................................
Mpf_ENSMPUP00000001410 -------------------i.........................................................
Mpf_ENSMPUP00000003424 -------------------t.........................................................
Mpf_ENSMPUP00000007040 -------------------hfkkidpkilayteglhgkwlfteirsifsrryllqntaleifmanrvavmfnfpdpa
Mpf_ENSMPUP00000019493 -------------------lsek......................................................
Mpf_ENSMPUP00000018830 -------------------rq........................................................
Mpf_ENSMPUP00000003141 -------------------lvdevmltlrqafstaa.........................................
Mpf_ENSMPUP00000010983 -------------------..........................................................
Mpf_ENSMPUP00000010498 -------------------agvfflssaegeqisflfdcivrgisptkgpfglrpvlpdps................
Mpf_ENSMPUP00000012786 PAAIGSQKKF---------srpllp....................................................
Mpf_ENSMPUP00000014114 -------------------ayr.......................................................
Mpf_ENSMPUP00000007256 -------------------iakditdhrafgyvcgkegnhrfvaiktaqaaepvildlrdlfqliyelkqreelekk
Mpf_ENSMPUP00000005608 -------------------h.........................................................
Mpf_ENSMPUP00000002033 -------------------l.........................................................
Mpf_ENSMPUP00000016751 -------------------icdsvglakqialhaeldrr......................................
Mpf_ENSMPUP00000016435 -------------------lv........................................................
Mpf_ENSMPUP00000001167 -------------------q.........................................................
Mpf_ENSMPUP00000001585 -------------------vsllpgqvirlrevlererkrr....................................
Mpf_ENSMPUP00000002351 -------------------qns.......................................................
Mpf_ENSMPUP00000011499 -------------------la........................................................
Mpf_ENSMPUP00000005375 -------------------gnsvvllfkmistraasglyraitethafyrcdtvtsavmmqysrdlkghlaslflne
Mpf_ENSMPUP00000015986 -------------------gevllmahalrrilystwcpadcqfafmarnpqspanklfchlfvgnqpgevqilhll
Mpf_ENSMPUP00000004747 -------------------dgttesncfaftesshgseefqihvfsceikeavsrilysfctafkrssrqvtdv...
Mpf_ENSMPUP00000009754 -------------------..........................................................
Mpf_ENSMPUP00000002257 -------------------yllhlcssqhkfqlqmrarqsnqdaq................................
Mpf_ENSMPUP00000006734 -------------------nq........................................................
Mpf_ENSMPUP00000003502 -------------------wdeskmlvmqdpiyrifyvshdsqdlkifsyiardgasnifrcnvfkskkksqamriv
Mpf_ENSMPUP00000011019 -------------------rkqkvlgpnqklkfnpteliiyckdfrivrfrfdesgpesakkvclaiahysqptdlq
Mpf_ENSMPUP00000003673 -------------------qrvpkm....................................................
Mpf_ENSMPUP00000000383 -------------------qsnyflnfkkevrnkvysrllsl...................................
Mpf_ENSMPUP00000008997 PAAVSSMKKF---------crpllp....................................................
Mpf_ENSMPUP00000010040 -------------------sa........................................................
Mpf_ENSMPUP00000007257 -------------------e.........................................................
Mpf_ENSMPUP00000016774 -------------------mf........................................................
Mpf_ENSMPUP00000001960 -------------------s.........................................................
Mpf_ENSMPUP00000007610 -------------------m.........................................................
Mpf_ENSMPUP00000017612 -------------------as........................................................
Mpf_ENSMPUP00000007907 -------------------v.........................................................
Mpf_ENSMPUP00000014021 -------------------cvrghdgtpesdcfafteshynaelfrihvfrceiqeavsrilysfatafrrsak...
Mpf_ENSMPUP00000008982 -------------------kyllrlcsaqhgfnaqmsslpvaav.................................
Mpf_ENSMPUP00000005803 -------------------l.........................................................
Mpf_ENSMPUP00000002728 -------------------lm........................................................
Mpf_ENSMPUP00000007017 -------------------k.........................................................
Mpf_ENSMPUP00000003752 -------------------iqlfrenqgvarvetsimdakplvllmewpeatnfacliagycrllldsrkmvfsr..
Mpf_ENSMPUP00000001306 -------------------..........................................................
Mpf_ENSMPUP00000005338 -------------------yqdgyysvqttegeqiaqliagyidii...............................
Mpf_ENSMPUP00000001689 -------------------vqekk.....................................................
Mpf_ENSMPUP00000010415 -------------------d.........................................................
Mpf_ENSMPUP00000006220 -------------------c.........................................................
Mpf_ENSMPUP00000016350 -------------------..........................................................
Mpf_ENSMPUP00000018773 -------------------yllhrvtycvadarlpkvfawvyrhelkhkavmlrchavlvskpekaqamalllyqts
Mpf_ENSMPUP00000017599 -------------------lkq.......................................................
Mpf_ENSMPUP00000016349 -------------------..........................................................
Mpf_ENSMPUP00000015036 -------------------egedpgcanqalis............................................
Mpf_ENSMPUP00000007938 -------------------e.........................................................
Mpf_ENSMPUP00000007257 -------------------ya........................................................
Mpf_ENSMPUP00000005203 -------------------dglpsarkliyytgcpmrsrhllqllsnshrlymnlqpvlrhirkleeneekkqyres
Mpf_ENSMPUP00000000650 -------------------yqesyysvqttegeqisqliagyidii...............................
Mpf_ENSMPUP00000007937 -------------------c.........................................................
Mpf_ENSMPUP00000007017 QQ-----------------lhilknsfklpphislhrivdkm...................................
Mpf_ENSMPUP00000012780 SHSDD--------------sgddd.....................................................
Mpf_ENSMPUP00000002522 -------------------hvldvkpitllmessdamnlacltagyyrllvdsrrsifnm.................
Mpf_ENSMPUP00000004905 -------------------psnltllpghlymmaealakeearr.................................
Mpf_ENSMPUP00000011326 -------------------qekrn.....................................................
Mpf_ENSMPUP00000009449 PAAVGSQ------------rrfvrpilp.................................................
Mpf_ENSMPUP00000000014 -------------------tsa.......................................................
Mpf_ENSMPUP00000012737 -------------------pt........................................................
Mpf_ENSMPUP00000002136 -------------------krq.......................................................
Mpf_ENSMPUP00000017782 -------------------lpqeya....................................................
Mpf_ENSMPUP00000013550 -------------------rllrrap...................................................
Mpf_ENSMPUP00000017362 -------------------k.........................................................
Mpf_ENSMPUP00000006996 -------------------tlql......................................................
Mpf_ENSMPUP00000004785 -------------------v.........................................................
Mpf_ENSMPUP00000014164 -------------------s.........................................................
Mpf_ENSMPUP00000016592 -------------------lq........................................................
Mpf_ENSMPUP00000000486 NLQVTLRSKPK--------dqmgghelr.................................................
Mpf_ENSMPUP00000003712 -------------------ayr.......................................................
Mpf_ENSMPUP00000006850 -------------------d.........................................................
Mpf_ENSMPUP00000015574 -------------------sffflelgrsaptgpgelwlqapdalvaqsihetvlaamkrl................
Mpf_ENSMPUP00000014962 -------------------ffidqanyflnfpckvrnqvyslllrlr..............................
Mpf_ENSMPUP00000016814 -------------------tqqa......................................................
Mpf_ENSMPUP00000000139 -------------------..........................................................
Mpf_ENSMPUP00000012020 -------------------i.........................................................
Mpf_ENSMPUP00000006069 -------------------snsakdlacliagyyrlfvdpdtpiflwp.............................
Mpf_ENSMPUP00000017142 -------------------p.........................................................
Mpf_ENSMPUP00000013991 -------------------kipaaennpfltgmhywysshss...................................
Mpf_ENSMPUP00000010353 -------------------afqkgirnkvyqrfl...........................................
Mpf_ENSMPUP00000000014 KKRKVEPPTP---------qepgpakvavtss.............................................
Mpf_ENSMPUP00000009546 -------------------tv........................................................
Mpf_ENSMPUP00000012020 -------------------icyainlgk.................................................
Mpf_ENSMPUP00000016751 -------------------i.........................................................
Mpf_ENSMPUP00000000216 -------------------a.........................................................
Mpf_ENSMPUP00000010854 -------------------i.........................................................
Mpf_ENSMPUP00000016813 PTQ----------------vqk.......................................................
Mpf_ENSMPUP00000002870 -------------------tvp.......................................................
Mpf_ENSMPUP00000003651 -------------------dpsg......................................................
Mpf_ENSMPUP00000002370 -------------------erer......................................................
Mpf_ENSMPUP00000006780 -------------------pviqtqkl..................................................
Mpf_ENSMPUP00000002802 -------------------a.........................................................
Mpf_ENSMPUP00000011336 -------------------a.........................................................
Mpf_ENSMPUP00000003120 -------------------ss........................................................
Mpf_ENSMPUP00000005803 -------------------aenlteadydligqlyykdchaldqwrkgwfsm.........................
Mpf_ENSMPUP00000004980 -------------------a.........................................................
Mpf_ENSMPUP00000015621 -------------------rq........................................................
Mpf_ENSMPUP00000003141 -------------------aqpddpesqmachvfratdpnqvpdvissirqlskaamked.................
Mpf_ENSMPUP00000013099 K------------------gddn......................................................
Mpf_ENSMPUP00000010983 PTQ----------------qli.......................................................
Mpf_ENSMPUP00000004910 -------------------r.........................................................
Mpf_ENSMPUP00000016233 -------------------htvndsmcsfmmpfdlmsnctveqpvftpnfikgiiqaapdggwegqatfklafrkgg
Mpf_ENSMPUP00000002953 -------------------rddvyhsil.................................................
Mpf_ENSMPUP00000011716 -------------------tntgy.....................................................
Mpf_ENSMPUP00000007767 -------------------lv........................................................
Mpf_ENSMPUP00000014585 -------------------s.........................................................
Mpf_ENSMPUP00000014164 -------------------ll........................................................
Mpf_ENSMPUP00000005886 -------------------ikdhtasqqsicyvfkaddqtkvpeiissirqagkiarqe..................
Mpf_ENSMPUP00000013797 -------------------lv........................................................
Mpf_ENSMPUP00000004108 KNNP---------------plksrs....................................................
Mpf_ENSMPUP00000009167 -------------------ilh.......................................................
Mpf_ENSMPUP00000016226 -------------------v.........................................................
Mpf_ENSMPUP00000014024 -------------------a.........................................................
Mpf_ENSMPUP00000008448 -------------------snwssgntyfhitignlvrgskllcetslgykmddlltsyisqm..............
Mpf_ENSMPUP00000010607 -------------------eypaeklafsavcpddrrlfglvtmqsgddgslahedegalrtschvfmvdpdlfshk
Mpf_ENSMPUP00000015774 -------------------eal.......................................................
Mpf_ENSMPUP00000008639 -------------------ak........................................................
Mpf_ENSMPUP00000012941 A------------------ieeeip....................................................
Mpf_ENSMPUP00000016218 -------------------..........................................................
Mpf_ENSMPUP00000007001 -------------------mpreeldllecydspqvqclraykpr................................
Mpf_ENSMPUP00000001986 -------------------sl........................................................
Mpf_ENSMPUP00000010415 -------------------la........................................................
Mpf_ENSMPUP00000003836 -------------------k.........................................................
Mpf_ENSMPUP00000007027 -------------------tvgta.....................................................
Mpf_ENSMPUP00000002688 -------------------hss.......................................................
Mpf_ENSMPUP00000001373 -------------------rgeqstg...................................................
Mpf_ENSMPUP00000013700 -------------------kk........................................................
Mpf_ENSMPUP00000016589 -------------------lttypftkisswssgstyfhmalgslargsrllcetslgykmddlltsyvqq......
Mpf_ENSMPUP00000015325 -------------------s.........................................................
Mpf_ENSMPUP00000001960 -------------------lse.......................................................
Mpf_ENSMPUP00000006310 F------------------tnmkqwnvnweirqvaiefdqnvsiaftclsadckivheyiggyifls..........
Mpf_ENSMPUP00000016747 -------------------..........................................................
Mpf_ENSMPUP00000013323 -------------------h.........................................................
Mpf_ENSMPUP00000007350 -------------------kvtwknaql.................................................
Mpf_ENSMPUP00000017588 -------------------wlm.......................................................
Mpf_ENSMPUP00000007745 -------------------ll........................................................
Mpf_ENSMPUP00000006409 -------------------efhss.....................................................
Mpf_ENSMPUP00000015574 -------------------e.........................................................
Mpf_ENSMPUP00000008365 PEEE---------------ses.......................................................
Mpf_ENSMPUP00000001054 HKEDTLRLLK---------seikkleqkidmdekmk.........................................
Mpf_ENSMPUP00000017488 -------------------ll........................................................
Mpf_ENSMPUP00000005234 -------------------apnrrt....................................................
Mpf_ENSMPUP00000013182 -------------------s.........................................................
Mpf_ENSMPUP00000011513 -------------------gilrgdnk..................................................
Mpf_ENSMPUP00000005385 -------------------qwnvnweikmvtvefadevrlsfictevdckvvhefiggyifls..............
Mpf_ENSMPUP00000009077 -------------------rssdhyscqshsygdlrelrqarfllqdialelffqngyskflvfhnndrnmvfksfc
Mpf_ENSMPUP00000001767 -------------------elwllhsnidaidkrfvgplgtiiikckdfriiqldipgmeeclniassiealstlds
Mpf_ENSMPUP00000007827 -------------------d.........................................................
Mpf_ENSMPUP00000000541 -------------------gi........................................................
Mpf_ENSMPUP00000001809 -------------------drenplel..................................................
Mpf_ENSMPUP00000005803 -------------------ndirppagkerkrsitknpkigglplipiqh...........................
Mpf_ENSMPUP00000013182 -------------------nvnwdirqvaiefdehinvafscvsascrivheyiggyifls................
Mpf_ENSMPUP00000005315 -------------------devtvee...................................................
Mpf_ENSMPUP00000014585 -------------------..........................................................
Mpf_ENSMPUP00000015166 -------------------ltmpr.....................................................
Mpf_ENSMPUP00000002409 -------------------leskinpntayqkqqdtlivwseaenydlalsfqekagcdeiwekicqvq........
Mpf_ENSMPUP00000005807 -------------------qr........................................................
Mpf_ENSMPUP00000013796 -------------------is........................................................
Mpf_ENSMPUP00000017782 -------------------r.........................................................
Mpf_ENSMPUP00000019464 -------------------vvreles...................................................
Mpf_ENSMPUP00000012725 -------------------tkekkitmqnqlqqnmqeglqitsasfqlikvafdeevspevveifkkqlmkfrypqs
Mpf_ENSMPUP00000010996 CCEEL--------------mkieimsprkppl.............................................
Mpf_ENSMPUP00000007938 -------------------l.........................................................
Mpf_ENSMPUP00000009654 -------------------nstp......................................................
Mpf_ENSMPUP00000005385 -------------------k.........................................................
Mpf_ENSMPUP00000006310 -------------------k.........................................................
Mpf_ENSMPUP00000007963 TDS----------------lrnlssss..................................................
Mpf_ENSMPUP00000002310 -------------------scess.....................................................
Mpf_ENSMPUP00000000486 -------------------gyvgr.....................................................
Mpf_ENSMPUP00000007805 -------------------esdgsllleskinpntayqkqqdtlivwseaenydlalsfqekagcdeiwekicqvq.
Mpf_ENSMPUP00000010246 -------------------ddlcsdiylkfyepqdrddlyfyi..................................
Mpf_ENSMPUP00000004460 -------------------v.........................................................
Mpf_ENSMPUP00000014791 -------------------sm........................................................
Mpf_ENSMPUP00000003154 -------------------nei.......................................................
Mpf_ENSMPUP00000005214 -------------------qk........................................................
Mpf_ENSMPUP00000003932 -------------------rl........................................................
Mpf_ENSMPUP00000008710 -------------------qgcrsa....................................................
Mpf_ENSMPUP00000005632 -------------------ll........................................................
Mpf_ENSMPUP00000002828 -------------------kkc.......................................................
Mpf_ENSMPUP00000017859 -------------------hsqistiekqattatgcpllircknfqllqliipqerdchdvyislirlarpvkyeel
Mpf_ENSMPUP00000013754 -------------------vp........................................................
Mpf_ENSMPUP00000004548 -------------------d.........................................................
Mpf_ENSMPUP00000000646 -------------------qakyedlyafsy..............................................
Mpf_ENSMPUP00000004473 -------------------a.........................................................
Mpf_ENSMPUP00000000402 -------------------kql.......................................................
Mpf_ENSMPUP00000007412 -------------------t.........................................................
Mpf_ENSMPUP00000004935 -------------------lsfvslidgyyrltadahhylcke..................................
Mpf_ENSMPUP00000011513 -------------------nn........................................................
Mpf_ENSMPUP00000001759 -------------------d.........................................................
Mpf_ENSMPUP00000008353 DEWV---------------niqyp.....................................................
Mpf_ENSMPUP00000012083 -------------------y.........................................................
Mpf_ENSMPUP00000006956 -------------------g.........................................................
Mpf_ENSMPUP00000014860 -------------------aqly......................................................
Mpf_ENSMPUP00000009647 -------------------ek........................................................
Mpf_ENSMPUP00000005803 -------------------sdy.......................................................
Mpf_ENSMPUP00000005109 -------------------vp........................................................
Mpf_ENSMPUP00000006149 -------------------e.........................................................
Mpf_ENSMPUP00000001981 -------------------lqcce.....................................................
Mpf_ENSMPUP00000017916 -------------------e.........................................................
Mpf_ENSMPUP00000003318 -------------------i.........................................................
Mpf_ENSMPUP00000017175 -------------------ek........................................................
Mpf_ENSMPUP00000016038 -------------------gql.......................................................
Mpf_ENSMPUP00000016192 -------------------ps........................................................
Mpf_ENSMPUP00000015325 -------------------ni........................................................
Mpf_ENSMPUP00000000660 -------------------yg........................................................
Mpf_ENSMPUP00000005493 -------------------rleavsglsrvqllrpgsplkfipeeilihgrdfrllrvafeagglepqafqvtmaiv
Mpf_ENSMPUP00000009754 EPSRVSR------------aapevrlgsvsliplrgsenem....................................
Mpf_ENSMPUP00000013796 -------------------lv........................................................
Mpf_ENSMPUP00000010667 -------------------wkergiapasf...............................................
Mpf_ENSMPUP00000013126 -------------------gvyp......................................................
Mpf_ENSMPUP00000018046 -------------------gmll......................................................
Mpf_ENSMPUP00000006359 -------------------slatnllaqn................................................
Mpf_ENSMPUP00000015086 -------------------glrytkeeevkrivsgiihhtqvpkllkrlflfsy.......................
Mpf_ENSMPUP00000008387 -------------------ni........................................................
Mpf_ENSMPUP00000015207 -------------------edlfafay..................................................
Mpf_ENSMPUP00000004217 -------------------tlaredvfpanalleirpfqvwlhhldhkgeatvhmdtfqvariayctadhnvspnif
Mpf_ENSMPUP00000015689 -------------------eaefpglpaalsfvalvdgyfrlisdsrhffcke........................
Mpf_ENSMPUP00000015159 -------------------qldiegveatldiarsiealsslesvitsfpffyr.......................
Mpf_ENSMPUP00000018833 -------------------nsntpyqkqqetliiwsegenhgvalsfqdtegchkiweeichiq.............
Mpf_ENSMPUP00000007866 CCDE---------------imkietpapr................................................
Mpf_ENSMPUP00000007938 VAE----------------kiwsn.....................................................
Mpf_ENSMPUP00000010694 -------------------nis.......................................................
Mpf_ENSMPUP00000013131 -------------------iedlfsfay.................................................
Mpf_ENSMPUP00000000312 -------------------gtsd......................................................
Mpf_ENSMPUP00000019132 -------------------..........................................................
Mpf_ENSMPUP00000015959 RE-----------------etwlsvwvhe................................................
Mpf_ENSMPUP00000012612 -------------------vpfy......................................................
Mpf_ENSMPUP00000007938 -------------------vg........................................................
Mpf_ENSMPUP00000007989 -------------------f.........................................................
Mpf_ENSMPUP00000016156 -------------------ptatqktqllvradtnlalla.....................................
Mpf_ENSMPUP00000013721 -------------------cn........................................................
Mpf_ENSMPUP00000005447 -------------------pknp......................................................
Mpf_ENSMPUP00000015768 -------------------ggi.......................................................
Mpf_ENSMPUP00000004215 -------------------..........................................................
Mpf_ENSMPUP00000010108 -------------------..........................................................
Mpf_ENSMPUP00000002188 -------------------gq........................................................
Mpf_ENSMPUP00000013446 -------------------ipk.......................................................
Mpf_ENSMPUP00000012407 -------------------dtrprp....................................................
Mpf_ENSMPUP00000017043 -------------------q.........................................................
Mpf_ENSMPUP00000007898 -------------------k.........................................................
Mpf_ENSMPUP00000017064 -------------------an........................................................
Mpf_ENSMPUP00000009754 -------------------se........................................................
Mpf_ENSMPUP00000016461 -------------------srr.......................................................
Mpf_ENSMPUP00000008230 -------------------gswalap...................................................
Mpf_ENSMPUP00000001993 -------------------clgget....................................................
Mpf_ENSMPUP00000014500 -------------------vkml......................................................
Mpf_ENSMPUP00000002405 -------------------rrvdnvl...................................................
Mpf_ENSMPUP00000002933 -------------------ag........................................................
Mpf_ENSMPUP00000007268 -------------------srrv......................................................
Mpf_ENSMPUP00000010983 -------------------k.........................................................
Mpf_ENSMPUP00000010498 -------------------vhrfhvav..................................................
Mpf_ENSMPUP00000018101 -------------------hktl......................................................
Mpf_ENSMPUP00000002033 -------------------krisvqtpvdqllqdglqlrsctfqllkmafdeevgsdsaelfrkqlhklryppdirg
Mpf_ENSMPUP00000010694 -------------------t.........................................................
Mpf_ENSMPUP00000008353 -------------------ae........................................................
Mpf_ENSMPUP00000009754 EQQLG--------------dsdipvivyrcvdyitqcgltsegiy................................
Mpf_ENSMPUP00000015718 -------------------hki.......................................................
Mpf_ENSMPUP00000002358 -------------------glq.......................................................
Mpf_ENSMPUP00000005077 -------------------rraen.....................................................
Mpf_ENSMPUP00000009107 -------------------slehp.....................................................
Mpf_ENSMPUP00000016101 -------------------enqpgwlcp.................................................
Mpf_ENSMPUP00000011911 -------------------tgesss....................................................
Mpf_ENSMPUP00000007938 -------------------gtalqeqqms................................................
Mpf_ENSMPUP00000009676 -------------------lwklpledadiv..............................................
Mpf_ENSMPUP00000005809 -------------------hg........................................................
Mpf_ENSMPUP00000016410 -------------------rissv.....................................................
Mpf_ENSMPUP00000006638 -------------------alslvslvdgyfrltadsshylcre.................................
Mpf_ENSMPUP00000005803 -------------------tdgn......................................................
Mpf_ENSMPUP00000010983 -------------------e.........................................................
Mpf_ENSMPUP00000000717 -------------------dgyfrltadahhylct..........................................
Mpf_ENSMPUP00000002793 -------------------leeenhmgwfcv..............................................
Mpf_ENSMPUP00000007833 -------------------rq........................................................
Mpf_ENSMPUP00000002271 -------------------fgggifg...................................................
Mpf_ENSMPUP00000010974 -------------------gvy.......................................................
Mpf_ENSMPUP00000010755 -------------------aq........................................................
Mpf_ENSMPUP00000013112 -------------------alyliirmvcyddglgagksllalkttdasnkeyslwvyqcssleqaqaickvlstaf


                                                                              
                                                                              
d1wg7a_                .......................................................
Mpf_ENSMPUP00000000236 .......................................................
Mpf_ENSMPUP00000001054 .......................................................
Mpf_ENSMPUP00000001986 .......................................................
Mpf_ENSMPUP00000006133 yvakdpvnqrachilecpeglaqdvistigqafelrfkqylr.............
Mpf_ENSMPUP00000009494 aqliaqsigqafsvayqeflr..................................
Mpf_ENSMPUP00000004093 dfadecpkpellairflnaenaqkfktkfeecrkeieerek..............
Mpf_ENSMPUP00000012215 chilecrsgmaqdvistigqafelrfkqylk........................
Mpf_ENSMPUP00000016175 .......................................................
Mpf_ENSMPUP00000009909 fasggdtdmtdyvayvakdpinqrachileccggvaqsvistvgqafelrfkqyl
Mpf_ENSMPUP00000010977 qliaqsigqafsvayqeflr...................................
Mpf_ENSMPUP00000016638 .......................................................
Mpf_ENSMPUP00000018612 pellairflnaenaqkfktkfeecrkeieerek......................
Mpf_ENSMPUP00000018966 pellairflnaenaqkfktkfeecrkeieerek......................
Mpf_ENSMPUP00000004660 .......................................................
Mpf_ENSMPUP00000002149 .......................................................
Mpf_ENSMPUP00000018066 .......................................................
Mpf_ENSMPUP00000017958 nltqye.................................................
Mpf_ENSMPUP00000011450 .......................................................
Mpf_ENSMPUP00000016402 .......................................................
Mpf_ENSMPUP00000004951 ekmeltstpsqesaggdlqsplt................................
Mpf_ENSMPUP00000011363 qafevayqlal............................................
Mpf_ENSMPUP00000015445 .......................................................
Mpf_ENSMPUP00000015195 .......................................................
Mpf_ENSMPUP00000011751 .......................................................
Mpf_ENSMPUP00000009831 .......................................................
Mpf_ENSMPUP00000004111 qafsvaysqfl............................................
Mpf_ENSMPUP00000005349 .......................................................
Mpf_ENSMPUP00000006137 .......................................................
Mpf_ENSMPUP00000009095 .......................................................
Mpf_ENSMPUP00000005832 asaleale...............................................
Mpf_ENSMPUP00000014567 .......................................................
Mpf_ENSMPUP00000015198 .......................................................
Mpf_ENSMPUP00000008441 qafelrfkqylq...........................................
Mpf_ENSMPUP00000005146 retverekeqmmrek........................................
Mpf_ENSMPUP00000010667 dgerkvehlavrfklqdvadsfkkifdeak.........................
Mpf_ENSMPUP00000000642 .......................................................
Mpf_ENSMPUP00000015373 seqhltqfaekfqevkeaarlareksqdggeltspalglaahqvppspl......
Mpf_ENSMPUP00000003213 lal....................................................
Mpf_ENSMPUP00000012196 .......................................................
Mpf_ENSMPUP00000012194 snnlplfafeyk...........................................
Mpf_ENSMPUP00000003212 lal....................................................
Mpf_ENSMPUP00000001158 rallenekkkremaekekeki..................................
Mpf_ENSMPUP00000010667 avrfktkemadcfkkkfeecqqnllk.............................
Mpf_ENSMPUP00000013386 .......................................................
Mpf_ENSMPUP00000016712 riaklmadvveee..........................................
Mpf_ENSMPUP00000003302 reiaekeker.............................................
Mpf_ENSMPUP00000003768 .......................................................
Mpf_ENSMPUP00000008012 .......................................................
Mpf_ENSMPUP00000002625 .......................................................
Mpf_ENSMPUP00000010667 elaeefkqkfeecq.........................................
Mpf_ENSMPUP00000006140 .......................................................
Mpf_ENSMPUP00000015670 krkvaqavtltvaqafkvafefwqmskeek.........................
Mpf_ENSMPUP00000008341 .......................................................
Mpf_ENSMPUP00000017573 .......................................................
Mpf_ENSMPUP00000012859 lfklamnilaqn...........................................
Mpf_ENSMPUP00000012131 .......................................................
Mpf_ENSMPUP00000000172 gssfrysgrtqkqlvdyvrdsgvkrvpyerrhsk.....................
Mpf_ENSMPUP00000013200 ertrdel................................................
Mpf_ENSMPUP00000003522 .......................................................
Mpf_ENSMPUP00000011499 rtqkqvldyvkegghkkvqferkhsk.............................
Mpf_ENSMPUP00000011494 .......................................................
Mpf_ENSMPUP00000012716 .......................................................
Mpf_ENSMPUP00000002913 .......................................................
Mpf_ENSMPUP00000003504 .......................................................
Mpf_ENSMPUP00000004361 lnsqetaq...............................................
Mpf_ENSMPUP00000017389 nhqtelevprtpr..........................................
Mpf_ENSMPUP00000015829 .......................................................
Mpf_ENSMPUP00000003644 rtglqralee.............................................
Mpf_ENSMPUP00000006376 .......................................................
Mpf_ENSMPUP00000014536 rysgrtqaqtrqastlidrpaphfertsskr........................
Mpf_ENSMPUP00000011501 .......................................................
Mpf_ENSMPUP00000017670 kr.....................................................
Mpf_ENSMPUP00000006727 .......................................................
Mpf_ENSMPUP00000000961 arspsk.................................................
Mpf_ENSMPUP00000004942 grtqaqtrrasalidrpapyferssskr...........................
Mpf_ENSMPUP00000002151 ygkkgrltslpferkh.......................................
Mpf_ENSMPUP00000014680 .......................................................
Mpf_ENSMPUP00000005563 .......................................................
Mpf_ENSMPUP00000011333 .......................................................
Mpf_ENSMPUP00000000969 psk....................................................
Mpf_ENSMPUP00000010395 .......................................................
Mpf_ENSMPUP00000015361 ysgrtqaqtrqasalidrpaphfertaskr.........................
Mpf_ENSMPUP00000001991 kvakevveasskiqreppevhrtsmtq............................
Mpf_ENSMPUP00000005637 .......................................................
Mpf_ENSMPUP00000007307 .......................................................
Mpf_ENSMPUP00000008193 .......................................................
Mpf_ENSMPUP00000007177 .......................................................
Mpf_ENSMPUP00000010360 .......................................................
Mpf_ENSMPUP00000010611 .......................................................
Mpf_ENSMPUP00000007161 .......................................................
Mpf_ENSMPUP00000006134 .......................................................
Mpf_ENSMPUP00000004983 .......................................................
Mpf_ENSMPUP00000001920 .......................................................
Mpf_ENSMPUP00000013542 iqkr...................................................
Mpf_ENSMPUP00000008337 .......................................................
Mpf_ENSMPUP00000013626 .......................................................
Mpf_ENSMPUP00000001949 .......................................................
Mpf_ENSMPUP00000017721 .......................................................
Mpf_ENSMPUP00000001109 .......................................................
Mpf_ENSMPUP00000001935 yyqqhl.................................................
Mpf_ENSMPUP00000006252 .......................................................
Mpf_ENSMPUP00000005676 apakniatslheicskimae...................................
Mpf_ENSMPUP00000005196 .......................................................
Mpf_ENSMPUP00000012589 pdqnvarsrsk............................................
Mpf_ENSMPUP00000010571 akevmessakikreppeih....................................
Mpf_ENSMPUP00000011589 .......................................................
Mpf_ENSMPUP00000005676 wcepnaaslseavqaacmlryqk................................
Mpf_ENSMPUP00000002533 .......................................................
Mpf_ENSMPUP00000004215 .......................................................
Mpf_ENSMPUP00000013399 .......................................................
Mpf_ENSMPUP00000010530 .......................................................
Mpf_ENSMPUP00000006089 .......................................................
Mpf_ENSMPUP00000016498 epmtlsksislp...........................................
Mpf_ENSMPUP00000007327 ckkviggmvwnpalrrslsve..................................
Mpf_ENSMPUP00000001749 .......................................................
Mpf_ENSMPUP00000016475 .......................................................
Mpf_ENSMPUP00000013206 .......................................................
Mpf_ENSMPUP00000006140 .......................................................
Mpf_ENSMPUP00000005780 .......................................................
Mpf_ENSMPUP00000001869 .......................................................
Mpf_ENSMPUP00000012475 .......................................................
Mpf_ENSMPUP00000008316 hytepytssq.............................................
Mpf_ENSMPUP00000001167 .......................................................
Mpf_ENSMPUP00000008230 .......................................................
Mpf_ENSMPUP00000017717 .......................................................
Mpf_ENSMPUP00000010272 .......................................................
Mpf_ENSMPUP00000003964 .......................................................
Mpf_ENSMPUP00000017478 .......................................................
Mpf_ENSMPUP00000010168 .......................................................
Mpf_ENSMPUP00000009546 .......................................................
Mpf_ENSMPUP00000002870 .......................................................
Mpf_ENSMPUP00000000151 .......................................................
Mpf_ENSMPUP00000000216 .......................................................
Mpf_ENSMPUP00000007012 .......................................................
Mpf_ENSMPUP00000012096 .......................................................
Mpf_ENSMPUP00000004281 .......................................................
Mpf_ENSMPUP00000004460 laiaeqhkrvllem.........................................
Mpf_ENSMPUP00000011499 .......................................................
Mpf_ENSMPUP00000003498 .......................................................
Mpf_ENSMPUP00000006723 .......................................................
Mpf_ENSMPUP00000006149 .......................................................
Mpf_ENSMPUP00000011052 .......................................................
Mpf_ENSMPUP00000015653 .......................................................
Mpf_ENSMPUP00000014937 lyaaihhrllalr..........................................
Mpf_ENSMPUP00000006713 .......................................................
Mpf_ENSMPUP00000005370 .......................................................
Mpf_ENSMPUP00000017142 .......................................................
Mpf_ENSMPUP00000011052 .......................................................
Mpf_ENSMPUP00000000930 .......................................................
Mpf_ENSMPUP00000016865 .......................................................
Mpf_ENSMPUP00000000090 .......................................................
Mpf_ENSMPUP00000012035 .......................................................
Mpf_ENSMPUP00000009068 .......................................................
Mpf_ENSMPUP00000000172 .......................................................
Mpf_ENSMPUP00000013402 hysethtsqd.............................................
Mpf_ENSMPUP00000012726 .......................................................
Mpf_ENSMPUP00000010329 .......................................................
Mpf_ENSMPUP00000005886 .......................................................
Mpf_ENSMPUP00000011911 lpelagprpcplpratslp....................................
Mpf_ENSMPUP00000013895 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000017452 .......................................................
Mpf_ENSMPUP00000004281 .......................................................
Mpf_ENSMPUP00000017577 .......................................................
Mpf_ENSMPUP00000004977 .......................................................
Mpf_ENSMPUP00000017884 rrw....................................................
Mpf_ENSMPUP00000007027 .......................................................
Mpf_ENSMPUP00000012725 .......................................................
Mpf_ENSMPUP00000000871 .......................................................
Mpf_ENSMPUP00000006220 .......................................................
Mpf_ENSMPUP00000008418 agglseavqaacmvqyqk.....................................
Mpf_ENSMPUP00000003932 l......................................................
Mpf_ENSMPUP00000001861 kkvvyslprvg............................................
Mpf_ENSMPUP00000008418 .......................................................
Mpf_ENSMPUP00000006249 .......................................................
Mpf_ENSMPUP00000003836 .......................................................
Mpf_ENSMPUP00000015858 .......................................................
Mpf_ENSMPUP00000002835 .......................................................
Mpf_ENSMPUP00000004473 .......................................................
Mpf_ENSMPUP00000000137 .......................................................
Mpf_ENSMPUP00000001907 .......................................................
Mpf_ENSMPUP00000014024 .......................................................
Mpf_ENSMPUP00000001742 .......................................................
Mpf_ENSMPUP00000000172 .......................................................
Mpf_ENSMPUP00000005480 .......................................................
Mpf_ENSMPUP00000018515 .......................................................
Mpf_ENSMPUP00000009502 .......................................................
Mpf_ENSMPUP00000013672 fgqrm..................................................
Mpf_ENSMPUP00000011336 .......................................................
Mpf_ENSMPUP00000001410 .......................................................
Mpf_ENSMPUP00000003424 .......................................................
Mpf_ENSMPUP00000007040 tvkkvvnylprv...........................................
Mpf_ENSMPUP00000019493 .......................................................
Mpf_ENSMPUP00000018830 .......................................................
Mpf_ENSMPUP00000003141 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000010498 .......................................................
Mpf_ENSMPUP00000012786 .......................................................
Mpf_ENSMPUP00000014114 .......................................................
Mpf_ENSMPUP00000007256 .......................................................
Mpf_ENSMPUP00000005608 .......................................................
Mpf_ENSMPUP00000002033 .......................................................
Mpf_ENSMPUP00000016751 .......................................................
Mpf_ENSMPUP00000016435 .......................................................
Mpf_ENSMPUP00000001167 .......................................................
Mpf_ENSMPUP00000001585 .......................................................
Mpf_ENSMPUP00000002351 .......................................................
Mpf_ENSMPUP00000011499 .......................................................
Mpf_ENSMPUP00000005375 nin....................................................
Mpf_ENSMPUP00000015986 lcrsfqlay..............................................
Mpf_ENSMPUP00000004747 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000002257 .......................................................
Mpf_ENSMPUP00000006734 .......................................................
Mpf_ENSMPUP00000003502 rtvgqafevchklsl........................................
Mpf_ENSMPUP00000011019 llfafey................................................
Mpf_ENSMPUP00000003673 .......................................................
Mpf_ENSMPUP00000000383 .......................................................
Mpf_ENSMPUP00000008997 .......................................................
Mpf_ENSMPUP00000010040 .......................................................
Mpf_ENSMPUP00000007257 .......................................................
Mpf_ENSMPUP00000016774 .......................................................
Mpf_ENSMPUP00000001960 .......................................................
Mpf_ENSMPUP00000007610 .......................................................
Mpf_ENSMPUP00000017612 .......................................................
Mpf_ENSMPUP00000007907 .......................................................
Mpf_ENSMPUP00000014021 .......................................................
Mpf_ENSMPUP00000008982 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000002728 .......................................................
Mpf_ENSMPUP00000007017 .......................................................
Mpf_ENSMPUP00000003752 .......................................................
Mpf_ENSMPUP00000001306 .......................................................
Mpf_ENSMPUP00000005338 .......................................................
Mpf_ENSMPUP00000001689 .......................................................
Mpf_ENSMPUP00000010415 .......................................................
Mpf_ENSMPUP00000006220 .......................................................
Mpf_ENSMPUP00000016350 .......................................................
Mpf_ENSMPUP00000018773 analaefkrlkrrd.........................................
Mpf_ENSMPUP00000017599 .......................................................
Mpf_ENSMPUP00000016349 .......................................................
Mpf_ENSMPUP00000015036 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000007257 .......................................................
Mpf_ENSMPUP00000005203 yisdsldldvdqlekrsrasgss................................
Mpf_ENSMPUP00000000650 .......................................................
Mpf_ENSMPUP00000007937 .......................................................
Mpf_ENSMPUP00000007017 .......................................................
Mpf_ENSMPUP00000012780 .......................................................
Mpf_ENSMPUP00000002522 .......................................................
Mpf_ENSMPUP00000004905 .......................................................
Mpf_ENSMPUP00000011326 .......................................................
Mpf_ENSMPUP00000009449 .......................................................
Mpf_ENSMPUP00000000014 .......................................................
Mpf_ENSMPUP00000012737 .......................................................
Mpf_ENSMPUP00000002136 .......................................................
Mpf_ENSMPUP00000017782 .......................................................
Mpf_ENSMPUP00000013550 .......................................................
Mpf_ENSMPUP00000017362 .......................................................
Mpf_ENSMPUP00000006996 .......................................................
Mpf_ENSMPUP00000004785 .......................................................
Mpf_ENSMPUP00000014164 .......................................................
Mpf_ENSMPUP00000016592 .......................................................
Mpf_ENSMPUP00000000486 .......................................................
Mpf_ENSMPUP00000003712 .......................................................
Mpf_ENSMPUP00000006850 .......................................................
Mpf_ENSMPUP00000015574 .......................................................
Mpf_ENSMPUP00000014962 .......................................................
Mpf_ENSMPUP00000016814 .......................................................
Mpf_ENSMPUP00000000139 .......................................................
Mpf_ENSMPUP00000012020 .......................................................
Mpf_ENSMPUP00000006069 .......................................................
Mpf_ENSMPUP00000017142 .......................................................
Mpf_ENSMPUP00000013991 .......................................................
Mpf_ENSMPUP00000010353 .......................................................
Mpf_ENSMPUP00000000014 .......................................................
Mpf_ENSMPUP00000009546 .......................................................
Mpf_ENSMPUP00000012020 .......................................................
Mpf_ENSMPUP00000016751 .......................................................
Mpf_ENSMPUP00000000216 .......................................................
Mpf_ENSMPUP00000010854 .......................................................
Mpf_ENSMPUP00000016813 .......................................................
Mpf_ENSMPUP00000002870 .......................................................
Mpf_ENSMPUP00000003651 .......................................................
Mpf_ENSMPUP00000002370 .......................................................
Mpf_ENSMPUP00000006780 .......................................................
Mpf_ENSMPUP00000002802 .......................................................
Mpf_ENSMPUP00000011336 .......................................................
Mpf_ENSMPUP00000003120 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000004980 .......................................................
Mpf_ENSMPUP00000015621 .......................................................
Mpf_ENSMPUP00000003141 .......................................................
Mpf_ENSMPUP00000013099 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000004910 .......................................................
Mpf_ENSMPUP00000016233 aiefaqmm...............................................
Mpf_ENSMPUP00000002953 .......................................................
Mpf_ENSMPUP00000011716 .......................................................
Mpf_ENSMPUP00000007767 .......................................................
Mpf_ENSMPUP00000014585 .......................................................
Mpf_ENSMPUP00000014164 .......................................................
Mpf_ENSMPUP00000005886 .......................................................
Mpf_ENSMPUP00000013797 .......................................................
Mpf_ENSMPUP00000004108 .......................................................
Mpf_ENSMPUP00000009167 .......................................................
Mpf_ENSMPUP00000016226 .......................................................
Mpf_ENSMPUP00000014024 .......................................................
Mpf_ENSMPUP00000008448 .......................................................
Mpf_ENSMPUP00000010607 ihqgiarrfgfectadpdtngc.................................
Mpf_ENSMPUP00000015774 .......................................................
Mpf_ENSMPUP00000008639 .......................................................
Mpf_ENSMPUP00000012941 .......................................................
Mpf_ENSMPUP00000016218 .......................................................
Mpf_ENSMPUP00000007001 .......................................................
Mpf_ENSMPUP00000001986 .......................................................
Mpf_ENSMPUP00000010415 .......................................................
Mpf_ENSMPUP00000003836 .......................................................
Mpf_ENSMPUP00000007027 .......................................................
Mpf_ENSMPUP00000002688 .......................................................
Mpf_ENSMPUP00000001373 .......................................................
Mpf_ENSMPUP00000013700 .......................................................
Mpf_ENSMPUP00000016589 .......................................................
Mpf_ENSMPUP00000015325 .......................................................
Mpf_ENSMPUP00000001960 .......................................................
Mpf_ENSMPUP00000006310 .......................................................
Mpf_ENSMPUP00000016747 .......................................................
Mpf_ENSMPUP00000013323 .......................................................
Mpf_ENSMPUP00000007350 .......................................................
Mpf_ENSMPUP00000017588 .......................................................
Mpf_ENSMPUP00000007745 .......................................................
Mpf_ENSMPUP00000006409 .......................................................
Mpf_ENSMPUP00000015574 .......................................................
Mpf_ENSMPUP00000008365 .......................................................
Mpf_ENSMPUP00000001054 .......................................................
Mpf_ENSMPUP00000017488 .......................................................
Mpf_ENSMPUP00000005234 .......................................................
Mpf_ENSMPUP00000013182 .......................................................
Mpf_ENSMPUP00000011513 .......................................................
Mpf_ENSMPUP00000005385 .......................................................
Mpf_ENSMPUP00000009077 sfq....................................................
Mpf_ENSMPUP00000001767 itlmypffyr.............................................
Mpf_ENSMPUP00000007827 .......................................................
Mpf_ENSMPUP00000000541 .......................................................
Mpf_ENSMPUP00000001809 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000013182 .......................................................
Mpf_ENSMPUP00000005315 .......................................................
Mpf_ENSMPUP00000014585 .......................................................
Mpf_ENSMPUP00000015166 .......................................................
Mpf_ENSMPUP00000002409 .......................................................
Mpf_ENSMPUP00000005807 .......................................................
Mpf_ENSMPUP00000013796 .......................................................
Mpf_ENSMPUP00000017782 .......................................................
Mpf_ENSMPUP00000019464 .......................................................
Mpf_ENSMPUP00000012725 ifttfafaa..............................................
Mpf_ENSMPUP00000010996 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000009654 .......................................................
Mpf_ENSMPUP00000005385 .......................................................
Mpf_ENSMPUP00000006310 .......................................................
Mpf_ENSMPUP00000007963 .......................................................
Mpf_ENSMPUP00000002310 .......................................................
Mpf_ENSMPUP00000000486 .......................................................
Mpf_ENSMPUP00000007805 .......................................................
Mpf_ENSMPUP00000010246 .......................................................
Mpf_ENSMPUP00000004460 .......................................................
Mpf_ENSMPUP00000014791 .......................................................
Mpf_ENSMPUP00000003154 .......................................................
Mpf_ENSMPUP00000005214 .......................................................
Mpf_ENSMPUP00000003932 .......................................................
Mpf_ENSMPUP00000008710 .......................................................
Mpf_ENSMPUP00000005632 .......................................................
Mpf_ENSMPUP00000002828 .......................................................
Mpf_ENSMPUP00000017859 ycfsf..................................................
Mpf_ENSMPUP00000013754 .......................................................
Mpf_ENSMPUP00000004548 .......................................................
Mpf_ENSMPUP00000000646 .......................................................
Mpf_ENSMPUP00000004473 .......................................................
Mpf_ENSMPUP00000000402 .......................................................
Mpf_ENSMPUP00000007412 .......................................................
Mpf_ENSMPUP00000004935 .......................................................
Mpf_ENSMPUP00000011513 .......................................................
Mpf_ENSMPUP00000001759 .......................................................
Mpf_ENSMPUP00000008353 .......................................................
Mpf_ENSMPUP00000012083 .......................................................
Mpf_ENSMPUP00000006956 .......................................................
Mpf_ENSMPUP00000014860 .......................................................
Mpf_ENSMPUP00000009647 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000005109 .......................................................
Mpf_ENSMPUP00000006149 .......................................................
Mpf_ENSMPUP00000001981 .......................................................
Mpf_ENSMPUP00000017916 .......................................................
Mpf_ENSMPUP00000003318 .......................................................
Mpf_ENSMPUP00000017175 .......................................................
Mpf_ENSMPUP00000016038 .......................................................
Mpf_ENSMPUP00000016192 .......................................................
Mpf_ENSMPUP00000015325 .......................................................
Mpf_ENSMPUP00000000660 .......................................................
Mpf_ENSMPUP00000005493 raraqssqaqqya..........................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000013796 .......................................................
Mpf_ENSMPUP00000010667 .......................................................
Mpf_ENSMPUP00000013126 .......................................................
Mpf_ENSMPUP00000018046 .......................................................
Mpf_ENSMPUP00000006359 .......................................................
Mpf_ENSMPUP00000015086 .......................................................
Mpf_ENSMPUP00000008387 .......................................................
Mpf_ENSMPUP00000015207 .......................................................
Mpf_ENSMPUP00000004217 awvyreinddlsyqmdchaveceskleakklahammeafkktfhsmk........
Mpf_ENSMPUP00000015689 .......................................................
Mpf_ENSMPUP00000015159 .......................................................
Mpf_ENSMPUP00000018833 .......................................................
Mpf_ENSMPUP00000007866 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000010694 .......................................................
Mpf_ENSMPUP00000013131 .......................................................
Mpf_ENSMPUP00000000312 .......................................................
Mpf_ENSMPUP00000019132 .......................................................
Mpf_ENSMPUP00000015959 .......................................................
Mpf_ENSMPUP00000012612 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000007989 .......................................................
Mpf_ENSMPUP00000016156 .......................................................
Mpf_ENSMPUP00000013721 .......................................................
Mpf_ENSMPUP00000005447 .......................................................
Mpf_ENSMPUP00000015768 .......................................................
Mpf_ENSMPUP00000004215 .......................................................
Mpf_ENSMPUP00000010108 .......................................................
Mpf_ENSMPUP00000002188 .......................................................
Mpf_ENSMPUP00000013446 .......................................................
Mpf_ENSMPUP00000012407 .......................................................
Mpf_ENSMPUP00000017043 .......................................................
Mpf_ENSMPUP00000007898 .......................................................
Mpf_ENSMPUP00000017064 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000016461 .......................................................
Mpf_ENSMPUP00000008230 .......................................................
Mpf_ENSMPUP00000001993 .......................................................
Mpf_ENSMPUP00000014500 .......................................................
Mpf_ENSMPUP00000002405 .......................................................
Mpf_ENSMPUP00000002933 .......................................................
Mpf_ENSMPUP00000007268 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000010498 .......................................................
Mpf_ENSMPUP00000018101 .......................................................
Mpf_ENSMPUP00000002033 tfafs..................................................
Mpf_ENSMPUP00000010694 .......................................................
Mpf_ENSMPUP00000008353 .......................................................
Mpf_ENSMPUP00000009754 .......................................................
Mpf_ENSMPUP00000015718 .......................................................
Mpf_ENSMPUP00000002358 .......................................................
Mpf_ENSMPUP00000005077 .......................................................
Mpf_ENSMPUP00000009107 .......................................................
Mpf_ENSMPUP00000016101 .......................................................
Mpf_ENSMPUP00000011911 .......................................................
Mpf_ENSMPUP00000007938 .......................................................
Mpf_ENSMPUP00000009676 .......................................................
Mpf_ENSMPUP00000005809 .......................................................
Mpf_ENSMPUP00000016410 .......................................................
Mpf_ENSMPUP00000006638 .......................................................
Mpf_ENSMPUP00000005803 .......................................................
Mpf_ENSMPUP00000010983 .......................................................
Mpf_ENSMPUP00000000717 .......................................................
Mpf_ENSMPUP00000002793 .......................................................
Mpf_ENSMPUP00000007833 .......................................................
Mpf_ENSMPUP00000002271 .......................................................
Mpf_ENSMPUP00000010974 .......................................................
Mpf_ENSMPUP00000010755 .......................................................
Mpf_ENSMPUP00000013112 ds.....................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0050517 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Synechococcus elongatus PCC 7942
NoYes   Rivularia sp. PCC 7116
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Enterococcus sp. 7L76
NoYes   Weissella koreensis KACC 15510
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria innocua Clip11262
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Geobacillus sp. JF8
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Pelobacter propionicus DSM 2379
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Mesorhizobium sp. BNC1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Photobacterium profundum SS9
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Pyrococcus yayanosii CH1
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechococcus elongatus PCC 6301
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. CBDB1
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus parasanguinis FW213
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus thermophilus MN-ZLW-002
NoYes   Streptococcus thermophilus JIM 8232
NoYes   Streptococcus thermophilus ND03
NoYes   Streptococcus thermophilus CNRZ1066
NoYes   Streptococcus thermophilus LMG 18311
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis TL13
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis D12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Streptococcus salivarius CCHSS3
NoYes   Streptococcus salivarius JIM8777
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Variovorax paradoxus B4
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Acinetobacter junii SH205
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Pyrococcus sp. NA2
NoYes   Natronobacterium gregoryi SP2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]