SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

PH domain-like alignments in Myotis lucifugus 76_2.0

These alignments are sequences aligned to the 0053889 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2elba2               nrnl..........................................................................
ENSMLUP00000006551  atgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtryh
ENSMLUP00000010306  dygtvfdqlvaeqsgterevtelsmgelllhspvawlnpflslgkarkdleltvfvfkravilvykencklkkklpsn
ENSMLUP00000002181  qlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtqvtreaislvceavpgakga
ENSMLUP00000007103  edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevdlfistq......
ENSMLUP00000015991  nhdpqfepivslpeqeiktleedeeelfkm................................................
ENSMLUP00000011751  acplpgpgdptpgsrqdrhflqhllgmgmnycvkymgcievlqsmrsldfgmrtqvtreaisrlceavpgangatkkr
ENSMLUP00000006051  grpgeepppsappasdqvlgagvtyvvkylgcievlrsmrsldfstrtqitreaisrvceavpgakgafrkrkppskm
ENSMLUP00000006484  eveyesvlcvkpdvsvyripprasnrgyrasdwkldqpd.......................................
ENSMLUP00000022507  nsaaellkqgaacnvwylgslemesltgpqavqkalsatlaqqppplstvvhfkvsaqgitltdnqrklffrrh....
ENSMLUP00000014236  edlidgiifaanylgstqllsernpsknirmmqaqeavsrvkrmqkaakikkkahsegdaqtltevdlfis.......
ENSMLUP00000006854  nsttdllkqgaacnvlfvnsvdmesltgpqaiskatsetlaadptpaativhfkvsaqgitltdnqrklffrrh....
ENSMLUP00000003954  vilesif.......................................................................
ENSMLUP00000009991  eqpifstrahvfqidpntkknwvptskhavt...............................................
ENSMLUP00000007057  kdktwmhtpealskhyipynakflgsteveqpkgtevvrdavrklkfarhikksegqkipkvelqisiygvkilepkt
ENSMLUP00000019012  dwgepsitlrppneatastpvqywqhhpeklifqscdykafylgsmlikelrgtestqdacakmrancqksteqmkkv
ENSMLUP00000005088  hfepvvplpdkievktgeedeeeffcnraklfrfdaeskewke...................................
ENSMLUP00000009827  edlcdgvifgakylgstqlvsernpppstrmaqaqeamdrvkapdgetqpmtevdlf.....................
ENSMLUP00000007432  l.............................................................................
ENSMLUP00000014622  ymgcievlrsmrsldfntrtqvtreainrlheavpgvrgswkkkapnkalasilgksnlrfagmsiavsistdglnls
ENSMLUP00000004098  dsrasclkrsagchvlylssvsvetltgalavqkaisailerdvlptptvvhfkvteqgitltdvqrkvffrrhypls
ENSMLUP00000014409  illeeqlikksqqk................................................................
ENSMLUP00000004165  lkahsffesitwenlhhqtppkltaylpamseddedcygnydnllsqfgcmqvsssssshslsasdtglpqragsnie
ENSMLUP00000005117  idkiarwqvsivdwegrdildrs.......................................................
ENSMLUP00000011092  eqpifstrahvfqidpatkrnwip......................................................
ENSMLUP00000001759  emyginyfeiknkkg...............................................................
ENSMLUP00000005088  fepvvplpdlvevssgeeneqvvfshraklyrydkdvgqwkergigdiki............................
ENSMLUP00000005088  nedihfepivslpevevksgeedeeilfkeraklyrwdrdvnqwkergvgdikilwhtlknyyri.............
ENSMLUP00000014421  disqyrveetldylvldrkdamitiddgirklklldakgkvwtqdmilqvddravslidlesknelen..........
ENSMLUP00000007415  emygvnyfsiknkkgse.............................................................
ENSMLUP00000000876  mslaalkqhdpyitsiadltgqvalytfcpkanqwektdieg....................................
ENSMLUP00000012407  eppllpgenikdmakdvtyicpftvpvrgtltvtnyrlyfksmeqd................................
ENSMLUP00000010866  emygvnyfeikn..................................................................
ENSMLUP00000015289  seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv....................
ENSMLUP00000014093  peasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhiceeavkrlkatgkkavkavlwvsadglrvvdektkdl
ENSMLUP00000005088  hfepvvqmpekvelvtgeedekvlysqrvklfrfdaeisqwkerglgnlkilknevngklr.................
ENSMLUP00000016145  sileel........................................................................
ENSMLUP00000000362  mpeasrphqwqadedavrkgtcsfpvrylghveveesrgmhvcedavkrlkamgrksvksvlwvsadglrvvddktkd
ENSMLUP00000004624  penwtdtretllegmlfnlkylgmtlveqpkgeemsaaavkrivatakasgkklqkvtlkvsprg.............
ENSMLUP00000004420  lqvdfptpktelvqkfhvqylgmlpvdkpvgmdtlnnaieslmtsssqedwpsvnmsvadatvtvisekneeeilv..
ENSMLUP00000007170  l.............................................................................
ENSMLUP00000007524  qvkaylshgerfikwddettlaspvilrvdpk..............................................
ENSMLUP00000011865  taadllrqgaacsvlyltsvetesltgpqavarassaalgcsprptpavvhfkvsaqgitltdnqr............
ENSMLUP00000009407  emygvnyfairnkkgtelllgvdalg....................................................
ENSMLUP00000017210  emygvnyfairnkkgtelllgvdalg....................................................
ENSMLUP00000001866  idkigqwkkialwgqggedildrsseli..................................................
ENSMLUP00000007867  hfrddddgpvssqgympylnkyildkveegafvkehfdelcwtltakknyragsngnsmlsnqdafrlwclfnflsed
ENSMLUP00000011713  emygirlhpakdregtkinlavantgilvfqgftkinafnwakvrklsfkrkrfliklr...................
ENSMLUP00000009897  vprlpgeiritdkeviyicpfngpikgrvyitnyrlylrsletdsalildvplgvisriekmggatsrgensyg....
ENSMLUP00000009921  aplfpgesikaivkdvmyicpfmgavsgtltvtdfk..........................................
ENSMLUP00000000027  raaewqldqpswsgrlritakgqvayikledrtsgelfaqapvdqfpgtave..........................
ENSMLUP00000019003  raaewqldqpswsgrlritakgqvayikledrtsgelfaqapvdqfpgtave..........................
ENSMLUP00000006515  emygirfhkasdregakinlavsh......................................................
ENSMLUP00000010025  rksldlttrkmihegpltwriskdktldlhvllledllvlllkqdeklllkchsktamgssds...............
ENSMLUP00000003276  dkdtvpdnhrnkfkvinvdddgnelgsgimeltetelilytrkr..................................
ENSMLUP00000012185  mygvdlhhakdsegvdiklgvcanglliykdrlrinrfawpkilkisykrsnfyikvrpaeleqfestigfklp....
ENSMLUP00000009828  seqsicqarasvmvyddtskkwvpikpgqqgfsriniyhntasstfrvvgvklqdqqvvinysi..............
ENSMLUP00000000547  sfkvwvifnflsedkypliivpeeieyllkkltdamggvwqqeqfedykvnfddgkdglsvwelielvgtgqfskgmd
ENSMLUP00000006939  emygisyfeiknkrgtdlwlgvdalglniyekdhkltpkigflwgeirnisfnkkk......................
ENSMLUP00000013213  elygvefhyardqsnneimigvmsggiliyknrvrmntfpwlkivkisfkc...........................
ENSMLUP00000010899  mygvdlhhakdsegidimlgvcanglliyrdrlrinrfawpkilkisykrsnfyikirpgeyeqfestigfklpnhrs
ENSMLUP00000014701  mygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnf.........................
ENSMLUP00000001355  dmygirphpasdgegmqihlavah......................................................
ENSMLUP00000004002  cpqhrvehlmtcklgtqgvrepkdavqrlqeldaqgrvwsqnlllq................................
ENSMLUP00000003010  klseypdveelrnldltkrk..........................................................
ENSMLUP00000014344  aikkmneiqknidgwegkdigqcc......................................................
ENSMLUP00000011779  shlrqssdpmlsefknlditkkk.......................................................
ENSMLUP00000004968  ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqriwvnislsgikiidektg
ENSMLUP00000006705  rwrlsrtlaakvelvdiqregalrfmvaddaaagpga.........................................
ENSMLUP00000013438  mygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeqe...............
ENSMLUP00000013178  etygvdphpckdstgtttflgftaagfvvfqgnkrthlikwpdvcklkfegktfyvigtqkek...............
ENSMLUP00000017586  rtsseevlknartlppqylgsmlikdlrgtestqdacakmrkstehmrkvptitlsitykgvkfidasnknviaehei
ENSMLUP00000000009  emygvdmhvvkardgndyslgltptgvlvfegetkiglffwpkitrldfkktkltlvvvedddqgk............
ENSMLUP00000009616  tgydgnlsdlgkllmqgsfsvwtdhkkghakvkdl...........................................
ENSMLUP00000001998  emygvdmhvvrgrdgceyslgltptgilifegankiglffwpkitkmdfkkskltlvvvedddqgreqe.........
ENSMLUP00000012742  rdgipdnhptkfkvtnvddegvelgsgvmeltqselvlhlhrreavrwpylclrrygyds..................
ENSMLUP00000000119  vwtsglleihealviqqrgvriydgeekikfdagt...........................................
ENSMLUP00000003793  qqsslqhkskkknkgplagkskrrisckdlgrg.............................................
ENSMLUP00000003076  aikkmneiqknidgwegkdigqccn.....................................................
ENSMLUP00000013179  fppvaaqdlpc...................................................................
ENSMLUP00000012676  yarvravvmtrddssggwlplggsglscvtvcrashqeedgcsdflirger...........................
ENSMLUP00000013417  maaltknsdwvdqfrvkflgsvqvpyhkgndvlcaamqkiattrrltvhfnppsscileisvrgvkigvkaddsqeak
ENSMLUP00000010021  dkecfkcalgsswiisvelaigpeegis..................................................
ENSMLUP00000005492  dlksssklknglpfrkedmlq.........................................................
ENSMLUP00000017245  ftvkfirevtpyikkpslvsdlpwegaapqspsfsgsedsgspkh.................................
ENSMLUP00000005975  ftvkfirevtpyikkpslvsdlpwegaapqspsfsgsedsgspkh.................................
ENSMLUP00000013604  mssavvqlyaadrncmwskkcsgvaclvkdnpqr............................................
ENSMLUP00000013658  dlksssklknglpfrkedmlq.........................................................
ENSMLUP00000014884  matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmygdik...........................
ENSMLUP00000015073  vfdmlgrkcwtlattviqlymamppgaerwtkkhcgavcfvk....................................
ENSMLUP00000011388  psfleqgqvfldyektesfvfepnclfkvdefgffltwksegkegqvlecslinsirlgatpkdpkilaaleavgkse
ENSMLUP00000004364  etygvdphpckdvsgnaaflaftpfgfvvlqgnkrvhfikwnevtk................................
ENSMLUP00000009774  eddfwfrgfnmrtgergvfpafyahavpgpakdllgskrspcwverfdvqflgsvevpchqgngilcaamqkiatark
ENSMLUP00000008949  llavkymreatpyvkkgspvseigwetpppesprlgsgssdplasssqpfsfhrd.......................
ENSMLUP00000013558  kcllekvevitgeeaesnvlqiqcklfvfdktsqswvergrgllrlndmasaddg.......................
ENSMLUP00000013327  emygvdlhpvygenkseyflgltpvgvvvyknkkqvgkyfwpritkvhfk............................
ENSMLUP00000013892  rkelelqilteairswegddiktlgnviymsqvmiqcagse.....................................
ENSMLUP00000011043  fqvefpapknelvqkfqvyylgnvpvakpvgvdvingalesvlsss................................
ENSMLUP00000004420  fegatlryaslklrnaphadddscsinsdpeakcfavrslgwvemaeddlapgkssvavnncirqlsyckndirdtvg
ENSMLUP00000001083  dvnlke........................................................................
ENSMLUP00000006407  ssrnlvtlrvdsngfflywtgpnmevdtldissi............................................
ENSMLUP00000020850  vrvravvmarddssggwlpvgggglsqvslcrvqgarpeggarqghyvihgerlrdqkttle................
ENSMLUP00000001631  t.............................................................................
ENSMLUP00000007486  vqreqnerfnvylmptpnldiygectmqitheniylwdihnakvklvmwplsslrrygrdstwftfe...........
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  p.............................................................................
ENSMLUP00000015365  lealeqlqshiegwegsnltdict......................................................
ENSMLUP00000020676  lealeqlqshiegwegsnltdict......................................................
ENSMLUP00000006371  tdlkeqgqllhrdpftvicgr.........................................................
ENSMLUP00000007133  rkqlelqilsepiqawegediktlgnvifmsqvmvqygtceek...................................
ENSMLUP00000002508  levleewqshiegwegsnitdtct......................................................
ENSMLUP00000001462  kssnkvhsfgkrdqairrnpnv........................................................
ENSMLUP00000015489  vnlkeqgqlrcrdefivycgrkky......................................................
ENSMLUP00000019635  fkevwqvvlkpkglgqtknligiyrlcltsktisfvklnteaaavvlqlmn...........................
ENSMLUP00000005155  evvlevkymkevspyfknsasgtsvgwdsppasplqrqpsspgppprdfnga..........................
ENSMLUP00000010240  gnlnelgkmivqgafsvwtghkkgatkmkdfarfkpmq........................................
ENSMLUP00000004993  sadrnhlkrspshlpcfppkpps.......................................................
ENSMLUP00000002012  dfygvelhsgrdlhnlnlmigiasagiavyrkyictsfypwvnilkisfkrkkffihqrqkqtesrdhivafnmlnyr
ENSMLUP00000009146  lrrhhchacgkivcrncsrnkyplkylkdrmakvcdgcygelkkrggdvpglmrerpvsmsfplssprfssssfssvf
ENSMLUP00000002140  denldvqgelilqdafqvwdp.........................................................
ENSMLUP00000014437  vqceqtdrfnvfllpcpnldvygecklqitheniylwdihnprvk.................................
ENSMLUP00000003504  n.............................................................................
ENSMLUP00000001212  pelsaqe.......................................................................
ENSMLUP00000000142  lrqitnfqlsienldqslahygr.......................................................
ENSMLUP00000011713  nkspdeatvadqeseddlsasrtslerqaphrgntmvhvcwhrntsvsmvdfsvavenq...................
ENSMLUP00000011537  n.............................................................................
ENSMLUP00000008290  ereqserfnvylmpspnldvhgecalqityehiclwdaqnprvkliswplsalrrygrdaawf...............
ENSMLUP00000011975  gtlealge......................................................................
ENSMLUP00000012342  airkmdnlkklleiyemlgeeedivnp...................................................
ENSMLUP00000022464  dlksssklknglpfrkedmlqr........................................................
ENSMLUP00000006515  psdevsleqeseddahgphsssegqgqhranttvhvcwyrntsvsradhsaaven.......................
ENSMLUP00000002051  ektdvegtlfvytrsaspkygftimnrlsmenrtepitk.......................................
ENSMLUP00000009895  msrrrisckdlgh.................................................................
ENSMLUP00000003910  qdh...........................................................................
ENSMLUP00000010202  kkpqvaykteiiggvvvhtpinqnggdgqeggepgshailrrsqsyipttgcrvptg.....................
ENSMLUP00000000726  dgkivaqgklllqdtflvtdqdagllprcrerrvflfeqivifsepldkkkgfstpgflfknsik.............
ENSMLUP00000014255  ptygvhyyavkdkqgipwwlglsykgifqydyhd............................................
ENSMLUP00000009304  vvvgwphknvvrelfrepakvslvlkkvpvpetppqsppqalgspqlrvpslaqdplspratsedvfafnltsnpspg
ENSMLUP00000000726  egfde.........................................................................
ENSMLUP00000018812  pkcllkkidvitgeeaeynvlkincklfvfnkttpswtergrgalrlnd.............................
ENSMLUP00000002452  pkcllkkidvitgeeaeynvlkincklfvfnkttpswtergrgalrlnd.............................
ENSMLUP00000009837  v.............................................................................
ENSMLUP00000015435  havrlqeiqslltnwkgpdltsygelvlegtfri............................................
ENSMLUP00000009557  p.............................................................................
ENSMLUP00000015519  erlkitalpl....................................................................
ENSMLUP00000004997  ptygvhyyavkdkqglpwwlgisykgigqydlqdkvkprklfqwkqlenlyfrekkfavevhdprrisvsrrtfgqsg
ENSMLUP00000009040  gvgrgggaagptsg................................................................
ENSMLUP00000009186  praqtpvpgkgpfgreellr..........................................................
ENSMLUP00000006019  ensiysswqevgtfpvvvqrteaatrcqlkgpyilllgqdaiqlsepgspqalytwpy....................
ENSMLUP00000004311  enktytklkngdvfrkqaliskertllhdglvfwktatgrfkedilallltdvllflqekdqkyifaavdq.......
ENSMLUP00000006153  flelldheyltstvrekkaviadillriqasrgsevrdhapkqetpsslpappqmplpeipqpwlppdsgppplptss
ENSMLUP00000001771  aikemerlqdlwevyqrlgleddivdp...................................................
ENSMLUP00000003867  eelhcpsefddtfskkfevlfcgrvtvahkkappalideciekfnhiscsrdkfrsvlqpagpteqghwpmrksfsqp
ENSMLUP00000003333  sstpnple......................................................................
ENSMLUP00000020254  shthmqqllktkstqcpslscassgglaagsplnssshssvewsqtgsqashaemaapsntevsavtsitdeleqrli
ENSMLUP00000007954  dsksimrmksgqmfakedlkrkklvrdgs.................................................
ENSMLUP00000014165  epppevlkeavlrysladeasmdsgarwqrgrlalrargpggv...................................
ENSMLUP00000015532  dgfgqeifpvkdnhgnsvhlgiffmgifvrnrigrqavihrwndmgnithnkstilvelinkeetvlfh.........
ENSMLUP00000006515  enlqkltelqrdlvgienliap........................................................
ENSMLUP00000015042  gv............................................................................
ENSMLUP00000000573  lfseierlehklnqtpekwqqlwervavdlkeepradrpqrhppgspgmvstnlppyqkrsllhlpdsvaeeqsasis
ENSMLUP00000002140  gtltaqgkllqqdtfyvieldagmqsrtkerrvflfeqivifsellrkgsvtpgymfkr...................
ENSMLUP00000009833  dqetyrceliqgwnitvdlvigpkgirqmtsqdakptclaefkqiksircllleegeavlqldi..............
ENSMLUP00000014256  ttpvyttlkgkatqissspfldessgseeeessrcssrtsesdtrsrsgpgspramkrgvslssvasesdyaippday
ENSMLUP00000014449  pckefavtmrpteasercrlrgaytlrigkgalelwggpeprallydwayrilrrfgrdkvtfs..............
ENSMLUP00000002296  vqceglaeqlifnsltnclgpr........................................................
ENSMLUP00000001022  egkltaqgkllgqdtfwvtepeaggllssrgrerrvflfeqivifsealgggvrggtqpgyvykssikv.........
ENSMLUP00000015339  p.............................................................................
ENSMLUP00000012336  sdcinsmvegselkkvr.............................................................
ENSMLUP00000022476  yrk...........................................................................
ENSMLUP00000014752  vslstpaqlvapsvvvkgilsvtsselyfevdeedpnfknidpkilayte............................
ENSMLUP00000011116  ntrrinivencfgaagqpltipgrvli...................................................
ENSMLUP00000006182  pslg..........................................................................
ENSMLUP00000002497  lreirqfqlsienlnqpvllfgrpqgdgeirittldkhtkqeskiflfflavivc.......................
ENSMLUP00000001331  assastisslsslstkskppqyvnkvhcwqredgemqdsgndpllilsslsp..........................
ENSMLUP00000009696  irkmermhkllkvyellggeedivsp....................................................
ENSMLUP00000007783  rtqemps.......................................................................
ENSMLUP00000013998  vy............................................................................
ENSMLUP00000002874  eesyiqsmepgakcfavrslgwvevpeedlapgkssiavsnciqqlaqtrsrsqppagawgeg...............
ENSMLUP00000004775  dsyivrvkavvmtrddssggwfpqegggisrvgvckvmhpengrsgflihgerqkdklsilasltlpmphsetvlsvv
ENSMLUP00000002874  rqaelldavsqaaqkyqalymgtlpvtkamgmdvlneaigilttrgdreawvpatlsvsdslmtahpiqaeada....
ENSMLUP00000015873  qk............................................................................
ENSMLUP00000019971  slassastisslsslstkkiptsahgprsfnrtvharphvdpllilsslspqds........................
ENSMLUP00000009770  ykdvwqvivkpglghrkelsgvfrlcltdeevvfvrlntevasvvvq...............................
ENSMLUP00000008335  q.............................................................................
ENSMLUP00000020205  cda...........................................................................
ENSMLUP00000014596  erwkdnwdrvkaaqrlegrpdgrgtpssllvssvphhrrslgvylqegpvgstlslsldsdqssgsttsgsrqaarrs
ENSMLUP00000011059  skdnedafynsqkfevlycgkvtvthkkapssliddciekfslheqqrlrgqgehgpdaanhravfevegpsspadil
ENSMLUP00000019635  d.............................................................................
ENSMLUP00000004596  psf...........................................................................
ENSMLUP00000004060  spmsslssegdyappdacsldsdysephklqrtssystegtnpgrse...............................
ENSMLUP00000010430  gpaphrprcitkfaqyvgsfsvddldtqegvwl.............................................
ENSMLUP00000000775  npfgesgggtksetedsilhqlfivrflgsmevksddnpdvvyetmrqilaaraihnifrmteshllvtcd.......
ENSMLUP00000006337  rpsvrvspasswgvrynkahflreranarmwekggihvaas.....................................
ENSMLUP00000010159  vagg..........................................................................
ENSMLUP00000004167  rhsyplsstsgnadssvissspispyacfygssak...........................................
ENSMLUP00000001945  eygvhfhrvhpekksqtgillgvcskgvlvfevhngvrtlvlrfpwretkkisfskkkitlqntsdgikh........
ENSMLUP00000014265  deeendeppkvvvtevkeedaf........................................................
ENSMLUP00000004630  al............................................................................
ENSMLUP00000014463  epvllpgeivvnevsfvrkciatdtsqydlwgklicsnfkisfitddpmplqkfhyrnlllgehdvpltcieqivtvn
ENSMLUP00000011713  menfqklhelkkdligvdnlvip.......................................................
ENSMLUP00000010988  enygiewhsvrdsegqklligvgpegisickddftpinriaypvvqmatqsgk.........................
ENSMLUP00000022232  rsqfwvtvqrteaaercglhgsyvlrveaekltlltag........................................
ENSMLUP00000012079  egp...........................................................................
ENSMLUP00000015465  v.............................................................................
ENSMLUP00000001381  qdvllmqk......................................................................
ENSMLUP00000014433  rrhhcracgkivcqacssnkcgldylknqparvcehcfqelqkldhqhspkigspgnhksssalssvlqsipsgrkqk
ENSMLUP00000002430  sdcisfmqagcelkkvr.............................................................
ENSMLUP00000001136  spsglpeedsvlfnkltylgcmkvssprnevealramatmksssqypfpvtlyvpnvpegsvriidqssnveiasfpi
ENSMLUP00000007700  v.............................................................................
ENSMLUP00000002685  haarlqevqrqlggwtgpelsafgelvlegsfrggggggprlrgg.................................
ENSMLUP00000003527  gqgdsegsspftpvadedsvvfskltylgcasvnaprsevealrmmsilrsqcqisldvtlsvpnvsegtvrlldpqt
ENSMLUP00000000189  etqallgcgagvncfsgdpeaptplalaeqagqtlqmeflrnnrttevprldlmkplekhysvvlpt...........
ENSMLUP00000005172  fkaknikkkkvsimvsvagvkvilkkkrqkkewtwdetkmlvmqdpiyr.............................
ENSMLUP00000005760  tpepgaavykhgalvrkvhadpdcr.....................................................
ENSMLUP00000003875  lacrasmsdnqswnssgseedpetefg...................................................
ENSMLUP00000014433  nfqklmqiqyslnghheivqpgrv......................................................
ENSMLUP00000010635  nvdaa.........................................................................
ENSMLUP00000001299  pplwdrdkrffipeclkhifkehmaenilsptn.............................................
ENSMLUP00000014110  lfntvgldekqsattllvgprhgishvidlktnlttvlsefskiskiqlfrenqgvarve..................
ENSMLUP00000010539  gvsfflvkekmkgknklvprllgitkecvmrvdektkevi......................................
ENSMLUP00000011416  mhkllevyeqlggeeavvnpa.........................................................
ENSMLUP00000001779  skrkklhitsedptytvlylgnattiqargdgctdlavgkiwskseagrqgtkmkltvsaqgirmvhaeeralrrpgh
ENSMLUP00000015042  kr............................................................................
ENSMLUP00000005045  cmsvmqsgtqmiklkrgtkglvrlfyldehrtrlrwrpsrksekakilidsiykvtegrqseifhrqae.........
ENSMLUP00000004048  tkislredinlstmels.............................................................
ENSMLUP00000015550  sslcsqk.......................................................................
ENSMLUP00000005543  vspiv.........................................................................
ENSMLUP00000002060  nev...........................................................................
ENSMLUP00000002846  k.............................................................................
ENSMLUP00000015512  digelgrllrhgafsvwtvhkerskvtgfirfkpsqrqlylfergivfckirmepsdqgpaphysfkksmkwttlsih
ENSMLUP00000008542  gvsfflvkekmkgknklvprllgitkdsvmrvdektk.........................................
ENSMLUP00000014804  v.............................................................................
ENSMLUP00000010863  ykqgilarkmhhdvdgk.............................................................
ENSMLUP00000000163  isdcklsdispigrdpsvssfssstltpsstcpslvdsrsnsvdqnkplvplipvlltcpstptlllssviphigspi
ENSMLUP00000010492  yk............................................................................
ENSMLUP00000012859  aslgsqk.......................................................................
ENSMLUP00000011587  grvfkatlvqaekrsevtllvgprygishvintktnlvalladfshvnriemfteeeslvrve...............
ENSMLUP00000018248  am............................................................................
ENSMLUP00000007856  am............................................................................
ENSMLUP00000014214  dvavhyyrlykdkreieasltlgltmrgiqifqnldeekqllydfpwtnvgklvfvgkkfeilpdglpsarkliyyt.
ENSMLUP00000008400  slaapkma......................................................................
ENSMLUP00000004048  s.............................................................................
ENSMLUP00000004605  dpsvi.........................................................................
ENSMLUP00000006812  eklvfsvdcelitiidiipgrleittqhiyfydgsiekedgvgfdfkwphsqvreihlrryn................
ENSMLUP00000014871  egygeesypaknsypvslpsisclgnrfrkhkerkgppvifrwhdianm.............................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  mavnqnhtenrrkpyipygesvlnqcsdvelsfpeqppgsnffhgtkrgtllltsyrvif..................
ENSMLUP00000012996  st............................................................................
ENSMLUP00000013711  lpsh..........................................................................
ENSMLUP00000006780  i.............................................................................
ENSMLUP00000005342  gkifnatlmlqdresyvallvgakygisqiinsklnimstlaefanisrvelteesekvsv.................
ENSMLUP00000006369  f.............................................................................
ENSMLUP00000010845  rqy...........................................................................
ENSMLUP00000015600  sskggggagg....................................................................
ENSMLUP00000010640  ekiqhmyrcarvqgldtseglllfgkehfyvidgftmtatreirdietlppnmhepiiprgarqgpsqlkrtcsifay
ENSMLUP00000000416  kktl..........................................................................
ENSMLUP00000012342  rrrhhcracghvvcwkcsdykaqleydggklskvckdcyqilsgfadseekkrkgileiesaev..............
ENSMLUP00000007987  nteetsddlispyasfsstadrpm......................................................
ENSMLUP00000012982  lepsseemeknlrpfsnldlmspmlgvapehtrqlllegparvkegreg.............................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  t.............................................................................
ENSMLUP00000004637  mdkpph........................................................................
ENSMLUP00000007008  mdkp..........................................................................
ENSMLUP00000001540  r.............................................................................
ENSMLUP00000007555  qv............................................................................
ENSMLUP00000010202  pyv...........................................................................
ENSMLUP00000009696  v.............................................................................
ENSMLUP00000000439  vergdipasislseidslsqgnkspfkadtdgsqlgnssvshpsiihiesenlpetvkknyqeetpettvspveyqdk
ENSMLUP00000021531  vvergdipasislseidslsqgnkspfkadtdgsqlgnssvshpsiihiesenlpetvkknyqeetpettvspveyqd
ENSMLUP00000008335  q.............................................................................
ENSMLUP00000003131  dasilnvamvvgylgsielpstscsleadsfqairgclrrlraeqkihslvtmkimhdgvqlctdkaavlaeypaekl
ENSMLUP00000002636  eefdcdlsdlrdmpeddgepgkgaspepakspslkhaadlppplpnrpppedyyeealplgpgkspeyisshngcspa
ENSMLUP00000012863  v.............................................................................
ENSMLUP00000005038  v.............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  aik...........................................................................
ENSMLUP00000006780  eteddafpeaedsllqqmfivqflgsmavktddtteviyeamrqvlaaraihnifrmteshlmvt.............
ENSMLUP00000001391  trqlvkdgflvevsegsrklrhvflftdvllcaklkktsagkhqqydckwyipladlvfpspeeseasphvhpfpdhe
ENSMLUP00000002099  emmytinsqlefkikpfplvsssrwlvkrgeltayvedtvlfs...................................
ENSMLUP00000004060  alpqgg........................................................................
ENSMLUP00000004167  dvhfegglsqesaqctflcdflyqapsaasklpaekk.........................................
ENSMLUP00000006989  rknsgggysihqhqgnkqfg..........................................................
ENSMLUP00000015169  gsaffevkqttepnfpeilliainkygvslidprtkdiltthpftkisnw............................
ENSMLUP00000000788  li............................................................................
ENSMLUP00000010633  askvllchgel...................................................................
ENSMLUP00000012424  esirvnrrcisvapsretagelllgkcgmyfvednasdtvessspqgelepasfswtyeei.................
ENSMLUP00000021545  gisyfivkfkgsrkdeilgiannrliridlavgdvvktwrfsn...................................
ENSMLUP00000009146  gdllqp........................................................................
ENSMLUP00000016015  ikqqrlnrl.....................................................................
ENSMLUP00000010504  eeliylsqkiefeckifplisqsrwlvksgelaalessvsp.....................................
ENSMLUP00000010306  v.............................................................................
ENSMLUP00000000456  p.............................................................................
ENSMLUP00000009152  eklvlsaecqlvtvvavvpgllevttqhiyfydgsaerveteegvghdfrrpl.........................
ENSMLUP00000008233  qkdslidssrvlcchgelknnrgmklhvflfqevlvitraithneqlcyqlyrqpipvkdllledlqdgevrlggslr
ENSMLUP00000001771  l.............................................................................
ENSMLUP00000002636  eagehatgkgkksslaelkgsmsraagrkitriisfskrkaladdlpmsste..........................
ENSMLUP00000008265  mhqlqgnkey....................................................................
ENSMLUP00000015858  eqmisiqkkmefkiksvpiishsrw.....................................................
ENSMLUP00000007197  gltyylvrfkgskkddilgvsynrliridaatgvpittwrfan...................................
ENSMLUP00000010409  kygllnvtkit...................................................................
ENSMLUP00000006153  t.............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ad............................................................................
ENSMLUP00000014256  slqp..........................................................................
ENSMLUP00000010844  sdaldis.......................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ikqqrlnrlcegssfrkignrrrqerfwycrlalnhkvlhygdlddnpqgevtfeslqekipvadikaivtgkdcphm
ENSMLUP00000004431  kk............................................................................
ENSMLUP00000003867  pneawvafslqlvgslpvhslttmpmlpwvvaevrrlsgqsskkepgtkqvrlcvspsglrcepepektqqwdplics
ENSMLUP00000017606  sqvlayteglhgkwmfseiravfsrryllq................................................
ENSMLUP00000005123  dkagvlhrtktvdkg...............................................................
ENSMLUP00000002234  githfmarfqggkkedligitynrlirmdastgdaiktw.......................................
ENSMLUP00000020202  githfmarfqggkkedligitynrlirmdastgdaiktw.......................................
ENSMLUP00000010185  ytq...........................................................................
ENSMLUP00000020533  layteglhgkwmfseiravfsrryllqn..................................................
ENSMLUP00000018072  ls............................................................................
ENSMLUP00000000937  v.............................................................................
ENSMLUP00000007197  rpk...........................................................................
ENSMLUP00000011043  lrlqgkdlllqleeetlklvep........................................................
ENSMLUP00000013586  ksqikralelgtvmtvfsfrkstperrtvqvimetrqvawsktadkiegfldimeikeirpgksskdferaktvr...
ENSMLUP00000019004  e.............................................................................
ENSMLUP00000003532  rrvkvytlnedrqwddrgtghvsstyveelkgmsllvraesd....................................
ENSMLUP00000010845  qafp..........................................................................
ENSMLUP00000007054  yl............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  lhccdeeisfylrlyehtrdlslflfndallvasrstshtpfertsks..............................
ENSMLUP00000011628  eveqvklldrfstnnksltgtlyltath..................................................
ENSMLUP00000007987  elerplhpkervleqalqwcqlpepcsaslllrkvslaqasclftgvrresp..........................
ENSMLUP00000002234  kpk...........................................................................
ENSMLUP00000020202  kpk...........................................................................
ENSMLUP00000000573  rpallpgeeivceglrvlldpdgreeatggllggpqllpaegalflttyrilfrgtphdqlvgeqtvmrsfpiasitk
ENSMLUP00000004701  rai...........................................................................
ENSMLUP00000000932  mrtgrgrcs.....................................................................
ENSMLUP00000005322  v.............................................................................
ENSMLUP00000002246  rrvkvytlnedrqwddrgtghvssgyverlkgmsllvrae......................................
ENSMLUP00000012242  gflnqqqmlegli.................................................................
ENSMLUP00000015202  ssaavp........................................................................
ENSMLUP00000010100  vr............................................................................
ENSMLUP00000010936  p.............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  dk............................................................................
ENSMLUP00000005842  q.............................................................................
ENSMLUP00000005470  ckvdsigsgrai..................................................................
ENSMLUP00000004401  eklhmeckaemvtplvtnpghvc.......................................................
ENSMLUP00000007384  s.............................................................................
ENSMLUP00000001364  p.............................................................................
ENSMLUP00000012921  ey............................................................................
ENSMLUP00000007470  p.............................................................................
ENSMLUP00000005126  lsnpfrgl......................................................................
ENSMLUP00000010417  kndqhlrrvqallsgrqakgltsgrw....................................................
ENSMLUP00000004167  sqsqaaaa......................................................................
ENSMLUP00000001037  lirqqrllrlcegtlfrkissrrrqdklwfcclspnhkvlqygdvedgasppapeslpeqlpvadlralltgkdcphv
ENSMLUP00000005893  nflnts........................................................................
ENSMLUP00000013677  p.............................................................................
ENSMLUP00000004578  mivgkkpvlslphrrlvcccqlyevpdpnrpqrlglhqrev.....................................
ENSMLUP00000006842  lqhhhavheisyiakditdhrafgyvcgkegnhrf...........................................
ENSMLUP00000000788  r.............................................................................
ENSMLUP00000008066  rai...........................................................................
ENSMLUP00000013630  ihfegkifplisqarwlvrhgelvelaplpaappaklkl.......................................
ENSMLUP00000007116  rvenvrlldrissk................................................................
ENSMLUP00000003711  eqvtqkysvvlvqghlvsealllfghqhfyicenftls........................................
ENSMLUP00000011617  psgeeifatiiitgnggiqwsrgkhkesetlteqdlqlycdfpdiidvsikqas........................
ENSMLUP00000010157  s.............................................................................
ENSMLUP00000008290  y.............................................................................
ENSMLUP00000009645  ttyrrymvtylgkvpttgmqffsgctekpvielwkkhtlaredifpanvllei.........................
ENSMLUP00000006092  lsssty........................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  rgpkk.........................................................................
ENSMLUP00000006542  gav...........................................................................
ENSMLUP00000001230  vlslphrrlvcycrlfevpdpnkpqklglhqreif...........................................
ENSMLUP00000010734  dpklrelldvgnigrlehrmitvvygpdlvni..............................................
ENSMLUP00000003167  mcsnrtllidsrvelkrglq..........................................................
ENSMLUP00000005624  daliaisnyrlhikfkdsvin.........................................................
ENSMLUP00000019375  r.............................................................................
ENSMLUP00000010926  l.............................................................................
ENSMLUP00000009859  sgclpgeqilawapgvrkglepelpgtlictnlrvtfqpcgwqrrqetplssdydfal....................
ENSMLUP00000001711  nirknlaiermivegcdilldtsqtfirqgsliqvpsvek......................................
ENSMLUP00000017505  emygvnyfairnkkgtelllgdalglhiyd................................................
ENSMLUP00000007171  d.............................................................................
ENSMLUP00000003490  yysenevc......................................................................
ENSMLUP00000007987  lyrkphpqhpdhsqllqalcaavagpnllknmtqllcveasegeepwspsaldgsfpgllppdpsldvynevvvpaty
ENSMLUP00000004020  venvtlldcymgkkpangilyltet.....................................................
ENSMLUP00000014449  va............................................................................
ENSMLUP00000016474  gqlvfnsvtnclgp................................................................
ENSMLUP00000006830  k.............................................................................
ENSMLUP00000016017  hagrfsv.......................................................................
ENSMLUP00000012677  iialsnyrlhikfkeslv............................................................
ENSMLUP00000000189  khgmmkfredrsllgl..............................................................
ENSMLUP00000009973  r.............................................................................
ENSMLUP00000010385  nntdtlscsswptspgl.............................................................
ENSMLUP00000007987  pqlpr.........................................................................
ENSMLUP00000009299  direikeirpgktsrdfdryqe........................................................
ENSMLUP00000007456  eelirltqrlrfhkvkalplvswsrrlelqgeltelgcrrggmlftsrp.............................
ENSMLUP00000006103  gllrvaggsgiawspgtqevfqpfcdfpeivdisikqaprvgpagehrlvtitrtdnqileaefpglpaslsfvalv.
ENSMLUP00000012783  pe............................................................................
ENSMLUP00000014471  lvfpifvqpldlcnpartlllseelllyegrnkaaevt........................................
ENSMLUP00000000189  yskrfisvaci...................................................................
ENSMLUP00000012437  qkqifdvvyevdgcpanllsshrsliqrvetislgehpcdrgeqvtlflfndcleiarkrhkvigtfrsphgqtrppa
ENSMLUP00000021530  hqeetesntlqircklfvfgqgllrpndvastgdwtlqsqlvrrtrliintklwaqmqi...................
ENSMLUP00000006501  p.............................................................................
ENSMLUP00000003171  egmimkrsgghripglnccgq.........................................................
ENSMLUP00000011174  ssil..........................................................................
ENSMLUP00000011009  sil...........................................................................
ENSMLUP00000005126  d.............................................................................
ENSMLUP00000008335  av............................................................................
ENSMLUP00000014049  spglqakep.....................................................................
ENSMLUP00000013909  etgt..........................................................................
ENSMLUP00000019004  ydli..........................................................................
ENSMLUP00000004167  ydli..........................................................................
ENSMLUP00000022232  g.............................................................................
ENSMLUP00000018295  khgmmkfredrsvmglgl............................................................
ENSMLUP00000021849  seldlgaqrnvrvwplhp............................................................
ENSMLUP00000006303  gta...........................................................................
ENSMLUP00000015098  ay............................................................................
ENSMLUP00000006492  csavecldlgrgepvsvkplhs........................................................
ENSMLUP00000008454  gqrqlllcetltetvygdrgqlikskerrvfllndmlvcaninfkgqleisslvplgpkyvvkwntalpqvqvvevgq
ENSMLUP00000010385  pv............................................................................
ENSMLUP00000009012  svw...........................................................................
ENSMLUP00000000189  erlgrlpyka....................................................................
ENSMLUP00000014285  pe............................................................................
ENSMLUP00000006019  plet..........................................................................
ENSMLUP00000011245  apwayfcdfrdithvvlrerhvsihcqdkrleltlp..........................................
ENSMLUP00000007987  glvr..........................................................................
ENSMLUP00000008335  tlpy..........................................................................
ENSMLUP00000000103  riqlsgmynvrkg.................................................................
ENSMLUP00000020572  riqlsgmynvrkg.................................................................
ENSMLUP00000009684  sdacaefriryvgaieklkvsegkrlegpldlinyidvaqqdgklpfvpleeevimgvskygikvstpdqydvlhrha
ENSMLUP00000018770  llldglvelkrglqrw..............................................................
ENSMLUP00000007942  cqmdqldri.....................................................................
ENSMLUP00000008949  re............................................................................
ENSMLUP00000007075  nfsyfpeithivi.................................................................
ENSMLUP00000012217  itsksgtapilk..................................................................
ENSMLUP00000014260  egvirkrsgghrvpgftccgrd........................................................
ENSMLUP00000021545  rpr...........................................................................
ENSMLUP00000013488  anh...........................................................................
ENSMLUP00000000189  agslelrg......................................................................
ENSMLUP00000005075  lhllpgeqllceastvlkcvqedscqrgiygklvc...........................................
ENSMLUP00000014442  ..............................................................................


                                                                                                    
                                                                                                    
d2elba2               ..............................................................................
ENSMLUP00000006551  flillfskdedisltlnmneeevekrfegrltknmsgslyemvsrvmkalvnrkitvpgnfqghsgaqcitcsykass
ENSMLUP00000010306  srpahssadldpf.................................................................
ENSMLUP00000002181  srr...........................................................................
ENSMLUP00000007103  ..............................................................................
ENSMLUP00000015991  ..............................................................................
ENSMLUP00000011751  kppvkflstvlgksnlqfsgmnikl.....................................................
ENSMLUP00000006051  lssilgksnlqfagmsisltistas.....................................................
ENSMLUP00000006484  ..............................................................................
ENSMLUP00000022507  ..............................................................................
ENSMLUP00000014236  ..............................................................................
ENSMLUP00000006854  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000009991  ..............................................................................
ENSMLUP00000007057  kev...........................................................................
ENSMLUP00000019012  ptiilsvsykgvkfidatnkn.........................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000009827  ..............................................................................
ENSMLUP00000007432  ..............................................................................
ENSMLUP00000014622  vpatr.........................................................................
ENSMLUP00000004098  tlr...........................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000004165  qyihdldtnsfeldlqfsedekrlllekqasgnpwhqfvennl...................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000011092  ..............................................................................
ENSMLUP00000001759  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000007415  ..............................................................................
ENSMLUP00000000876  ..............................................................................
ENSMLUP00000012407  ..............................................................................
ENSMLUP00000010866  ..............................................................................
ENSMLUP00000015289  ..............................................................................
ENSMLUP00000014093  ivdqtiekvsfcapdrn.............................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000016145  ..............................................................................
ENSMLUP00000000362  llvdqtiekvsfca................................................................
ENSMLUP00000004624  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000007170  ..............................................................................
ENSMLUP00000007524  ..............................................................................
ENSMLUP00000011865  ..............................................................................
ENSMLUP00000009407  ..............................................................................
ENSMLUP00000017210  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000007867  kyplimvpdeveyllkkvlssmslevslaeleellaqeaqaaqttgglsvwqflelfnsgrclrgvgrdtlsmaihev
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000009897  ..............................................................................
ENSMLUP00000009921  ..............................................................................
ENSMLUP00000000027  ..............................................................................
ENSMLUP00000019003  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000010025  ..............................................................................
ENSMLUP00000003276  ..............................................................................
ENSMLUP00000012185  ..............................................................................
ENSMLUP00000009828  ..............................................................................
ENSMLUP00000000547  rqtvsmainevfnelil.............................................................
ENSMLUP00000006939  ..............................................................................
ENSMLUP00000013213  ..............................................................................
ENSMLUP00000010899  a.............................................................................
ENSMLUP00000014701  ..............................................................................
ENSMLUP00000001355  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000003010  ..............................................................................
ENSMLUP00000014344  ..............................................................................
ENSMLUP00000011779  ..............................................................................
ENSMLUP00000004968  viehehpvnkisfiardvtdnrafgy....................................................
ENSMLUP00000006705  ..............................................................................
ENSMLUP00000013438  ..............................................................................
ENSMLUP00000013178  ..............................................................................
ENSMLUP00000017586  rniscaaqdped..................................................................
ENSMLUP00000000009  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000001998  ..............................................................................
ENSMLUP00000012742  ..............................................................................
ENSMLUP00000000119  ..............................................................................
ENSMLUP00000003793  ..............................................................................
ENSMLUP00000003076  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000012676  ..............................................................................
ENSMLUP00000013417  g.............................................................................
ENSMLUP00000010021  ..............................................................................
ENSMLUP00000005492  ..............................................................................
ENSMLUP00000017245  ..............................................................................
ENSMLUP00000005975  ..............................................................................
ENSMLUP00000013604  ..............................................................................
ENSMLUP00000013658  ..............................................................................
ENSMLUP00000014884  ..............................................................................
ENSMLUP00000015073  ..............................................................................
ENSMLUP00000011388  ndlegrivcvcsgtdlvni...........................................................
ENSMLUP00000004364  ..............................................................................
ENSMLUP00000009774  ltvhlrppascdleis..............................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000013558  ..............................................................................
ENSMLUP00000013327  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000004420  iw............................................................................
ENSMLUP00000001083  ..............................................................................
ENSMLUP00000006407  ..............................................................................
ENSMLUP00000020850  ..............................................................................
ENSMLUP00000001631  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  ..............................................................................
ENSMLUP00000020676  ..............................................................................
ENSMLUP00000006371  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000002508  ..............................................................................
ENSMLUP00000001462  ..............................................................................
ENSMLUP00000015489  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000005155  ..............................................................................
ENSMLUP00000010240  ..............................................................................
ENSMLUP00000004993  ..............................................................................
ENSMLUP00000002012  scktlw........................................................................
ENSMLUP00000009146  hsinpstfkkqkkvpsaltevaasg.....................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000003504  ..............................................................................
ENSMLUP00000001212  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000011537  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000011975  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000022464  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000002051  ..............................................................................
ENSMLUP00000009895  ..............................................................................
ENSMLUP00000003910  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000014255  ..............................................................................
ENSMLUP00000009304  sspastdsasldpeplpitpaspatlpaggaetreplenkspvldrkkskgvatrlsrrrvscrelg...........
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000018812  ..............................................................................
ENSMLUP00000002452  ..............................................................................
ENSMLUP00000009837  ..............................................................................
ENSMLUP00000015435  ..............................................................................
ENSMLUP00000009557  ..............................................................................
ENSMLUP00000015519  ..............................................................................
ENSMLUP00000004997  lfvqtwy.......................................................................
ENSMLUP00000009040  ..............................................................................
ENSMLUP00000009186  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000004311  ..............................................................................
ENSMLUP00000006153  lpegyyeeavplspgkapeyitsnydsdamsssyesydeeeedgkgkktrhqwpseeasmdlvkdaki..........
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000003867  glrslayrkefqdgslrshsffssfdendienhlisghnivqptdieenrtmlftigqsevylispdtkkialeknfk
ENSMLUP00000003333  ..............................................................................
ENSMLUP00000020254  iqndkesmvdsncpmgikhlkespsfggnvekdellirpvvkttrhrefedlsnenhseacfqmkfppnttefnsavc
ENSMLUP00000007954  ..............................................................................
ENSMLUP00000014165  ..............................................................................
ENSMLUP00000015532  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000000573  psngvdrraatlysqytskn..........................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009833  ..............................................................................
ENSMLUP00000014256  stdtecsqpeqklpktcssssdngk.....................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000001022  ..............................................................................
ENSMLUP00000015339  ..............................................................................
ENSMLUP00000012336  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000014752  ..............................................................................
ENSMLUP00000011116  ..............................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000001331  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000007783  ..............................................................................
ENSMLUP00000013998  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000004775  fpifckkv......................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000015873  ..............................................................................
ENSMLUP00000019971  ..............................................................................
ENSMLUP00000009770  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000020205  ..............................................................................
ENSMLUP00000014596  tstlysqfqtaese................................................................
ENSMLUP00000011059  leedddipdthpalpavasqpalassrgcfperiledsvfddpqefrsrcssvtglqrkvpenshkpqprrrhasaps
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000010430  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000006337  ..............................................................................
ENSMLUP00000010159  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001945  ..............................................................................
ENSMLUP00000014265  ..............................................................................
ENSMLUP00000004630  ..............................................................................
ENSMLUP00000014463  dhkrkq........................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000010988  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000012079  ..............................................................................
ENSMLUP00000015465  ..............................................................................
ENSMLUP00000001381  ..............................................................................
ENSMLUP00000014433  kipaalkevsan..................................................................
ENSMLUP00000002430  ..............................................................................
ENSMLUP00000001136  ykvlfcarghdgtte...............................................................
ENSMLUP00000007700  ..............................................................................
ENSMLUP00000002685  ..............................................................................
ENSMLUP00000003527  nteianypiyk...................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005172  ..............................................................................
ENSMLUP00000005760  ..............................................................................
ENSMLUP00000003875  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000010635  ..............................................................................
ENSMLUP00000001299  ..............................................................................
ENSMLUP00000014110  ..............................................................................
ENSMLUP00000010539  ..............................................................................
ENSMLUP00000011416  ..............................................................................
ENSMLUP00000001779  lyllhrvt......................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000005045  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000015550  ..............................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  ..............................................................................
ENSMLUP00000002846  ..............................................................................
ENSMLUP00000015512  qler..........................................................................
ENSMLUP00000008542  ..............................................................................
ENSMLUP00000014804  ..............................................................................
ENSMLUP00000010863  ..............................................................................
ENSMLUP00000000163  lgktngdnfnslrpdieeirpgsv......................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000012859  ..............................................................................
ENSMLUP00000011587  ..............................................................................
ENSMLUP00000018248  ..............................................................................
ENSMLUP00000007856  ..............................................................................
ENSMLUP00000014214  ..............................................................................
ENSMLUP00000008400  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000004605  ..............................................................................
ENSMLUP00000006812  ..............................................................................
ENSMLUP00000014871  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  ..............................................................................
ENSMLUP00000012996  ..............................................................................
ENSMLUP00000013711  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000005342  ..............................................................................
ENSMLUP00000006369  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000015600  ..............................................................................
ENSMLUP00000010640  edirev........................................................................
ENSMLUP00000000416  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000012982  ..............................................................................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000004637  ..............................................................................
ENSMLUP00000007008  ..............................................................................
ENSMLUP00000001540  ..............................................................................
ENSMLUP00000007555  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000000439  lylhlkknlskvkayaveigkkipvpdqctiedsvrscvaklfftcslkghyclyskssfilisqepqpwiqimflfq
ENSMLUP00000021531  klylhlkknlskvkayaveigkkipvpdqctiedsvrscvaklfftcslkghyclyskssfilisqepqpwiqimflf
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000003131  afsavcpddrrffg................................................................
ENSMLUP00000002636  hsivdgyyedadssypstrmngemkssyndsdamsssyesydeeeedgkglqpthqwpseeasmhlvr..........
ENSMLUP00000012863  ..............................................................................
ENSMLUP00000005038  ..............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000001391  ledmkmkisalkseiqkekankgqsraierlkkkmfenefllllnspt..............................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000006989  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000016015  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000000456  ..............................................................................
ENSMLUP00000009152  ..............................................................................
ENSMLUP00000008233  gaf...........................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000010844  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ..............................................................................
ENSMLUP00000004431  ..............................................................................
ENSMLUP00000003867  sifeckpqhahklihnshdpsyfaclikddaasrrs..........................................
ENSMLUP00000017606  ..............................................................................
ENSMLUP00000005123  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000010185  ..............................................................................
ENSMLUP00000020533  ..............................................................................
ENSMLUP00000018072  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000003532  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000007054  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  ..............................................................................
ENSMLUP00000011628  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000000573  e.............................................................................
ENSMLUP00000004701  ..............................................................................
ENSMLUP00000000932  ..............................................................................
ENSMLUP00000005322  ..............................................................................
ENSMLUP00000002246  ..............................................................................
ENSMLUP00000012242  ..............................................................................
ENSMLUP00000015202  ..............................................................................
ENSMLUP00000010100  ..............................................................................
ENSMLUP00000010936  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  ..............................................................................
ENSMLUP00000005842  ..............................................................................
ENSMLUP00000005470  ..............................................................................
ENSMLUP00000004401  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000001364  ..............................................................................
ENSMLUP00000012921  ..............................................................................
ENSMLUP00000007470  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000010417  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001037  rek...........................................................................
ENSMLUP00000005893  ..............................................................................
ENSMLUP00000013677  ..............................................................................
ENSMLUP00000004578  ..............................................................................
ENSMLUP00000006842  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000008066  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000007116  ..............................................................................
ENSMLUP00000003711  ..............................................................................
ENSMLUP00000011617  ..............................................................................
ENSMLUP00000010157  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000009645  ..............................................................................
ENSMLUP00000006092  ..............................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  ..............................................................................
ENSMLUP00000006542  ..............................................................................
ENSMLUP00000001230  ..............................................................................
ENSMLUP00000010734  ..............................................................................
ENSMLUP00000003167  ..............................................................................
ENSMLUP00000005624  ..............................................................................
ENSMLUP00000019375  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000009859  ..............................................................................
ENSMLUP00000001711  ..............................................................................
ENSMLUP00000017505  ..............................................................................
ENSMLUP00000007171  ..............................................................................
ENSMLUP00000003490  ..............................................................................
ENSMLUP00000007987  ssflycgpisnkagpppprrgrd.......................................................
ENSMLUP00000004020  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000016017  ..............................................................................
ENSMLUP00000012677  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000009973  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000007456  ..............................................................................
ENSMLUP00000006103  ..............................................................................
ENSMLUP00000012783  ..............................................................................
ENSMLUP00000014471  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000012437  sl............................................................................
ENSMLUP00000021530  ..............................................................................
ENSMLUP00000006501  ..............................................................................
ENSMLUP00000003171  ..............................................................................
ENSMLUP00000011174  ..............................................................................
ENSMLUP00000011009  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000014049  ..............................................................................
ENSMLUP00000013909  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000018295  ..............................................................................
ENSMLUP00000021849  ..............................................................................
ENSMLUP00000006303  ..............................................................................
ENSMLUP00000015098  ..............................................................................
ENSMLUP00000006492  ..............................................................................
ENSMLUP00000008454  eggsydkdnvliqhagakkssasgqaqskvyfgpprlfqelqdlqkdlavveqitllistlhgtyqnlnmtvaqdwcl
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000009012  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000014285  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000011245  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000000103  ..............................................................................
ENSMLUP00000020572  ..............................................................................
ENSMLUP00000009684  ly............................................................................
ENSMLUP00000018770  ..............................................................................
ENSMLUP00000007942  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000007075  ..............................................................................
ENSMLUP00000012217  ..............................................................................
ENSMLUP00000014260  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000013488  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005075  ..............................................................................
ENSMLUP00000014442  ..............................................................................


                                                                                                    
                                                                                                    
d2elba2               ..............................................................................
ENSMLUP00000006551  gllyplergfiyvhkppvhirfdeisf...................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000002181  ..............................................................................
ENSMLUP00000007103  ..............................................................................
ENSMLUP00000015991  ..............................................................................
ENSMLUP00000011751  ..............................................................................
ENSMLUP00000006051  ..............................................................................
ENSMLUP00000006484  ..............................................................................
ENSMLUP00000022507  ..............................................................................
ENSMLUP00000014236  ..............................................................................
ENSMLUP00000006854  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000009991  ..............................................................................
ENSMLUP00000007057  ..............................................................................
ENSMLUP00000019012  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000009827  ..............................................................................
ENSMLUP00000007432  ..............................................................................
ENSMLUP00000014622  ..............................................................................
ENSMLUP00000004098  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000004165  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000011092  ..............................................................................
ENSMLUP00000001759  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000007415  ..............................................................................
ENSMLUP00000000876  ..............................................................................
ENSMLUP00000012407  ..............................................................................
ENSMLUP00000010866  ..............................................................................
ENSMLUP00000015289  ..............................................................................
ENSMLUP00000014093  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000016145  ..............................................................................
ENSMLUP00000000362  ..............................................................................
ENSMLUP00000004624  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000007170  ..............................................................................
ENSMLUP00000007524  ..............................................................................
ENSMLUP00000011865  ..............................................................................
ENSMLUP00000009407  ..............................................................................
ENSMLUP00000017210  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000007867  yqeli.........................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000009897  ..............................................................................
ENSMLUP00000009921  ..............................................................................
ENSMLUP00000000027  ..............................................................................
ENSMLUP00000019003  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000010025  ..............................................................................
ENSMLUP00000003276  ..............................................................................
ENSMLUP00000012185  ..............................................................................
ENSMLUP00000009828  ..............................................................................
ENSMLUP00000000547  ..............................................................................
ENSMLUP00000006939  ..............................................................................
ENSMLUP00000013213  ..............................................................................
ENSMLUP00000010899  ..............................................................................
ENSMLUP00000014701  ..............................................................................
ENSMLUP00000001355  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000003010  ..............................................................................
ENSMLUP00000014344  ..............................................................................
ENSMLUP00000011779  ..............................................................................
ENSMLUP00000004968  ..............................................................................
ENSMLUP00000006705  ..............................................................................
ENSMLUP00000013438  ..............................................................................
ENSMLUP00000013178  ..............................................................................
ENSMLUP00000017586  ..............................................................................
ENSMLUP00000000009  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000001998  ..............................................................................
ENSMLUP00000012742  ..............................................................................
ENSMLUP00000000119  ..............................................................................
ENSMLUP00000003793  ..............................................................................
ENSMLUP00000003076  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000012676  ..............................................................................
ENSMLUP00000013417  ..............................................................................
ENSMLUP00000010021  ..............................................................................
ENSMLUP00000005492  ..............................................................................
ENSMLUP00000017245  ..............................................................................
ENSMLUP00000005975  ..............................................................................
ENSMLUP00000013604  ..............................................................................
ENSMLUP00000013658  ..............................................................................
ENSMLUP00000014884  ..............................................................................
ENSMLUP00000015073  ..............................................................................
ENSMLUP00000011388  ..............................................................................
ENSMLUP00000004364  ..............................................................................
ENSMLUP00000009774  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000013558  ..............................................................................
ENSMLUP00000013327  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000001083  ..............................................................................
ENSMLUP00000006407  ..............................................................................
ENSMLUP00000020850  ..............................................................................
ENSMLUP00000001631  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  ..............................................................................
ENSMLUP00000020676  ..............................................................................
ENSMLUP00000006371  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000002508  ..............................................................................
ENSMLUP00000001462  ..............................................................................
ENSMLUP00000015489  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000005155  ..............................................................................
ENSMLUP00000010240  ..............................................................................
ENSMLUP00000004993  ..............................................................................
ENSMLUP00000002012  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000003504  ..............................................................................
ENSMLUP00000001212  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000011537  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000011975  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000022464  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000002051  ..............................................................................
ENSMLUP00000009895  ..............................................................................
ENSMLUP00000003910  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000014255  ..............................................................................
ENSMLUP00000009304  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000018812  ..............................................................................
ENSMLUP00000002452  ..............................................................................
ENSMLUP00000009837  ..............................................................................
ENSMLUP00000015435  ..............................................................................
ENSMLUP00000009557  ..............................................................................
ENSMLUP00000015519  ..............................................................................
ENSMLUP00000004997  ..............................................................................
ENSMLUP00000009040  ..............................................................................
ENSMLUP00000009186  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000004311  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000003867  eisfcsqgirhvdh................................................................
ENSMLUP00000003333  ..............................................................................
ENSMLUP00000020254  aadnlfltekpltsdadqyskqdeitlgltsftqeaaecqsiasmrpnaegdkketyyhqmdilhspqkqkalkdwnl
ENSMLUP00000007954  ..............................................................................
ENSMLUP00000014165  ..............................................................................
ENSMLUP00000015532  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009833  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000001022  ..............................................................................
ENSMLUP00000015339  ..............................................................................
ENSMLUP00000012336  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000014752  ..............................................................................
ENSMLUP00000011116  ..............................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000001331  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000007783  ..............................................................................
ENSMLUP00000013998  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000004775  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000015873  ..............................................................................
ENSMLUP00000019971  ..............................................................................
ENSMLUP00000009770  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000020205  ..............................................................................
ENSMLUP00000014596  ..............................................................................
ENSMLUP00000011059  hvqpsdseknrtmlfqvgrfeinlispdtksvv.............................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000010430  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000006337  ..............................................................................
ENSMLUP00000010159  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001945  ..............................................................................
ENSMLUP00000014265  ..............................................................................
ENSMLUP00000004630  ..............................................................................
ENSMLUP00000014463  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000010988  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000012079  ..............................................................................
ENSMLUP00000015465  ..............................................................................
ENSMLUP00000001381  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000002430  ..............................................................................
ENSMLUP00000001136  ..............................................................................
ENSMLUP00000007700  ..............................................................................
ENSMLUP00000002685  ..............................................................................
ENSMLUP00000003527  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005172  ..............................................................................
ENSMLUP00000005760  ..............................................................................
ENSMLUP00000003875  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000010635  ..............................................................................
ENSMLUP00000001299  ..............................................................................
ENSMLUP00000014110  ..............................................................................
ENSMLUP00000010539  ..............................................................................
ENSMLUP00000011416  ..............................................................................
ENSMLUP00000001779  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000005045  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000015550  ..............................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  ..............................................................................
ENSMLUP00000002846  ..............................................................................
ENSMLUP00000015512  ..............................................................................
ENSMLUP00000008542  ..............................................................................
ENSMLUP00000014804  ..............................................................................
ENSMLUP00000010863  ..............................................................................
ENSMLUP00000000163  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000012859  ..............................................................................
ENSMLUP00000011587  ..............................................................................
ENSMLUP00000018248  ..............................................................................
ENSMLUP00000007856  ..............................................................................
ENSMLUP00000014214  ..............................................................................
ENSMLUP00000008400  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000004605  ..............................................................................
ENSMLUP00000006812  ..............................................................................
ENSMLUP00000014871  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  ..............................................................................
ENSMLUP00000012996  ..............................................................................
ENSMLUP00000013711  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000005342  ..............................................................................
ENSMLUP00000006369  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000015600  ..............................................................................
ENSMLUP00000010640  ..............................................................................
ENSMLUP00000000416  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000012982  ..............................................................................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000004637  ..............................................................................
ENSMLUP00000007008  ..............................................................................
ENSMLUP00000001540  ..............................................................................
ENSMLUP00000007555  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000000439  qslfpeplsiqsrsvqflrslwektqaegahsfetamlestfpqqkdldqvqlhleevrffdvfgfseaagawqcfmc
ENSMLUP00000021531  qqdldqvqlhleevrffdvfgfseaagawqcfmcnnpekaavvnq.................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000003131  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000012863  ..............................................................................
ENSMLUP00000005038  ..............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000001391  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000006989  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000016015  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000000456  ..............................................................................
ENSMLUP00000009152  ..............................................................................
ENSMLUP00000008233  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000010844  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ..............................................................................
ENSMLUP00000004431  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000017606  ..............................................................................
ENSMLUP00000005123  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000010185  ..............................................................................
ENSMLUP00000020533  ..............................................................................
ENSMLUP00000018072  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000003532  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000007054  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  ..............................................................................
ENSMLUP00000011628  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000004701  ..............................................................................
ENSMLUP00000000932  ..............................................................................
ENSMLUP00000005322  ..............................................................................
ENSMLUP00000002246  ..............................................................................
ENSMLUP00000012242  ..............................................................................
ENSMLUP00000015202  ..............................................................................
ENSMLUP00000010100  ..............................................................................
ENSMLUP00000010936  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  ..............................................................................
ENSMLUP00000005842  ..............................................................................
ENSMLUP00000005470  ..............................................................................
ENSMLUP00000004401  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000001364  ..............................................................................
ENSMLUP00000012921  ..............................................................................
ENSMLUP00000007470  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000010417  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001037  ..............................................................................
ENSMLUP00000005893  ..............................................................................
ENSMLUP00000013677  ..............................................................................
ENSMLUP00000004578  ..............................................................................
ENSMLUP00000006842  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000008066  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000007116  ..............................................................................
ENSMLUP00000003711  ..............................................................................
ENSMLUP00000011617  ..............................................................................
ENSMLUP00000010157  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000009645  ..............................................................................
ENSMLUP00000006092  ..............................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  ..............................................................................
ENSMLUP00000006542  ..............................................................................
ENSMLUP00000001230  ..............................................................................
ENSMLUP00000010734  ..............................................................................
ENSMLUP00000003167  ..............................................................................
ENSMLUP00000005624  ..............................................................................
ENSMLUP00000019375  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000009859  ..............................................................................
ENSMLUP00000001711  ..............................................................................
ENSMLUP00000017505  ..............................................................................
ENSMLUP00000007171  ..............................................................................
ENSMLUP00000003490  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000004020  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000016017  ..............................................................................
ENSMLUP00000012677  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000009973  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000007456  ..............................................................................
ENSMLUP00000006103  ..............................................................................
ENSMLUP00000012783  ..............................................................................
ENSMLUP00000014471  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000012437  ..............................................................................
ENSMLUP00000021530  ..............................................................................
ENSMLUP00000006501  ..............................................................................
ENSMLUP00000003171  ..............................................................................
ENSMLUP00000011174  ..............................................................................
ENSMLUP00000011009  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000014049  ..............................................................................
ENSMLUP00000013909  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000018295  ..............................................................................
ENSMLUP00000021849  ..............................................................................
ENSMLUP00000006303  ..............................................................................
ENSMLUP00000015098  ..............................................................................
ENSMLUP00000006492  ..............................................................................
ENSMLUP00000008454  alqr..........................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000009012  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000014285  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000011245  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000000103  ..............................................................................
ENSMLUP00000020572  ..............................................................................
ENSMLUP00000009684  ..............................................................................
ENSMLUP00000018770  ..............................................................................
ENSMLUP00000007942  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000007075  ..............................................................................
ENSMLUP00000012217  ..............................................................................
ENSMLUP00000014260  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000013488  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005075  ..............................................................................
ENSMLUP00000014442  ..............................................................................


                                                                                                    
                                                                                                    
d2elba2               ..............................................................................
ENSMLUP00000006551  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000002181  ..............................................................................
ENSMLUP00000007103  ..............................................................................
ENSMLUP00000015991  ..............................................................................
ENSMLUP00000011751  ..............................................................................
ENSMLUP00000006051  ..............................................................................
ENSMLUP00000006484  ..............................................................................
ENSMLUP00000022507  ..............................................................................
ENSMLUP00000014236  ..............................................................................
ENSMLUP00000006854  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000009991  ..............................................................................
ENSMLUP00000007057  ..............................................................................
ENSMLUP00000019012  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000009827  ..............................................................................
ENSMLUP00000007432  ..............................................................................
ENSMLUP00000014622  ..............................................................................
ENSMLUP00000004098  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000004165  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000011092  ..............................................................................
ENSMLUP00000001759  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000007415  ..............................................................................
ENSMLUP00000000876  ..............................................................................
ENSMLUP00000012407  ..............................................................................
ENSMLUP00000010866  ..............................................................................
ENSMLUP00000015289  ..............................................................................
ENSMLUP00000014093  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000016145  ..............................................................................
ENSMLUP00000000362  ..............................................................................
ENSMLUP00000004624  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000007170  ..............................................................................
ENSMLUP00000007524  ..............................................................................
ENSMLUP00000011865  ..............................................................................
ENSMLUP00000009407  ..............................................................................
ENSMLUP00000017210  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000007867  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000009897  ..............................................................................
ENSMLUP00000009921  ..............................................................................
ENSMLUP00000000027  ..............................................................................
ENSMLUP00000019003  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000010025  ..............................................................................
ENSMLUP00000003276  ..............................................................................
ENSMLUP00000012185  ..............................................................................
ENSMLUP00000009828  ..............................................................................
ENSMLUP00000000547  ..............................................................................
ENSMLUP00000006939  ..............................................................................
ENSMLUP00000013213  ..............................................................................
ENSMLUP00000010899  ..............................................................................
ENSMLUP00000014701  ..............................................................................
ENSMLUP00000001355  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000003010  ..............................................................................
ENSMLUP00000014344  ..............................................................................
ENSMLUP00000011779  ..............................................................................
ENSMLUP00000004968  ..............................................................................
ENSMLUP00000006705  ..............................................................................
ENSMLUP00000013438  ..............................................................................
ENSMLUP00000013178  ..............................................................................
ENSMLUP00000017586  ..............................................................................
ENSMLUP00000000009  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000001998  ..............................................................................
ENSMLUP00000012742  ..............................................................................
ENSMLUP00000000119  ..............................................................................
ENSMLUP00000003793  ..............................................................................
ENSMLUP00000003076  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000012676  ..............................................................................
ENSMLUP00000013417  ..............................................................................
ENSMLUP00000010021  ..............................................................................
ENSMLUP00000005492  ..............................................................................
ENSMLUP00000017245  ..............................................................................
ENSMLUP00000005975  ..............................................................................
ENSMLUP00000013604  ..............................................................................
ENSMLUP00000013658  ..............................................................................
ENSMLUP00000014884  ..............................................................................
ENSMLUP00000015073  ..............................................................................
ENSMLUP00000011388  ..............................................................................
ENSMLUP00000004364  ..............................................................................
ENSMLUP00000009774  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000013558  ..............................................................................
ENSMLUP00000013327  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000001083  ..............................................................................
ENSMLUP00000006407  ..............................................................................
ENSMLUP00000020850  ..............................................................................
ENSMLUP00000001631  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  ..............................................................................
ENSMLUP00000020676  ..............................................................................
ENSMLUP00000006371  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000002508  ..............................................................................
ENSMLUP00000001462  ..............................................................................
ENSMLUP00000015489  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000005155  ..............................................................................
ENSMLUP00000010240  ..............................................................................
ENSMLUP00000004993  ..............................................................................
ENSMLUP00000002012  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000003504  ..............................................................................
ENSMLUP00000001212  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000011537  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000011975  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000022464  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000002051  ..............................................................................
ENSMLUP00000009895  ..............................................................................
ENSMLUP00000003910  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000014255  ..............................................................................
ENSMLUP00000009304  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000018812  ..............................................................................
ENSMLUP00000002452  ..............................................................................
ENSMLUP00000009837  ..............................................................................
ENSMLUP00000015435  ..............................................................................
ENSMLUP00000009557  ..............................................................................
ENSMLUP00000015519  ..............................................................................
ENSMLUP00000004997  ..............................................................................
ENSMLUP00000009040  ..............................................................................
ENSMLUP00000009186  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000004311  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000003333  ..............................................................................
ENSMLUP00000020254  qinslklpqelpprgtrasdgsqeeaidqwarrrqqfkdgkssssaggssfasnitegsiisedscsvdfgfrvdiee
ENSMLUP00000007954  ..............................................................................
ENSMLUP00000014165  ..............................................................................
ENSMLUP00000015532  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009833  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000001022  ..............................................................................
ENSMLUP00000015339  ..............................................................................
ENSMLUP00000012336  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000014752  ..............................................................................
ENSMLUP00000011116  ..............................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000001331  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000007783  ..............................................................................
ENSMLUP00000013998  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000004775  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000015873  ..............................................................................
ENSMLUP00000019971  ..............................................................................
ENSMLUP00000009770  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000020205  ..............................................................................
ENSMLUP00000014596  ..............................................................................
ENSMLUP00000011059  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000010430  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000006337  ..............................................................................
ENSMLUP00000010159  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001945  ..............................................................................
ENSMLUP00000014265  ..............................................................................
ENSMLUP00000004630  ..............................................................................
ENSMLUP00000014463  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000010988  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000012079  ..............................................................................
ENSMLUP00000015465  ..............................................................................
ENSMLUP00000001381  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000002430  ..............................................................................
ENSMLUP00000001136  ..............................................................................
ENSMLUP00000007700  ..............................................................................
ENSMLUP00000002685  ..............................................................................
ENSMLUP00000003527  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005172  ..............................................................................
ENSMLUP00000005760  ..............................................................................
ENSMLUP00000003875  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000010635  ..............................................................................
ENSMLUP00000001299  ..............................................................................
ENSMLUP00000014110  ..............................................................................
ENSMLUP00000010539  ..............................................................................
ENSMLUP00000011416  ..............................................................................
ENSMLUP00000001779  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000005045  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000015550  ..............................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  ..............................................................................
ENSMLUP00000002846  ..............................................................................
ENSMLUP00000015512  ..............................................................................
ENSMLUP00000008542  ..............................................................................
ENSMLUP00000014804  ..............................................................................
ENSMLUP00000010863  ..............................................................................
ENSMLUP00000000163  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000012859  ..............................................................................
ENSMLUP00000011587  ..............................................................................
ENSMLUP00000018248  ..............................................................................
ENSMLUP00000007856  ..............................................................................
ENSMLUP00000014214  ..............................................................................
ENSMLUP00000008400  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000004605  ..............................................................................
ENSMLUP00000006812  ..............................................................................
ENSMLUP00000014871  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  ..............................................................................
ENSMLUP00000012996  ..............................................................................
ENSMLUP00000013711  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000005342  ..............................................................................
ENSMLUP00000006369  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000015600  ..............................................................................
ENSMLUP00000010640  ..............................................................................
ENSMLUP00000000416  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000012982  ..............................................................................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000004637  ..............................................................................
ENSMLUP00000007008  ..............................................................................
ENSMLUP00000001540  ..............................................................................
ENSMLUP00000007555  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000000439  nnpekaavvnq...................................................................
ENSMLUP00000021531  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000003131  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000012863  ..............................................................................
ENSMLUP00000005038  ..............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000001391  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000006989  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000016015  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000000456  ..............................................................................
ENSMLUP00000009152  ..............................................................................
ENSMLUP00000008233  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000010844  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ..............................................................................
ENSMLUP00000004431  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000017606  ..............................................................................
ENSMLUP00000005123  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000010185  ..............................................................................
ENSMLUP00000020533  ..............................................................................
ENSMLUP00000018072  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000003532  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000007054  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  ..............................................................................
ENSMLUP00000011628  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000004701  ..............................................................................
ENSMLUP00000000932  ..............................................................................
ENSMLUP00000005322  ..............................................................................
ENSMLUP00000002246  ..............................................................................
ENSMLUP00000012242  ..............................................................................
ENSMLUP00000015202  ..............................................................................
ENSMLUP00000010100  ..............................................................................
ENSMLUP00000010936  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  ..............................................................................
ENSMLUP00000005842  ..............................................................................
ENSMLUP00000005470  ..............................................................................
ENSMLUP00000004401  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000001364  ..............................................................................
ENSMLUP00000012921  ..............................................................................
ENSMLUP00000007470  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000010417  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001037  ..............................................................................
ENSMLUP00000005893  ..............................................................................
ENSMLUP00000013677  ..............................................................................
ENSMLUP00000004578  ..............................................................................
ENSMLUP00000006842  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000008066  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000007116  ..............................................................................
ENSMLUP00000003711  ..............................................................................
ENSMLUP00000011617  ..............................................................................
ENSMLUP00000010157  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000009645  ..............................................................................
ENSMLUP00000006092  ..............................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  ..............................................................................
ENSMLUP00000006542  ..............................................................................
ENSMLUP00000001230  ..............................................................................
ENSMLUP00000010734  ..............................................................................
ENSMLUP00000003167  ..............................................................................
ENSMLUP00000005624  ..............................................................................
ENSMLUP00000019375  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000009859  ..............................................................................
ENSMLUP00000001711  ..............................................................................
ENSMLUP00000017505  ..............................................................................
ENSMLUP00000007171  ..............................................................................
ENSMLUP00000003490  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000004020  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000016017  ..............................................................................
ENSMLUP00000012677  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000009973  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000007456  ..............................................................................
ENSMLUP00000006103  ..............................................................................
ENSMLUP00000012783  ..............................................................................
ENSMLUP00000014471  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000012437  ..............................................................................
ENSMLUP00000021530  ..............................................................................
ENSMLUP00000006501  ..............................................................................
ENSMLUP00000003171  ..............................................................................
ENSMLUP00000011174  ..............................................................................
ENSMLUP00000011009  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000014049  ..............................................................................
ENSMLUP00000013909  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000018295  ..............................................................................
ENSMLUP00000021849  ..............................................................................
ENSMLUP00000006303  ..............................................................................
ENSMLUP00000015098  ..............................................................................
ENSMLUP00000006492  ..............................................................................
ENSMLUP00000008454  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000009012  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000014285  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000011245  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000000103  ..............................................................................
ENSMLUP00000020572  ..............................................................................
ENSMLUP00000009684  ..............................................................................
ENSMLUP00000018770  ..............................................................................
ENSMLUP00000007942  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000007075  ..............................................................................
ENSMLUP00000012217  ..............................................................................
ENSMLUP00000014260  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000013488  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005075  ..............................................................................
ENSMLUP00000014442  ..............................................................................


                                                                                                    
                                                                                                    
d2elba2               ..............................................................................
ENSMLUP00000006551  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000002181  ..............................................................................
ENSMLUP00000007103  ..............................................................................
ENSMLUP00000015991  ..............................................................................
ENSMLUP00000011751  ..............................................................................
ENSMLUP00000006051  ..............................................................................
ENSMLUP00000006484  ..............................................................................
ENSMLUP00000022507  ..............................................................................
ENSMLUP00000014236  ..............................................................................
ENSMLUP00000006854  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000009991  ..............................................................................
ENSMLUP00000007057  ..............................................................................
ENSMLUP00000019012  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000009827  ..............................................................................
ENSMLUP00000007432  ..............................................................................
ENSMLUP00000014622  ..............................................................................
ENSMLUP00000004098  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000004165  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000011092  ..............................................................................
ENSMLUP00000001759  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000007415  ..............................................................................
ENSMLUP00000000876  ..............................................................................
ENSMLUP00000012407  ..............................................................................
ENSMLUP00000010866  ..............................................................................
ENSMLUP00000015289  ..............................................................................
ENSMLUP00000014093  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000016145  ..............................................................................
ENSMLUP00000000362  ..............................................................................
ENSMLUP00000004624  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000007170  ..............................................................................
ENSMLUP00000007524  ..............................................................................
ENSMLUP00000011865  ..............................................................................
ENSMLUP00000009407  ..............................................................................
ENSMLUP00000017210  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000007867  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000009897  ..............................................................................
ENSMLUP00000009921  ..............................................................................
ENSMLUP00000000027  ..............................................................................
ENSMLUP00000019003  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000010025  ..............................................................................
ENSMLUP00000003276  ..............................................................................
ENSMLUP00000012185  ..............................................................................
ENSMLUP00000009828  ..............................................................................
ENSMLUP00000000547  ..............................................................................
ENSMLUP00000006939  ..............................................................................
ENSMLUP00000013213  ..............................................................................
ENSMLUP00000010899  ..............................................................................
ENSMLUP00000014701  ..............................................................................
ENSMLUP00000001355  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000003010  ..............................................................................
ENSMLUP00000014344  ..............................................................................
ENSMLUP00000011779  ..............................................................................
ENSMLUP00000004968  ..............................................................................
ENSMLUP00000006705  ..............................................................................
ENSMLUP00000013438  ..............................................................................
ENSMLUP00000013178  ..............................................................................
ENSMLUP00000017586  ..............................................................................
ENSMLUP00000000009  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000001998  ..............................................................................
ENSMLUP00000012742  ..............................................................................
ENSMLUP00000000119  ..............................................................................
ENSMLUP00000003793  ..............................................................................
ENSMLUP00000003076  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000012676  ..............................................................................
ENSMLUP00000013417  ..............................................................................
ENSMLUP00000010021  ..............................................................................
ENSMLUP00000005492  ..............................................................................
ENSMLUP00000017245  ..............................................................................
ENSMLUP00000005975  ..............................................................................
ENSMLUP00000013604  ..............................................................................
ENSMLUP00000013658  ..............................................................................
ENSMLUP00000014884  ..............................................................................
ENSMLUP00000015073  ..............................................................................
ENSMLUP00000011388  ..............................................................................
ENSMLUP00000004364  ..............................................................................
ENSMLUP00000009774  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000013558  ..............................................................................
ENSMLUP00000013327  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000001083  ..............................................................................
ENSMLUP00000006407  ..............................................................................
ENSMLUP00000020850  ..............................................................................
ENSMLUP00000001631  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  ..............................................................................
ENSMLUP00000020676  ..............................................................................
ENSMLUP00000006371  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000002508  ..............................................................................
ENSMLUP00000001462  ..............................................................................
ENSMLUP00000015489  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000005155  ..............................................................................
ENSMLUP00000010240  ..............................................................................
ENSMLUP00000004993  ..............................................................................
ENSMLUP00000002012  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000003504  ..............................................................................
ENSMLUP00000001212  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000011537  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000011975  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000022464  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000002051  ..............................................................................
ENSMLUP00000009895  ..............................................................................
ENSMLUP00000003910  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000014255  ..............................................................................
ENSMLUP00000009304  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000018812  ..............................................................................
ENSMLUP00000002452  ..............................................................................
ENSMLUP00000009837  ..............................................................................
ENSMLUP00000015435  ..............................................................................
ENSMLUP00000009557  ..............................................................................
ENSMLUP00000015519  ..............................................................................
ENSMLUP00000004997  ..............................................................................
ENSMLUP00000009040  ..............................................................................
ENSMLUP00000009186  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000004311  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000003333  ..............................................................................
ENSMLUP00000020254  kgfyteifhsaawifrgddgnpgdsprclskkprpaavrertlrlfkgtddcpwgfqiqfskpivvtevdansaaeea
ENSMLUP00000007954  ..............................................................................
ENSMLUP00000014165  ..............................................................................
ENSMLUP00000015532  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009833  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000001022  ..............................................................................
ENSMLUP00000015339  ..............................................................................
ENSMLUP00000012336  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000014752  ..............................................................................
ENSMLUP00000011116  ..............................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000001331  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000007783  ..............................................................................
ENSMLUP00000013998  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000004775  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000015873  ..............................................................................
ENSMLUP00000019971  ..............................................................................
ENSMLUP00000009770  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000020205  ..............................................................................
ENSMLUP00000014596  ..............................................................................
ENSMLUP00000011059  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000010430  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000006337  ..............................................................................
ENSMLUP00000010159  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001945  ..............................................................................
ENSMLUP00000014265  ..............................................................................
ENSMLUP00000004630  ..............................................................................
ENSMLUP00000014463  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000010988  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000012079  ..............................................................................
ENSMLUP00000015465  ..............................................................................
ENSMLUP00000001381  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000002430  ..............................................................................
ENSMLUP00000001136  ..............................................................................
ENSMLUP00000007700  ..............................................................................
ENSMLUP00000002685  ..............................................................................
ENSMLUP00000003527  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005172  ..............................................................................
ENSMLUP00000005760  ..............................................................................
ENSMLUP00000003875  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000010635  ..............................................................................
ENSMLUP00000001299  ..............................................................................
ENSMLUP00000014110  ..............................................................................
ENSMLUP00000010539  ..............................................................................
ENSMLUP00000011416  ..............................................................................
ENSMLUP00000001779  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000005045  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000015550  ..............................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  ..............................................................................
ENSMLUP00000002846  ..............................................................................
ENSMLUP00000015512  ..............................................................................
ENSMLUP00000008542  ..............................................................................
ENSMLUP00000014804  ..............................................................................
ENSMLUP00000010863  ..............................................................................
ENSMLUP00000000163  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000012859  ..............................................................................
ENSMLUP00000011587  ..............................................................................
ENSMLUP00000018248  ..............................................................................
ENSMLUP00000007856  ..............................................................................
ENSMLUP00000014214  ..............................................................................
ENSMLUP00000008400  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000004605  ..............................................................................
ENSMLUP00000006812  ..............................................................................
ENSMLUP00000014871  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  ..............................................................................
ENSMLUP00000012996  ..............................................................................
ENSMLUP00000013711  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000005342  ..............................................................................
ENSMLUP00000006369  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000015600  ..............................................................................
ENSMLUP00000010640  ..............................................................................
ENSMLUP00000000416  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000012982  ..............................................................................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000004637  ..............................................................................
ENSMLUP00000007008  ..............................................................................
ENSMLUP00000001540  ..............................................................................
ENSMLUP00000007555  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000000439  ..............................................................................
ENSMLUP00000021531  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000003131  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000012863  ..............................................................................
ENSMLUP00000005038  ..............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000001391  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000006989  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000016015  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000000456  ..............................................................................
ENSMLUP00000009152  ..............................................................................
ENSMLUP00000008233  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000010844  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ..............................................................................
ENSMLUP00000004431  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000017606  ..............................................................................
ENSMLUP00000005123  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000010185  ..............................................................................
ENSMLUP00000020533  ..............................................................................
ENSMLUP00000018072  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000003532  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000007054  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  ..............................................................................
ENSMLUP00000011628  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000004701  ..............................................................................
ENSMLUP00000000932  ..............................................................................
ENSMLUP00000005322  ..............................................................................
ENSMLUP00000002246  ..............................................................................
ENSMLUP00000012242  ..............................................................................
ENSMLUP00000015202  ..............................................................................
ENSMLUP00000010100  ..............................................................................
ENSMLUP00000010936  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  ..............................................................................
ENSMLUP00000005842  ..............................................................................
ENSMLUP00000005470  ..............................................................................
ENSMLUP00000004401  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000001364  ..............................................................................
ENSMLUP00000012921  ..............................................................................
ENSMLUP00000007470  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000010417  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001037  ..............................................................................
ENSMLUP00000005893  ..............................................................................
ENSMLUP00000013677  ..............................................................................
ENSMLUP00000004578  ..............................................................................
ENSMLUP00000006842  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000008066  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000007116  ..............................................................................
ENSMLUP00000003711  ..............................................................................
ENSMLUP00000011617  ..............................................................................
ENSMLUP00000010157  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000009645  ..............................................................................
ENSMLUP00000006092  ..............................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  ..............................................................................
ENSMLUP00000006542  ..............................................................................
ENSMLUP00000001230  ..............................................................................
ENSMLUP00000010734  ..............................................................................
ENSMLUP00000003167  ..............................................................................
ENSMLUP00000005624  ..............................................................................
ENSMLUP00000019375  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000009859  ..............................................................................
ENSMLUP00000001711  ..............................................................................
ENSMLUP00000017505  ..............................................................................
ENSMLUP00000007171  ..............................................................................
ENSMLUP00000003490  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000004020  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000016017  ..............................................................................
ENSMLUP00000012677  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000009973  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000007456  ..............................................................................
ENSMLUP00000006103  ..............................................................................
ENSMLUP00000012783  ..............................................................................
ENSMLUP00000014471  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000012437  ..............................................................................
ENSMLUP00000021530  ..............................................................................
ENSMLUP00000006501  ..............................................................................
ENSMLUP00000003171  ..............................................................................
ENSMLUP00000011174  ..............................................................................
ENSMLUP00000011009  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000014049  ..............................................................................
ENSMLUP00000013909  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000018295  ..............................................................................
ENSMLUP00000021849  ..............................................................................
ENSMLUP00000006303  ..............................................................................
ENSMLUP00000015098  ..............................................................................
ENSMLUP00000006492  ..............................................................................
ENSMLUP00000008454  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000009012  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000014285  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000011245  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000000103  ..............................................................................
ENSMLUP00000020572  ..............................................................................
ENSMLUP00000009684  ..............................................................................
ENSMLUP00000018770  ..............................................................................
ENSMLUP00000007942  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000007075  ..............................................................................
ENSMLUP00000012217  ..............................................................................
ENSMLUP00000014260  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000013488  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005075  ..............................................................................
ENSMLUP00000014442  ..............................................................................


                                                                               10                   
                                                                                |                   
d2elba2               .................................................----TRKAGYLNAR.......N.....KT
ENSMLUP00000006551  .................................................--------------.......-.....--
ENSMLUP00000010306  .................................................--------------.......-.....--
ENSMLUP00000002181  .................................................--------------.......-.....--
ENSMLUP00000007103  .................................................--------------.......-.....--
ENSMLUP00000015991  .................................................--------------.......-.....--
ENSMLUP00000011751  .................................................--------------.......-.....--
ENSMLUP00000006051  .................................................--------------.......-.....--
ENSMLUP00000006484  .................................................--------------.......-.....--
ENSMLUP00000022507  .................................................--------------.......-.....--
ENSMLUP00000014236  .................................................--------------.......-.....--
ENSMLUP00000006854  .................................................--------------.......-.....--
ENSMLUP00000003954  .................................................-----------LKR.......S.....QQ
ENSMLUP00000009991  .................................................--------------.......-.....--
ENSMLUP00000007057  .................................................--------------.......-.....--
ENSMLUP00000019012  .................................................--------------.......-.....--
ENSMLUP00000005088  .................................................--------------.......-.....--
ENSMLUP00000009827  .................................................--------------.......-.....--
ENSMLUP00000007432  .................................................-----LKEGFMIKR.......A.....QG
ENSMLUP00000014622  .................................................--------------.......-.....--
ENSMLUP00000004098  .................................................--------------.......-.....--
ENSMLUP00000014409  .................................................--------------.......-.....-R
ENSMLUP00000004165  .................................................----ILKMGPVDKR.......K.....GL
ENSMLUP00000005117  .................................................--SELIHSGELTRI.......T.....KQ
ENSMLUP00000011092  .................................................--------------.......-.....--
ENSMLUP00000001759  .................................................--------------.......-.....--
ENSMLUP00000005088  .................................................--------------.......-.....--
ENSMLUP00000005088  .................................................--------------.......-.....--
ENSMLUP00000014421  .................................................--------------.......-.....--
ENSMLUP00000007415  .................................................--------------.......-.....--
ENSMLUP00000000876  .................................................--------------.......-.....--
ENSMLUP00000012407  .................................................--------------.......-.....--
ENSMLUP00000010866  .................................................--------------.......-.....--
ENSMLUP00000015289  .................................................--------------.......-.....--
ENSMLUP00000014093  .................................................--------------.......-.....--
ENSMLUP00000005088  .................................................--------------.......-.....--
ENSMLUP00000016145  .................................................----------LLKR.......S.....QQ
ENSMLUP00000000362  .................................................--------------.......-.....--
ENSMLUP00000004624  .................................................--------------.......-.....--
ENSMLUP00000004420  .................................................--------------.......-.....--
ENSMLUP00000007170  .................................................------KEGEMYKR.......A.....QG
ENSMLUP00000007524  .................................................--------------.......-.....--
ENSMLUP00000011865  .................................................--------------.......-.....--
ENSMLUP00000009407  .................................................--------------.......-.....--
ENSMLUP00000017210  .................................................--------------.......-.....--
ENSMLUP00000001866  .................................................------YTGEMAWI.......-.....--
ENSMLUP00000007867  .................................................--QDVLKQGYLWKR.......-.....--
ENSMLUP00000011713  .................................................--------------.......-.....--
ENSMLUP00000009897  .................................................--------------.......-.....--
ENSMLUP00000009921  .................................................--------------.......-.....--
ENSMLUP00000000027  .................................................--------------.......-.....--
ENSMLUP00000019003  .................................................--------------.......-.....--
ENSMLUP00000006515  .................................................-------MGVLVFQ.......S.....TT
ENSMLUP00000010025  .................................................--------------.......-.....--
ENSMLUP00000003276  .................................................--------------.......-.....--
ENSMLUP00000012185  .................................................--------------.......-.....--
ENSMLUP00000009828  .................................................--------------.......-.....--
ENSMLUP00000000547  .................................................---DVLKQGYMMKK.......-.....--
ENSMLUP00000006939  .................................................--------------.......-.....--
ENSMLUP00000013213  .................................................--------------.......-.....--
ENSMLUP00000010899  .................................................--------------.......-.....--
ENSMLUP00000014701  .................................................--------------.......-.....--
ENSMLUP00000001355  .................................................-------MGILVLR.......G.....NT
ENSMLUP00000004002  .................................................--------------.......-.....--
ENSMLUP00000003010  .................................................----MIHEGPLVWK.......V.....--
ENSMLUP00000014344  .................................................--NEFIMEGTLTRV.......-.....--
ENSMLUP00000011779  .................................................----LVHEGPLTWR.......-.....--
ENSMLUP00000004968  .................................................--------------.......-.....--
ENSMLUP00000006705  .................................................--------------.......-.....--
ENSMLUP00000013438  .................................................--------------.......-.....--
ENSMLUP00000013178  .................................................--------------.......-.....--
ENSMLUP00000017586  .................................................--------------.......-.....--
ENSMLUP00000000009  .................................................--------------.......-.....--
ENSMLUP00000009616  .................................................--------------.......-.....--
ENSMLUP00000001998  .................................................--------------.......-.....--
ENSMLUP00000012742  .................................................--------------.......-.....--
ENSMLUP00000000119  .................................................--------------.......-.....--
ENSMLUP00000003793  .................................................-----DCEGWLWKK.......K.....DA
ENSMLUP00000003076  .................................................---EFIMEGPLTRI.......-.....--
ENSMLUP00000013179  .................................................----VFKAGYLEKR.......R.....KD
ENSMLUP00000012676  .................................................--------------.......-.....--
ENSMLUP00000013417  .................................................--------------.......-.....--
ENSMLUP00000010021  .................................................--------------.......-.....--
ENSMLUP00000005492  .................................................--RQLHLEGTLAWK.......T.....TA
ENSMLUP00000017245  .................................................--------------.......-.....--
ENSMLUP00000005975  .................................................--------------.......-.....--
ENSMLUP00000013604  .................................................--------------.......-.....--
ENSMLUP00000013658  .................................................--RQLHLEGTLAWK.......T.....TA
ENSMLUP00000014884  .................................................--------------.......-.....--
ENSMLUP00000015073  .................................................--------------.......-.....--
ENSMLUP00000011388  .................................................--------------.......-.....--
ENSMLUP00000004364  .................................................--------------.......-.....--
ENSMLUP00000009774  .................................................--------------.......-.....--
ENSMLUP00000008949  .................................................--------------.......-.....--
ENSMLUP00000013558  .................................................--------------.......-.....--
ENSMLUP00000013327  .................................................--------------.......-.....--
ENSMLUP00000013892  .................................................--------------.......-.....--
ENSMLUP00000011043  .................................................--------------.......-.....--
ENSMLUP00000004420  .................................................--------------.......-.....--
ENSMLUP00000001083  .................................................-------QGQLVRQ.......D.....EF
ENSMLUP00000006407  .................................................--------------.......-.....--
ENSMLUP00000020850  .................................................--------------.......-.....--
ENSMLUP00000001631  .................................................-----VREGYLLKR.......K.....EE
ENSMLUP00000007486  .................................................--------------.......-.....--
ENSMLUP00000008206  .................................................-----VKEGWMVHY.......-.....--
ENSMLUP00000013539  .................................................-----DREGWLLKL.......G.....GG
ENSMLUP00000015365  .................................................---QLLLQGTLLKI.......-.....--
ENSMLUP00000020676  .................................................---QLLLQGTLLKI.......-.....--
ENSMLUP00000006371  .................................................--------------.......-.....--
ENSMLUP00000007133  .................................................--------------.......-.....--
ENSMLUP00000002508  .................................................---EMLMCGVLLKI.......-.....--
ENSMLUP00000001462  .................................................---PVVVRGWLHKQ.......D.....SS
ENSMLUP00000015489  .................................................--------------.......-.....--
ENSMLUP00000019635  .................................................--------------.......-.....--
ENSMLUP00000005155  .................................................--------------.......-.....--
ENSMLUP00000010240  .................................................--------------.......-.....--
ENSMLUP00000004993  .................................................-DSAVIKAGYCVKQ.......-.....--
ENSMLUP00000002012  .................................................--------------.......-.....--
ENSMLUP00000009146  .................................................--EGSAISGYLSRC.......-.....--
ENSMLUP00000002140  .................................................--------------.......-.....--
ENSMLUP00000014437  .................................................--------------.......-.....--
ENSMLUP00000003504  .................................................----PDREGWLLKL.......G.....E-
ENSMLUP00000001212  .................................................-----QMEGMLCRK.......Q.....EM
ENSMLUP00000000142  .................................................----PKIDGELKIT.......-.....--
ENSMLUP00000011713  .................................................------LSGNLLRK.......-.....--
ENSMLUP00000011537  .................................................----PDREGWLLKL.......-.....--
ENSMLUP00000008290  .................................................--------------.......-.....--
ENSMLUP00000011975  .................................................----PIRQGHFIVW.......E.....GA
ENSMLUP00000012342  .................................................-SNELIKEGQILKL.......-.....--
ENSMLUP00000022464  .................................................---QLHLEGTLAWK.......T.....TA
ENSMLUP00000006515  .................................................-----QLSGYLLRK.......-.....--
ENSMLUP00000002051  .................................................--------------.......-.....--
ENSMLUP00000009895  .................................................----ADCQGWLYKK.......K.....EK
ENSMLUP00000003910  .................................................-GHSVQMEGYLGRK.......H.....DL
ENSMLUP00000010202  .................................................--HPFIKSGYCVKQ.......-.....--
ENSMLUP00000000726  .................................................--------------.......-.....--
ENSMLUP00000014255  .................................................--------------.......-.....--
ENSMLUP00000009304  .................................................---QPDCDGWLLLR.......K.....VP
ENSMLUP00000000726  .................................................---NIESQGELILQ.......EsfqvwDP
ENSMLUP00000018812  .................................................--------------.......-.....TA
ENSMLUP00000002452  .................................................--------------.......-.....TA
ENSMLUP00000009837  .................................................-----MKEGWMVHY.......-.....--
ENSMLUP00000015435  .................................................--------------.......-.....--
ENSMLUP00000009557  .................................................-----VKEGPLFIH.......R.....TK
ENSMLUP00000015519  .................................................-----YFEGFLLVK.......-.....--
ENSMLUP00000004997  .................................................--------------.......-.....--
ENSMLUP00000009040  .................................................--------------.......-.....--
ENSMLUP00000009186  .................................................--RKLIHDGCLLWK.......T.....--
ENSMLUP00000006019  .................................................--------------.......-.....--
ENSMLUP00000004311  .................................................--------------.......-.....--
ENSMLUP00000006153  .................................................-------CAFLLRK.......-.....--
ENSMLUP00000001771  .................................................-SNALLREGPVLKI.......-.....--
ENSMLUP00000003867  .................................................--------------.......-.....--
ENSMLUP00000003333  .................................................---RPIKMGWLKKQ.......-.....--
ENSMLUP00000020254  glqigdvvlavngtevtsaehaeavhlarkgpdiltlvvgsdisrcpnt--PRPTCRGYLHKR.......T.....H-
ENSMLUP00000007954  .................................................----------VFLK.......N.....--
ENSMLUP00000014165  .................................................--------------.......-.....--
ENSMLUP00000015532  .................................................--------------.......-.....--
ENSMLUP00000006515  .................................................-GREFIREGCLHKL.......-.....--
ENSMLUP00000015042  .................................................----IIKQGCLLKQ.......-.....--
ENSMLUP00000000573  .................................................-DENRSFEGTLYKR.......-.....--
ENSMLUP00000002140  .................................................--------------.......-.....--
ENSMLUP00000009833  .................................................--------------.......-.....--
ENSMLUP00000014256  .................................................-NEPLEKSGYLLKM.......-.....--
ENSMLUP00000014449  .................................................--------------.......-.....--
ENSMLUP00000002296  .................................................---KLLHSGKLHKT.......K.....SN
ENSMLUP00000001022  .................................................--------------.......-.....--
ENSMLUP00000015339  .................................................--NTSIKEGQLLKQ.......-.....--
ENSMLUP00000012336  .................................................--------------.......-.....--
ENSMLUP00000022476  .................................................--------------.......-.....--
ENSMLUP00000014752  .................................................--------------.......-.....--
ENSMLUP00000011116  .................................................------GEGVLTKL.......-.....--
ENSMLUP00000006182  .................................................-----TKEGYLTKQ.......-.....--
ENSMLUP00000002497  .................................................--------------.......-.....--
ENSMLUP00000001331  .................................................-------------Q.......D.....SS
ENSMLUP00000009696  .................................................-TKELIKEGHILKL.......-.....--
ENSMLUP00000007783  .................................................----AQMEGFLNRK.......H.....EW
ENSMLUP00000013998  .................................................------KSGFLARKihadmdgK.....KT
ENSMLUP00000002874  .................................................--------------.......-.....--
ENSMLUP00000004775  .................................................--------------.......-.....--
ENSMLUP00000002874  .................................................--------------.......-.....--
ENSMLUP00000015873  .................................................---TVIKEGMLTKQ.......-.....--
ENSMLUP00000019971  .................................................--------------.......-.....--
ENSMLUP00000009770  .................................................--------------.......-.....--
ENSMLUP00000008335  .................................................---EALKQGWLHKK.......G.....GG
ENSMLUP00000020205  .................................................---PVDNAGFLYKK.......-.....--
ENSMLUP00000014596  .................................................---NRSYEGTLYKK.......-.....--
ENSMLUP00000011059  .................................................--------------.......-.....--
ENSMLUP00000019635  .................................................----VRKVGYLRKP.......-.....--
ENSMLUP00000004596  .................................................--------------.......-.....--
ENSMLUP00000004060  .................................................--ESLEKSGYLLKM.......-.....--
ENSMLUP00000010430  .................................................------------VQ.......Q.....QL
ENSMLUP00000000775  .................................................--------------.......-.....--
ENSMLUP00000006337  .................................................--------------.......-.....--
ENSMLUP00000010159  .................................................--SGSAREGWLFKW.......-.....--
ENSMLUP00000004167  .................................................----KVKSGWLDKL.......S.....PQ
ENSMLUP00000001945  .................................................--------------.......-.....--
ENSMLUP00000014265  .................................................--------------.......-.....--
ENSMLUP00000004630  .................................................-GKDCIMHGYMSKM.......G.....NP
ENSMLUP00000014463  .................................................--------------.......-.....--
ENSMLUP00000011713  .................................................-GREFIRLGSLSKL.......-.....--
ENSMLUP00000010988  .................................................--------------.......-.....--
ENSMLUP00000022232  .................................................--------------.......-.....--
ENSMLUP00000012079  .................................................--GGLVMEGHLFKR.......A.....SN
ENSMLUP00000015465  .................................................-----IRKGWLTIS.......N.....I-
ENSMLUP00000001381  .................................................--------GTMMRK.......-.....--
ENSMLUP00000014433  .................................................-TEDSSMSGYLYRS.......-.....--
ENSMLUP00000002430  .................................................--------------.......-.....--
ENSMLUP00000001136  .................................................--------------.......-.....--
ENSMLUP00000007700  .................................................-----IRKGWLTIN.......N.....I-
ENSMLUP00000002685  .................................................--------------.......-.....--
ENSMLUP00000003527  .................................................--------------.......-.....--
ENSMLUP00000000189  .................................................----VSHSGFLYKT.......A.....SA
ENSMLUP00000005172  .................................................--------------.......-.....--
ENSMLUP00000005760  .................................................--------------.......-.....KT
ENSMLUP00000003875  .................................................--PPVERCGVLSKW.......-.....--
ENSMLUP00000014433  .................................................----FLKEGTLMKL.......-.....--
ENSMLUP00000010635  .................................................--NGIVMEGYLFKR.......A.....SN
ENSMLUP00000001299  .................................................--RHLLYEGKLTLA.......-.....--
ENSMLUP00000014110  .................................................--------------.......-.....--
ENSMLUP00000010539  .................................................--------------.......-.....--
ENSMLUP00000011416  .................................................--NELIKEGHIQKL.......-.....--
ENSMLUP00000001779  .................................................--------------.......-.....--
ENSMLUP00000015042  .................................................-----IREGYLVKK.......-.....--
ENSMLUP00000005045  .................................................--------------.......-.....--
ENSMLUP00000004048  .................................................--GTVIKQGYLAKQ.......-.....--
ENSMLUP00000015550  .................................................--GGVIKQGWLYKA.......N.....VN
ENSMLUP00000005543  .................................................-----SKKGYLHFL.......-.....--
ENSMLUP00000002060  .................................................---SVIKEGWLHKR.......-.....--
ENSMLUP00000002846  .................................................-----TCRGFLIKM.......-.....--
ENSMLUP00000015512  .................................................--------------.......-.....--
ENSMLUP00000008542  .................................................--------------.......-.....--
ENSMLUP00000014804  .................................................-----IRKGWLTIN.......N.....I-
ENSMLUP00000010863  .................................................--------------.......-.....KT
ENSMLUP00000000163  .................................................----VSKKGYLHFK.......-.....--
ENSMLUP00000010492  .................................................---NIVKKGYLLKK.......G.....KG
ENSMLUP00000012859  .................................................--GGITKHGWLYKG.......N.....MN
ENSMLUP00000011587  .................................................--------------.......-.....--
ENSMLUP00000018248  .................................................-GKDCIMHGYMLKL.......G.....NP
ENSMLUP00000007856  .................................................-GKDCIMHGYMLKL.......G.....NP
ENSMLUP00000014214  .................................................--------------.......-.....--
ENSMLUP00000008400  .................................................----SIMEGPLSKW.......-.....--
ENSMLUP00000004048  .................................................--------------.......-.....--
ENSMLUP00000004605  .................................................-----VMADWLKIR.......-.....--
ENSMLUP00000006812  .................................................--------------.......-.....--
ENSMLUP00000014871  .................................................--------------.......-.....--
ENSMLUP00000010926  .................................................------KKGWLTKQ.......Y.....ED
ENSMLUP00000012190  .................................................--------------.......-.....--
ENSMLUP00000012996  .................................................--------------.......-.....--
ENSMLUP00000013711  .................................................-----YHESFLEKK.......G.....PR
ENSMLUP00000006780  .................................................-----QKAGYLNLR.......S.....KT
ENSMLUP00000005342  .................................................--------------.......-.....--
ENSMLUP00000006369  .................................................-------KGWLLKW.......-.....--
ENSMLUP00000010845  .................................................--QDVLKSGTLYRL.......-.....--
ENSMLUP00000015600  .................................................--TGVFKSGWLYKG.......N.....FN
ENSMLUP00000010640  .................................................--------------.......-.....--
ENSMLUP00000000416  .................................................--------------.......-.....--
ENSMLUP00000012342  .................................................-SGNSVVCSFLQYM.......E.....KS
ENSMLUP00000007987  .................................................----PLLSGWLDKL.......S.....PQ
ENSMLUP00000012982  .................................................--------------.......-.....--
ENSMLUP00000014543  .................................................--------------.......-.....--
ENSMLUP00000000775  .................................................-----RKAGYLNAR.......N.....KT
ENSMLUP00000004637  .................................................----MKHSGYLYAL.......G.....QK
ENSMLUP00000007008  .................................................--QNMKHSGYLWAI.......G.....KN
ENSMLUP00000001540  .................................................--QKILKEGPLLKS.......-.....--
ENSMLUP00000007555  .................................................-NSSVEEKGFLTIF.......E.....DV
ENSMLUP00000010202  .................................................-DRQNRICGFLDIE.......E.....NE
ENSMLUP00000009696  .................................................------ICSFLHYM.......-.....--
ENSMLUP00000000439  .................................................-DGQPLIEGKLKEK.......Q.....VR
ENSMLUP00000021531  .................................................-DGQPLIEGKLKEK.......Q.....VR
ENSMLUP00000008335  .................................................---EFIVRGWLHKE.......V.....KN
ENSMLUP00000003131  .................................................--------------.......-.....--
ENSMLUP00000002636  .................................................---DCRICAFLLRK.......-.....--
ENSMLUP00000012863  .................................................-----EKEGYLQKAkia....D.....GG
ENSMLUP00000005038  .................................................-------CGYLMKY.......-.....--
ENSMLUP00000007090  .................................................--------------.......-.....--
ENSMLUP00000020254  .................................................---NPECLGLLHQL.......-.....--
ENSMLUP00000006780  .................................................--------------.......-.....--
ENSMLUP00000001391  .................................................--------------.......-.....--
ENSMLUP00000002099  .................................................--------------.......-.....--
ENSMLUP00000004060  .................................................--TKPTVKGWLTKV.......-.....--
ENSMLUP00000004167  .................................................--------------.......-.....--
ENSMLUP00000006989  .................................................----TEKVGFLYKK.......N.....PR
ENSMLUP00000015169  .................................................--------------.......-.....--
ENSMLUP00000000788  .................................................-TRNYLKQGFMEKT.......G.....PK
ENSMLUP00000010633  .................................................--------------.......-.....--
ENSMLUP00000012424  .................................................--------------.......-.....--
ENSMLUP00000021545  .................................................--------------.......-.....--
ENSMLUP00000009146  .................................................-GREFLKEGTLMKV.......-.....--
ENSMLUP00000016015  .................................................------VEGTCFRK.......L.....NS
ENSMLUP00000010504  .................................................--------------.......-.....--
ENSMLUP00000010306  .................................................-----RKAGWLFFK.......-.....--
ENSMLUP00000000456  .................................................-EGAITKEGMLHYK.......A.....GT
ENSMLUP00000009152  .................................................--------------.......-.....--
ENSMLUP00000008233  .................................................--------------.......-.....--
ENSMLUP00000001771  .................................................------MSSFLQLV.......G.....DK
ENSMLUP00000002636  .................................................--EAVPCCGYLNVM.......-.....--
ENSMLUP00000008265  .................................................---GSEKKGYLLKK.......S.....DG
ENSMLUP00000015858  .................................................----LLKQGELQQM.......S.....GP
ENSMLUP00000007197  .................................................--------------.......-.....--
ENSMLUP00000010409  .................................................--------------.......E.....NG
ENSMLUP00000006153  .................................................-------CGHLNVL.......-.....--
ENSMLUP00000019004  .................................................--------------.......-.....--
ENSMLUP00000014933  .................................................------KAGWIKKS.......S.....GG
ENSMLUP00000014256  .................................................-EGKPTVKGLLTKV.......-.....--
ENSMLUP00000010844  .................................................--TKVQLYGVLWKR.......P.....F-
ENSMLUP00000006830  .................................................---------YLNVL.......-.....--
ENSMLUP00000008037  .................................................--------------.......-.....--
ENSMLUP00000004431  .................................................------LCGYLSKF.......G.....G-
ENSMLUP00000003867  .................................................--------------.......-.....--
ENSMLUP00000017606  .................................................--------------.......-.....--
ENSMLUP00000005123  .................................................--------------.......-.....-K
ENSMLUP00000002234  .................................................--------------.......-.....--
ENSMLUP00000020202  .................................................--------------.......-.....--
ENSMLUP00000010185  .................................................--EPPVQKGFLLKK.......R.....KW
ENSMLUP00000020533  .................................................--------------.......-.....--
ENSMLUP00000018072  .................................................-NSPADHRGFLRTW.......G.....GP
ENSMLUP00000000937  .................................................-----EKSGQLNVT.......Kiaq..GG
ENSMLUP00000007197  .................................................--------------.......-.....--
ENSMLUP00000011043  .................................................--------------.......-.....--
ENSMLUP00000013586  .................................................--------------.......-.....--
ENSMLUP00000019004  .................................................----SIKEGALKIK.......E.....EP
ENSMLUP00000003532  .................................................--------------.......-.....--
ENSMLUP00000010845  .................................................---NILKKGYLEIR.......-.....--
ENSMLUP00000007054  .................................................--------------.......-.....--
ENSMLUP00000007486  .................................................---DIVKQGYVKIR.......-.....--
ENSMLUP00000003307  .................................................--------------.......-.....--
ENSMLUP00000011628  .................................................--------------.......-.....--
ENSMLUP00000007987  .................................................------RVGLLRCR.......E.....EP
ENSMLUP00000002234  .................................................--------------.......-.....--
ENSMLUP00000020202  .................................................--------------.......-.....--
ENSMLUP00000000573  .................................................--------------.......-.....--
ENSMLUP00000004701  .................................................----PIKQGMLLKR.......S.....G-
ENSMLUP00000000932  .................................................--------------.......-.....--
ENSMLUP00000005322  .................................................--------------.......-.....--
ENSMLUP00000002246  .................................................--------------.......-.....--
ENSMLUP00000012242  .................................................--------------.......-.....--
ENSMLUP00000015202  .................................................-----TMEGPLRRKtllk...E.....GR
ENSMLUP00000010100  .................................................-------GGWLWRQ.......-.....--
ENSMLUP00000010936  .................................................-----ELEGALYLK.......-.....--
ENSMLUP00000014437  .................................................---DIVKQGYVKMK.......-.....--
ENSMLUP00000005292  .................................................------HEGFMLKK.......R.....KW
ENSMLUP00000005842  .................................................-------EGHLLKK.......R.....KW
ENSMLUP00000005470  .................................................----PIKQGILLKR.......S.....G-
ENSMLUP00000004401  .................................................--------------.......-.....--
ENSMLUP00000007384  .................................................---QFTAEGYLYVQ.......E.....KR
ENSMLUP00000001364  .................................................--GQPTIEGYLYTQ.......E.....KW
ENSMLUP00000012921  .................................................--------------.......-.....--
ENSMLUP00000007470  .................................................-----EIEGVLWLK.......-.....--
ENSMLUP00000005126  .................................................-----MKLGTVERR.......-.....--
ENSMLUP00000010417  .................................................----FLRQGWLLVV.......P.....PR
ENSMLUP00000004167  .................................................----PEKCGYLELR.......-.....--
ENSMLUP00000001037  .................................................--------------.......-.....--
ENSMLUP00000005893  .................................................--SCPEIQGFLHVK.......-.....--
ENSMLUP00000013677  .................................................-----EIQGFLQLR.......-.....--
ENSMLUP00000004578  .................................................--------------.......-.....--
ENSMLUP00000006842  .................................................--------------.......-.....--
ENSMLUP00000000788  .................................................-------EGFLWKR.......-.....--
ENSMLUP00000008066  .................................................----PIKQSFLLKR.......S.....G-
ENSMLUP00000013630  .................................................--------------.......-.....--
ENSMLUP00000007116  .................................................--------------.......-.....--
ENSMLUP00000003711  .................................................--------------.......-.....--
ENSMLUP00000011617  .................................................--------------.......-.....--
ENSMLUP00000010157  .................................................--------GSLRVQ.......Q.....AG
ENSMLUP00000008290  .................................................--------------.......-.....--
ENSMLUP00000009645  .................................................--------------.......-.....--
ENSMLUP00000006092  .................................................----PEIHGFLHAK.......-.....--
ENSMLUP00000000518  .................................................--------------.......-.....--
ENSMLUP00000004023  .................................................--------------.......-.....--
ENSMLUP00000006542  .................................................-----TIQGVLKRK.......Tllke.GK
ENSMLUP00000001230  .................................................--------------.......-.....--
ENSMLUP00000010734  .................................................--------------.......-.....--
ENSMLUP00000003167  .................................................--------------.......-.....--
ENSMLUP00000005624  .................................................--------------.......-.....--
ENSMLUP00000019375  .................................................-------EGFLWKR.......-.....--
ENSMLUP00000010926  .................................................--------------.......-.....--
ENSMLUP00000009859  .................................................--------------.......-.....--
ENSMLUP00000001711  .................................................--------GKLSKV.......R.....LG
ENSMLUP00000017505  .................................................--------------.......-.....--
ENSMLUP00000007171  .................................................----VVVKGWLYRE.......P.....RG
ENSMLUP00000003490  .................................................------KQDYFIKS.......P.....PP
ENSMLUP00000007987  .................................................--------------.......-.....--
ENSMLUP00000004020  .................................................--------------.......-.....--
ENSMLUP00000014449  .................................................-----VKQGFLYLQ.......Q.....Q-
ENSMLUP00000016474  .................................................--RKFLHSGKLYKA.......-.....--
ENSMLUP00000006830  .................................................--------------.......-.....--
ENSMLUP00000016017  .................................................--------------.......-.....--
ENSMLUP00000012677  .................................................--------------.......-.....--
ENSMLUP00000000189  .................................................--------------.......-.....--
ENSMLUP00000009973  .................................................------FEGPLWKS.......-.....--
ENSMLUP00000010385  .................................................--------------.......-.....--
ENSMLUP00000007987  .................................................----PLRTGMLELR.......-.....--
ENSMLUP00000009299  .................................................--------------.......-.....--
ENSMLUP00000007456  .................................................--------------.......-.....--
ENSMLUP00000006103  .................................................--------------.......-.....--
ENSMLUP00000012783  .................................................----SRIEGWLSVP.......N.....RG
ENSMLUP00000014471  .................................................--------------.......-.....--
ENSMLUP00000000189  .................................................--------------.......-.....--
ENSMLUP00000012437  .................................................--------------.......-.....--
ENSMLUP00000021530  .................................................--------------.......-.....--
ENSMLUP00000006501  .................................................----YTMEGYLYVQ.......E.....KR
ENSMLUP00000003171  .................................................--------------.......-.....--
ENSMLUP00000011174  .................................................--------------.......-.....--
ENSMLUP00000011009  .................................................--------------.......-.....--
ENSMLUP00000005126  .................................................----AIKESLLYLY.......-.....--
ENSMLUP00000008335  .................................................--------------.......-.....--
ENSMLUP00000014049  .................................................-GSSLHLEGWMKVP.......R.....NN
ENSMLUP00000013909  .................................................---GTAYEGFLSVP.......R.....P-
ENSMLUP00000019004  .................................................--------GQLYYK.......D.....CH
ENSMLUP00000004167  .................................................--------GQLYYK.......D.....CH
ENSMLUP00000022232  .................................................----AVMEGPLFLQ.......G.....Q-
ENSMLUP00000018295  .................................................--------------.......-.....--
ENSMLUP00000021849  .................................................--------------.......-.....--
ENSMLUP00000006303  .................................................------YEGHVRIP.......K.....P-
ENSMLUP00000015098  .................................................-------KGYVKVP.......K.....P-
ENSMLUP00000006492  .................................................--------------.......-.....--
ENSMLUP00000008454  .................................................--------------.......-.....--
ENSMLUP00000010385  .................................................-NQQIVYMGWCEAR.......E.....QD
ENSMLUP00000009012  .................................................-----VKTGALQWW.......C.....DW
ENSMLUP00000000189  .................................................--------------.......-.....--
ENSMLUP00000014285  .................................................----SRLEGWLSLP.......V.....RN
ENSMLUP00000006019  .................................................----PVKDGILYQQ.......H.....V-
ENSMLUP00000011245  .................................................--------------.......-.....--
ENSMLUP00000007987  .................................................-------LGRLWLR.......S.....PS
ENSMLUP00000008335  .................................................------FHSFLYMK.......-.....--
ENSMLUP00000000103  .................................................--------------.......-.....KM
ENSMLUP00000020572  .................................................--------------.......-.....KM
ENSMLUP00000009684  .................................................--------------.......-.....--
ENSMLUP00000018770  .................................................--------------.......-.....--
ENSMLUP00000007942  .................................................-----LLSGIYNVR.......K.....G-
ENSMLUP00000008949  .................................................----IRHLGWLAEK.......V.....P-
ENSMLUP00000007075  .................................................--------------.......-.....--
ENSMLUP00000012217  .................................................--------------.......-.....--
ENSMLUP00000014260  .................................................--------------.......-.....--
ENSMLUP00000021545  .................................................--------------.......-.....--
ENSMLUP00000013488  .................................................--------------.......-.....--
ENSMLUP00000000189  .................................................--------------.......-.....--
ENSMLUP00000005075  .................................................--------------.......-.....--
ENSMLUP00000014442  .................................................--------------.......-.....--


                                   20                30                               40            
                                    |                 |                                |            
d2elba2               G............LVSS.....TWD..R.QFYFT.........Q.......GG.......NLMSQA............
ENSMLUP00000006551  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010306  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000002181  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007103  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000015991  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011751  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006051  -............----.....---..-.-----.........-.......--.......-L----............
ENSMLUP00000006484  -............----.....-WT..G.RLRIT.........S.......KG.......KIAYIK............
ENSMLUP00000022507  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014236  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006854  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003954  K............KKTSpl...NFK..K.RLFLL.........T.......VQ.......KLSYYE............
ENSMLUP00000009991  -............----.....---..-.-----.........-.......--.......-VSYFY............
ENSMLUP00000007057  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000019012  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005088  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009827  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007432  R............KRFGmk...NFK..K.RWFRL.........T.......NH.......EFTYQK............
ENSMLUP00000014622  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004098  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014409  R............TSPS.....NFK..V.RFFVL.........T.......KT.......SLAYFE............
ENSMLUP00000004165  -............----.....FAR..R.RQLLL.........T.......EGp......HLYYVD............
ENSMLUP00000005117  -............---G.....KSQ..Q.RTFFL.........F.......DH.......QLVSCK............
ENSMLUP00000011092  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000001759  -............----.....--T..D.LWLGV.........D.......AL.......GLNIYE............
ENSMLUP00000005088  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005088  -............----.....---..-.----L.........-.......--.......------............
ENSMLUP00000014421  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007415  -............----.....---..-.LWLGV.........D.......AL.......GLNIYE............
ENSMLUP00000000876  -............----.....---..-.-----.........-.......--.......TLFVYR............
ENSMLUP00000012407  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010866  -............---K.....KGT..E.LWLGV.........D.......AL.......GLNIYE............
ENSMLUP00000015289  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014093  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005088  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000016145  K............KKMSpn...NYK..E.RLFVL.........T.......KT.......NLSYYE............
ENSMLUP00000000362  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004624  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004420  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007170  Rtr..........IGKK.....NFK..K.RWFCL.........T.......SR.......ELTYHK............
ENSMLUP00000007524  -............----.....---..-.-----.........-.......GY.......YLYWTY............
ENSMLUP00000011865  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009407  -............----.....---..-.-----.........-.......--.......-LHIYD............
ENSMLUP00000017210  -............----.....---..-.-----.........-.......--.......-LHIYD............
ENSMLUP00000001866  Y............QPYG.....RNQ..Q.RVFFL.........F.......DH.......QMVLCK............
ENSMLUP00000007867  G............HLRR.....NWA..E.RWFQL.........Q.......PS.......CLCYFG............
ENSMLUP00000011713  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009897  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009921  -............----.....---..-.-----.........-.......--.......--MYFK............
ENSMLUP00000000027  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000019003  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006515  K............INTF.....NWS..R.V----.........-.......--.......------............
ENSMLUP00000010025  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003276  -............---D.....SVK..W.HYLCL.........-.......--.......------............
ENSMLUP00000012185  -............-N--.....---..-.-----.........-.......--.......------............
ENSMLUP00000009828  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000547  G............HRRK.....NWT..E.RWFVL.........K.......PN.......VISYYV............
ENSMLUP00000006939  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013213  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010899  -............----.....--K..R.LWK--.........-.......--.......------............
ENSMLUP00000014701  -............----.....---..-.-----.........-.......--.......--Y---............
ENSMLUP00000001355  Kintfnwa.....KIRKl....SFK..R.KHFLIkl.......H.......AN.......ILVLCK............
ENSMLUP00000004002  -............----.....---..-.----V.........R.......DG.......WLQLLD............
ENSMLUP00000003010  -............-NRD.....KTI..D.LYTLL.........L.......ED.......ILVLLQkqddrlvlrchs
ENSMLUP00000014344  -............---G.....AKH..E.RHIFL.........F.......DG.......LMICCKsnhgqprlpga.
ENSMLUP00000011779  -............-VTKd....KAV..E.VHVLL.........L.......DD.......LLLLLQrqderlllkshs
ENSMLUP00000004968  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006705  -............---A.....QWQ..K.CRLLLrravag...E.......RF.......RLEFFV............
ENSMLUP00000013438  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013178  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000017586  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000009  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009616  -............ARFK.....PMQ..R.HLFLH.........E.......KA.......VLFCKK............
ENSMLUP00000001998  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012742  -............----.....---..-.-----.........-.......--.......N-----............
ENSMLUP00000000119  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003793  K............SYFSq....KWK..K.YWFVL.........K.......DA.......SLYWYI............
ENSMLUP00000003076  -............---G.....AKH..E.RHIFL.........F.......DG.......LMISCKpnhsqsrlpgy.
ENSMLUP00000013179  H............SFLGf....EWQ..K.RWCAL.........S.......KG.......VFYYYG............
ENSMLUP00000012676  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013417  -............----.....NKC..S.HFFQL.........K.......NI.......SFCGYH............
ENSMLUP00000010021  -............----.....---..-.-----.........-.......--.......---YLT............
ENSMLUP00000005492  -............---G.....RLK..D.VLVVL.........L.......TD.......VLLLLQ............
ENSMLUP00000017245  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005975  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013604  -............----.....SYF..L.RIFDI.........K.......DG.......KL----............
ENSMLUP00000013658  -............---G.....RLK..D.VLVVL.........L.......TD.......VLLLLQ............
ENSMLUP00000014884  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000015073  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011388  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004364  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009774  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008949  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013558  -............----.....TLQ..S.RLVMR.........T.......QG.......SLRLIL............
ENSMLUP00000013327  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013892  -............----.....EKN..E.RYLLL.........F.......PN.......ILLMLS............
ENSMLUP00000011043  -............-SRE.....QWT..P.SHVSV.........A.......PA.......TLTILH............
ENSMLUP00000004420  -............---G.....EGK..D.MYLIL.........E.......ND.......TLSLVD............
ENSMLUP00000001083  T............VRAGr....HKS..L.RRVFL.........F.......EE.......LLLFSK............
ENSMLUP00000006407  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000020850  -............----.....---..-.--C--.........-.......--.......------............
ENSMLUP00000001631  Pgsl.........ATRF.....AFK..K.RYFWL.........S.......GE.......TLSYSK............
ENSMLUP00000007486  -............----.....---..-.-----.........-.......S-.......------............
ENSMLUP00000008206  T............SRDT.....LRK..R.HYWRL.........D.......SK.......CLTLFQ............
ENSMLUP00000013539  -............-RVK.....TWK..R.RWFIL.........T.......DN.......CLYYFE............
ENSMLUP00000015365  -............-SAG.....NIQ..E.RAFFL.........F.......DN.......LLVYCKrksrvtgskkst
ENSMLUP00000020676  -............-SAG.....NIQ..E.RAFFL.........F.......DN.......LLVYCKrksrvtgskkst
ENSMLUP00000006371  -............----.....KKC..L.RHVFL.........F.......EH.......LLLFSK............
ENSMLUP00000007133  -............----.....--E..E.RYLML.........F.......SN.......VLIMLS............
ENSMLUP00000002508  -............-SSG.....NIQ..E.RVFFL.........F.......DN.......LLVYCKrkhrrrlknskt
ENSMLUP00000001462  -............-GMR.....LWK..R.RWFVL.........A.......DY.......CLFYYK............
ENSMLUP00000015489  -............----.....---..L.RHVFL.........F.......ED.......LILFSK............
ENSMLUP00000019635  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005155  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010240  -............----.....---..-.RHLFL.........Y.......EK.......AIVFCK............
ENSMLUP00000004993  G............AVMK.....NWK..R.RYFQL.........D.......EN.......TIGYFK............
ENSMLUP00000002012  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009146  K............KGKR.....HWK..K.LWFVI.........K.......GK.......VLYTYM............
ENSMLUP00000002140  K............SLIR.....KGR..E.RHLFL.........F.......EI.......SLVFSK............
ENSMLUP00000014437  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003504  G............GRVK.....TWK..R.RWFIL.........T.......DN.......CLYYFE............
ENSMLUP00000001212  Eafgkk.......AANR.....SWQ..N.VYCVL.........R.......HG.......SLGFYK............
ENSMLUP00000000142  S............VERR.....SKT..D.RYAFL.........L.......DK.......ALLICK............
ENSMLUP00000011713  F............KNSN.....GWQ..K.LWVVF.........T.......NF.......CLFFYK............
ENSMLUP00000011537  G............GRVK.....TWK..R.RWFIL.........T.......DS.......CLYYFE............
ENSMLUP00000008290  -............----.....---..-.---T-.........-.......--.......------............
ENSMLUP00000011975  P............GARM.....PWKghH.RHVFL.........F.......RH.......HLVVCK............
ENSMLUP00000012342  A............ARNT.....SAQ..E.RYLLL.........F.......NN.......MLLYCV............
ENSMLUP00000022464  G............RLKGs....QEC..N.VLVVL.........L.......TD.......VLLLLQ............
ENSMLUP00000006515  F............KNSN.....GWQ..K.LWVVF.........T.......NF.......CLFFYK............
ENSMLUP00000002051  -............----.....---..D.LDFQL.........Q.......DP.......FLLYRN............
ENSMLUP00000009895  G............TFLSn....KWK..K.FWVVL.........K.......AS.......SLYWYS............
ENSMLUP00000003910  Egpnkk.......ASNR.....SWN..H.LYCVL.........R.......NS.......ELTFYK............
ENSMLUP00000010202  G............NVRK.....SWK..R.RFFAL.........D.......DF.......SICYFK............
ENSMLUP00000000726  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014255  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009304  G............GFMSp....RWR..R.CWFVL.........K.......RH.......KLYWYR............
ENSMLUP00000000726  K............TLIR.....KGR..E.RHLFL.........F.......EM.......SLVFSK............
ENSMLUP00000018812  G............SDRG.....AFQ..S.RLIMR.........N.......QG.......SLRLIL............
ENSMLUP00000002452  G............SDRG.....AFQ..S.RLIMR.........N.......QG.......SLRLIL............
ENSMLUP00000009837  T............SKDT.....LRK..R.HYWRL.........D.......SK.......CITLFQ............
ENSMLUP00000015435  -............--QR.....AKN..E.RTLFL.........F.......DK.......LLLITK............
ENSMLUP00000009557  Gkgp.........LMSS.....SFK..K.LYFSL.........T.......TE.......ALSFAK............
ENSMLUP00000015519  R............SEYQ.....EYK..Q.YWTEL.........R.......GT.......TLFFYN............
ENSMLUP00000004997  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009040  G............GGQP.....QWQ..K.CRLLL.........RsegegggGS.......RLEFFV............
ENSMLUP00000009186  -............-ATG.....RFK..D.VLMLL.........M.......TD.......VLVFLQ............
ENSMLUP00000006019  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004311  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006153  -............KRFG.....QWT..K.LLCVI.........K.......DT.......KLLCYK............
ENSMLUP00000001771  S............FRRR.....DPT..E.RYLFL.........F.......NN.......MLLYCV............
ENSMLUP00000003867  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003333  R............SIVK.....NWQ..Q.RYFVL.........R.......AQ.......QLYYYK............
ENSMLUP00000020254  S............GFVK.....GWR..K.RWFVLk........H.......DG.......CLHYYR............
ENSMLUP00000007954  -............-AAG.....RLK..E.VQAVL.........L.......TD.......ILVFLQ............
ENSMLUP00000014165  -............----.....---..-.-----.........-.......DR.......VLELFD............
ENSMLUP00000015532  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006515  -............-TRK.....GLQ..Q.RMFFL.........F.......SD.......MLLYTS............
ENSMLUP00000015042  G............HRRK.....NWK..V.RKFIL.........R.......EDpa.....YLHYYD............
ENSMLUP00000000573  G............ALLK.....GWK..P.RWFVLdv.......T.......KH.......QLRYYD............
ENSMLUP00000002140  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009833  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014256  S............GKVK.....TWK..R.RWFVL.........K.......GG.......ELLYYK............
ENSMLUP00000014449  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000002296  Kelhgflfndf..LLLT.....HLV..K.QFAVS.........S.......GTe......KLFSSK............
ENSMLUP00000001022  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000015339  T............SSFQ.....RWK..K.RYFKL.........R.......GR.......TLYYAK............
ENSMLUP00000012336  -............-SNS.....RIY..H.RYFLL.........D.......ADmq.....SLRWEP............
ENSMLUP00000022476  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014752  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011116  -............-CRK.....KPK..A.RQFFL.........F.......ND.......ILVYGN............
ENSMLUP00000006182  G............GLVK.....TWK..T.RWFTL.........H.......RN.......ELKYFK............
ENSMLUP00000002497  -............----.....---..-.-----.........-.......--.......-----K............
ENSMLUP00000001331  -............-GLR.....LWK..R.RWFVL.........S.......GH.......CLFYYK............
ENSMLUP00000009696  S............AKNG.....TTQ..D.RYLIL.........F.......ND.......RLLYCV............
ENSMLUP00000007783  E............AHNKkassrSWH..N.VYCA-.........-.......--.......------............
ENSMLUP00000013998  P............RGKR.....GWK..T.FYAVL.........K.......GT.......ILYLQK............
ENSMLUP00000002874  -............----.....--Q..N.MLMIL.........K.......KD.......AMSLVN............
ENSMLUP00000004775  -............----.....---..-.-----.........-.......--.......V-----............
ENSMLUP00000002874  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000015873  N............NSFQ.....RSK..R.RYFKL.........R.......GR.......TLYYAK............
ENSMLUP00000019971  -............SGLR.....LWK..R.RWFVL.........S.......GH.......CLFYYK............
ENSMLUP00000009770  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008335  Sst..........LSRR.....NWK..R.RWFVL.........R.......QS.......KLMYFE............
ENSMLUP00000020205  G............GRHA.....AYH..R.RWFVL.........R.......GN.......MLFYFE............
ENSMLUP00000014596  G............AFMK.....PWK..A.RWFVLdk.......T.......KH.......QLRYYD............
ENSMLUP00000011059  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000019635  -............---K.....SMH..K.RFFVL.........R.......AAseaggpaRLEYYE............
ENSMLUP00000004596  -............-FGS.....EWQ..K.RWCVV.........S.......RG.......LFCYYA............
ENSMLUP00000004060  G............SRVK.....TWK..R.RWFVL.........R.......QG.......QILYYK............
ENSMLUP00000010430  W............ALKD.....CPR..R.RAVIL.........K.......FSlq.....GLKIYS............
ENSMLUP00000000775  -............----.....---..-.-----.........-.......--.......CLKLID............
ENSMLUP00000006337  -............SGVK.....QWN..K.RWFVL.........V.......DR.......CLFYYK............
ENSMLUP00000010159  T............NYIK.....GYQ..R.RWFVL.........S.......NG.......LLSYYR............
ENSMLUP00000004167  -............-GKR.....MFQ..K.RWVKF.........D.......GF.......SISYYN............
ENSMLUP00000001945  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014265  -............----.....---..-.---YS.........K.......KC.......KLFYKK............
ENSMLUP00000004630  -............-FLT.....QWQ..R.RYFYL.........F.......PN.......RLEW-R............
ENSMLUP00000014463  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011713  -............-SGK.....GLQ..Q.RMFFL.........F.......ND.......VLLYTS............
ENSMLUP00000010988  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000022232  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012079  -............-AFK.....TWS..R.RWFTI.........Q.......SN.......QLVYQK............
ENSMLUP00000015465  G............IMKG.....GSK..G.YWFVL.........T.......AE.......SLSWYK............
ENSMLUP00000001381  -............VRSK.....NWK..KlRYFRL.........K.......ED.......GMTVWH............
ENSMLUP00000014433  K............GHKK.....PWK..H.FWFVI.........K.......NK.......VLYTYA............
ENSMLUP00000002430  -............-PNS.....RIY..N.RFFTL.........D.......TD.......LLALRW............
ENSMLUP00000001136  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007700  S............LMKG.....GSK..E.YWFVL.........T.......AE.......SLSWYK............
ENSMLUP00000002685  -............----.....---..E.RLLFL.........F.......SR.......MLLVAK............
ENSMLUP00000003527  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000189  Akllqdr......RARE.....EFS..R.RWCVL.........S.......DG.......VLSYYE............
ENSMLUP00000005172  -............----.....---..-.-----.........-.......--.......I-----............
ENSMLUP00000005760  P............RGKR.....GWK..S.FHGIL.........K.......GM.......ILYLQK............
ENSMLUP00000003875  T............NYIH.....GWQ..D.RWVVM.........K.......NN.......TLSYYK............
ENSMLUP00000014433  -............-SRK.....DMQ..P.RVFFL.........F.......ND.......ALLYTT............
ENSMLUP00000010635  -............-AFK.....TWN..R.RWFSI.........Q.......NN.......QLVYQK............
ENSMLUP00000001299  -............-EST.....RFL..D.VYLFL.........F.......DD.......FLLVTKtkrnkkkvggld
ENSMLUP00000014110  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010539  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011416  S............AKTG.....AAQ..D.RHLFL.........F.......NS.......MVLYCV............
ENSMLUP00000001779  -............----.....---..-.-Y---.........-.......--.......------............
ENSMLUP00000015042  G............SVFN.....TWK..P.MWVVL.........L.......ED.......GIEFYK............
ENSMLUP00000005045  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004048  G............HKRK.....NWK..V.RRFVL.........R.......KEpa.....FLHYYD............
ENSMLUP00000015550  Stit.........VTMK.....VFK..R.RYFYLtqlpd....G.......SY.......ILNSCK............
ENSMLUP00000005543  E............PHTA.....GWA..K.RYVVV.........R.......RP.......YAYMYN............
ENSMLUP00000002060  G............EYIK.....TWR..P.RYFLLk........S.......DG.......SFIGYK............
ENSMLUP00000002846  G............GKIK.....TWK..K.RWFVF.........D.......RNkr.....TFSYYA............
ENSMLUP00000015512  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008542  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014804  G............IMKG.....GSK..E.YWFVL.........T.......AE.......NLSWYK............
ENSMLUP00000010863  P............WGKR.....GWK..M.LHTLL.........R.......GM.......VLYFLK............
ENSMLUP00000000163  E............PFSS.....NWA..K.HFVVV.........R.......RP.......YVFIYN............
ENSMLUP00000010492  -............---K.....RWK..N.LYFILeg.......S.......DA.......QLIYFE............
ENSMLUP00000012859  Sais.........VTMR.....SFK..R.RFFHLiqlgd....G.......SY.......NLNFYK............
ENSMLUP00000011587  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000018248  -............-FLT.....QWQ..R.RYFYL.........F.......PN.......RLEWRG............
ENSMLUP00000007856  -............-FLT.....QWQ..R.RYFYL.........F.......PN.......RLEWRG............
ENSMLUP00000014214  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008400  T............NVMK.....GWQ..Y.RWFVLdy.......N.......AG.......LLSYYT............
ENSMLUP00000004048  G............HIVH.....NWK..A.RWFVL.........R.......QN.......TLLYYK............
ENSMLUP00000004605  -............GTLK.....SWT..K.LWCVL.........K.......PG.......VLLIYK............
ENSMLUP00000006812  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014871  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010926  -............---G.....QWK..K.HWFVL.........A.......DQ.......SLRYYR............
ENSMLUP00000012190  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012996  -............---S.....EWK..K.HWFVL.........T.......DS.......SLKYYR............
ENSMLUP00000013711  -............-QGD.....DYK..K.FWAGL.........Q.......GL.......TLYFYK............
ENSMLUP00000006780  G............LVTT.....SWE..R.LYFFT.........Q.......GG.......NLMCQP............
ENSMLUP00000005342  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006369  T............NYLK.....GYQ..R.RWFVL.........S.......NG.......LLSYYR............
ENSMLUP00000010845  -............TVQN.....NWK..A.FTFVL.........S.......RA.......YLMAFQ............
ENSMLUP00000015600  Stvnnt.......ITVR.....SFK..K.RYFQLtqlpd....S.......SY.......IMNFYK............
ENSMLUP00000010640  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000416  -............---Y.....AWK..R.RWFVL.........R.......SGrltgdpdVLEYYK............
ENSMLUP00000012342  -............---K.....PWQ..K.AWCVIpkq......D.......PL.......VLYMYG............
ENSMLUP00000007987  -............-GNY.....VFQ..R.RFVQF.........N.......GR.......SLMYFG............
ENSMLUP00000012982  -............----.....-KM..D.VYLFL.........F.......SD.......VLLVTK............
ENSMLUP00000014543  -............----.....-WK..K.RWFIL.........R.......SGrmsgdpdVLEYYK............
ENSMLUP00000000775  G............LVSS.....TWD..R.QFYFT.........Q.......GG.......NLMSQA............
ENSMLUP00000004637  -............-VWK.....RWK..K.RYFVLvqvsq....Y.......TF.......AMCSYR............
ENSMLUP00000007008  -............-VWK.....RWK..K.RFFVLvqvsq....Y.......TF.......AMCSYR............
ENSMLUP00000001540  C............NSFK.....RWK..L.RYFLV.........R.......GQ.......RLSHVL............
ENSMLUP00000007555  -............SGFG.....AWH..R.RWCIL.........S.......GN.......CISYWT............
ENSMLUP00000010202  -............-NSG.....KFL..R.RYFILdt.......Q.......AN.......YLLWYM............
ENSMLUP00000009696  E............KGGK.....GWH..K.AWFVV.........P.......ENepl....VLYIYG............
ENSMLUP00000000439  W............KFIK.....RWK..T.RYFTL.........A.......GN.......QLLFQK............
ENSMLUP00000021531  W............KFIK.....RWK..T.RYFTL.........A.......GN.......QLLFQK............
ENSMLUP00000008335  S............PKMSsl...KLK..K.RWFVL.........T.......HN.......SLDYYK............
ENSMLUP00000003131  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000002636  -............KRFG.....QWA..K.QLTVI.........K.......ED.......QLLCYK............
ENSMLUP00000012863  K............KLRK.....NWS..T.SWIVL.........S.......SR.......KIEFYK............
ENSMLUP00000005038  T............NLVT.....GWQ..Y.RFFVLnn.......E.......AG.......LLEYFV............
ENSMLUP00000007090  -............----.....-WR..K.RWFVL.........R.......RGrmcgnpdVLEYYR............
ENSMLUP00000020254  D............RSTD.....LWA..Q.RYCIL.........K.......DG.......CLYLYA............
ENSMLUP00000006780  -............----.....---..-.-----.........-.......SQ.......MLRLID............
ENSMLUP00000001391  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000002099  -............-KRT.....SKQ..Q.VYFFL.........F.......ND.......VLIITK............
ENSMLUP00000004060  -............-KHG.....HSK..L.VWCAL.........V.......GR.......TFYYYR............
ENSMLUP00000004167  -............-LLE.....ETN..K.KWCVL.........E.......GG.......FLSYYE............
ENSMLUP00000006989  -............-IRR.....VWQ..K.RKCGV.........K.......YG.......CLTISH............
ENSMLUP00000015169  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000788  -............-HRE.....PFK..K.RWFALdp.......Q.......ER.......RLLYYK............
ENSMLUP00000010633  -............-KNK.....NGH..K.LYIFL.........F.......QD.......ILVLTRpvtrndrhsyqv
ENSMLUP00000012424  -............---K.....EVH..K.RWWQL.........R.......DN.......AVEIFL............
ENSMLUP00000021545  -............--M-.....---..-.-----.........-.......--.......------............
ENSMLUP00000009146  -............-TGK.....NRR..P.RHLFL.........M.......SD.......MLLYTY............
ENSMLUP00000016015  -............-RRR.....QDK..F.WYCRL.........S.......PN.......HKVLHY............
ENSMLUP00000010504  G............LRRKl....NTR..P.VHLHL.........F.......ND.......CLLLSR............
ENSMLUP00000010306  PlvtlqkekklelVARR.....KWK..Q.YWVTL.........K.......GC.......TLLFYE............
ENSMLUP00000000456  S............YLGKe....LWK..T.CFVVL.........S.......NG.......ILYQYP............
ENSMLUP00000009152  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008233  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000001771  -............-WGK.....SST..R.GWCVIprd......D.......PL.......VLYIYA............
ENSMLUP00000002636  -............-VNH.....GWK..E.RWCRL.........K.......CN.......TLYFHK............
ENSMLUP00000008265  -............-IRK.....VWQ..R.RKCAV.........K.......NG.......MLTISH............
ENSMLUP00000015858  Ktsrtl.......RTKK.....LFQ..E.IYLFL.........F.......ND.......LLVICR............
ENSMLUP00000007197  -............--M-.....---..-.-----.........-.......--.......------............
ENSMLUP00000010409  K............KVRK.....NWL..S.SWAVL.........Q.......GS.......SLLFTK............
ENSMLUP00000006153  -............-SNN.....RWR..E.RWCRV.........K.......DN.......KLILHK............
ENSMLUP00000019004  -............----.....---..K.KWCVL.........E.......GG.......FLSYYE............
ENSMLUP00000014933  -............-FLG.....LWK..D.RYLLL.........C.......QA.......QLLVYE............
ENSMLUP00000014256  -............-KHG.....YSK..R.VWCTL.........V.......GK.......TLYYFR............
ENSMLUP00000010844  G............RPSA.....KWS..R.RFFII.........K.......ES.......FLLYYSesekksfet...
ENSMLUP00000006830  -............-VNS.....QWK..S.RWCSV.........R.......DS.......HLHFYQ............
ENSMLUP00000008037  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004431  K............GPIR.....GWK..S.RWFFYde.......R.......KC.......HLYYSR............
ENSMLUP00000003867  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000017606  -............----.....---..-.-----.........-.......N-.......------............
ENSMLUP00000005123  R............VRKK.....HWS..T.SWTVL.........E.......GG.......ILTFFK............
ENSMLUP00000002234  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000020202  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010185  -............-PLK.....GWH..K.RFFYL.........D.......KG.......ILKYAK............
ENSMLUP00000020533  -............----.....---..-.-----.........-.......-T.......------............
ENSMLUP00000018072  Gtpp.........TPSG.....TGR..R.CWFVL.........K.......GN.......LLFSFE............
ENSMLUP00000000937  R............KLRK.....NWC..P.SWVVL.........A.......GN.......SLMFYReppraapssavw
ENSMLUP00000007197  K............LILK.....AFK..Q.YWFVF.........K.......DT.......SITYFK............
ENSMLUP00000011043  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000013586  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000019004  S............KILSgn...KFQ..D.RHCVL.........R.......DG.......YLILYK............
ENSMLUP00000003532  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010845  K............DHDS.....YWQ..S.CYAEL.........S.......PY.......HLCFYS............
ENSMLUP00000007054  -............---S.....GWQ..P.RWFLL.........C.......GG.......ILSYYD............
ENSMLUP00000007486  S............RKLG.....IFR..R.CWLVF.........K.......KAsskgpr.RLEKFP............
ENSMLUP00000003307  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011628  -............----.....---..-.-----.........-.......--.......-LLFID............
ENSMLUP00000007987  P............RLLGn....RFQ..E.RFFLV.........R.......GR.......CLLLLK............
ENSMLUP00000002234  K............LTLK.....GYK..Q.YWCTF.........K.......DT.......SISCYK............
ENSMLUP00000020202  K............LTLK.....GYK..Q.YWCTF.........K.......DT.......SISCYK............
ENSMLUP00000000573  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000004701  K............SLNK.....EWK..K.KYVTLc........D.......NG.......VLTYHP............
ENSMLUP00000000932  -............----.....GQM..D.VYCFL.........F.......TD.......LLLVTK............
ENSMLUP00000005322  -............----.....GWQ..P.RWFVL.........D.......NG.......ILSYYD............
ENSMLUP00000002246  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012242  -............----.....SWR..R.LYCVL.........R.......GG.......KLYCFY............
ENSMLUP00000015202  K............PTLS.....SWT..R.YWVIL.........S.......GS.......TLLYYGakslrgtdr...
ENSMLUP00000010100  S............SILR.....RWK..R.NWFALw........L.......DG.......TLGYYH............
ENSMLUP00000010936  E............DGKK.....SWK..R.RYFLL.........R.......AS.......GIYYVP............
ENSMLUP00000014437  S............RKLG.....IYR..R.CWLVF.........R.......KSsskgpq.RLEKYP............
ENSMLUP00000005292  -............-PLK.....GWH..K.RFFVL.........D.......NG.......MLKYSK............
ENSMLUP00000005842  -............-PLK.....GWH..K.RYFVL.........E.......DG.......ILRYAT............
ENSMLUP00000005470  K............SLNK.....EWK..K.KYVTL.........C.......DN.......GLLTYH............
ENSMLUP00000004401  -............----.....---..-.----I.........T.......DT.......TLYFQP............
ENSMLUP00000007384  P............APFGs....SWV..K.HYCMYrkaa.....K.......KF.......NMIPFE............
ENSMLUP00000001364  -............ALGI.....SWV..K.YYCQY.........E.......KEtktl...TMTPME............
ENSMLUP00000012921  -............--IK.....NWR..P.RYFILk........T.......DG.......SFIGYK............
ENSMLUP00000007470  D............DGKK.....SWK..K.RYFLL.........R.......AS.......GIYYVP............
ENSMLUP00000005126  -............GAMG.....IWK..E.LFCEL.........S.......PL.......EFRLYL............
ENSMLUP00000010417  -............---G.....EPR..P.RMFFL.........F.......SD.......VLVLAK............
ENSMLUP00000004167  -............---G.....YKA..K.IFTVL.........S.......GN.......SVWLCK............
ENSMLUP00000001037  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005893  E............LGRK.....SWK..K.MYLCL.........R.......RS.......GLYCST............
ENSMLUP00000013677  G............SGRK.....LWK..R.FFCFL.........R.......RS.......GLYYST............
ENSMLUP00000004578  -............----.....---..-.---FL.........F.......ND.......LL----............
ENSMLUP00000006842  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000788  G............RDNA.....QFL..R.RRFVLla.......R.......EG.......LLKYYT............
ENSMLUP00000008066  N............SLNK.....EWK..K.KYVTLs........S.......NG.......FLLYHP............
ENSMLUP00000013630  -............----.....SSK..A.VYLHL.........F.......ND.......CLLLSR............
ENSMLUP00000007116  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003711  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011617  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000010157  -............-ERQ.....DWA..R.VHGVL.........K.......GT.......NLFCYR............
ENSMLUP00000008290  -............----.....--Q..R.CWLVF.........K.......KAsskgpk.RLEKFS............
ENSMLUP00000009645  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006092  E............QGKK.....SWK..K.TYFLL.........R.......RS.......GLYFST............
ENSMLUP00000000518  -............----.....---..-.RYFVLdf.......E.......AG.......LLQYFV............
ENSMLUP00000004023  -............--GS.....VVK..R.RLVKL.........V.......VN.......FLFYFR............
ENSMLUP00000006542  K............PTVA.....SWT..K.YWAAL.........C.......GT.......QLFYYT............
ENSMLUP00000001230  -............----.....---..-.----L.........F.......ND.......LLVVTKifqkkk......
ENSMLUP00000010734  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000003167  -............----.....-RQ..E.RHLFL.........F.......SD.......LFVVAK............
ENSMLUP00000005624  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000019375  G............RDNA.....QFL..R.RRFVLla.......R.......EG.......LLKYYT............
ENSMLUP00000010926  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000009859  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000001711  S............LSLK.....KEG..E.RQCFLf........T.......KH.......FLICTR............
ENSMLUP00000017505  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007171  R............GPRPwl...PPR..R.AWFVL.........T.......RD.......SLDQFS............
ENSMLUP00000003490  Q............LFSSap...SWK..K.RFFVLtrsge....K.......GF.......SLSYYK............
ENSMLUP00000007987  -............----.....APS..R.LWCVL.........-.......GA.......ALEMFV............
ENSMLUP00000004020  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014449  Q............TFGK.....KWR..R.FGAVL.........Y.......GQsgcala.RLELQE............
ENSMLUP00000016474  -............---K.....SNK..E.LYGFL.........F.......ND.......FLLLT-............
ENSMLUP00000006830  -............----.....---..-.-----.........-.......EN.......RLLCYK............
ENSMLUP00000016017  -............----.....---..-.NWFIL.........F.......ND.......ALVHA-............
ENSMLUP00000012677  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000189  G............LPSG.....GFH..D.RYFIL.........N.......SS.......CLRLYKeirsqrpwsga.
ENSMLUP00000009973  -............SRFF.....GWR..L.FWVVL.........E.......HG.......VLSWYR............
ENSMLUP00000010385  -............----.....RWE..K.RWCDL.........R.......--.......------............
ENSMLUP00000007987  -............---G.....HKA..K.VFAAL.........S.......PG.......ELALYK............
ENSMLUP00000009299  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007456  -............----.....RFT..P.LCLLL.........F.......SD.......LLLITQ............
ENSMLUP00000006103  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012783  N............IKRY.....GWK..K.QYVVV.........S.......SK.......KILFYN............
ENSMLUP00000014471  -............----.....---..-.-LFAY.........S.......DL.......LLFTKE............
ENSMLUP00000000189  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012437  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000021530  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006501  E............CHFGt....SWV..K.HYCTY.........Q.......RDskqi...TMVPFD............
ENSMLUP00000003171  G............RACY.....RWS..R.RWLIV.........K.......DS.......FLLYMK............
ENSMLUP00000011174  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000011009  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000005126  -............-TDR.....TWT..P.YIFSL.........S.......LD.......SLKCFR............
ENSMLUP00000008335  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014049  K............RGQQ.....GWD..R.KYIVL.........E.......GS.......KVLIYD............
ENSMLUP00000013909  A............GVRR.....GWQ..R.VFAAL.........S.......DS.......RLLLFD............
ENSMLUP00000019004  -............-ALD.....QWK..K.GWFAM.........D.......KS.......SLCFCL............
ENSMLUP00000004167  -............-ALD.....QWK..K.GWFAM.........D.......KS.......SLCFCL............
ENSMLUP00000022232  R............FGAK.....RWR..K.TWAVL.........Y.......PAsphgva.RLEFFD............
ENSMLUP00000018295  G............LPSG.....GFQ..D.RYFSL.........N.......SS.......CLRLYKeiwsqrpwsga.
ENSMLUP00000021849  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000006303  A............GVKK.....GWQ..R.ALAVV.........C.......DF.......KLFLYDvaegka......
ENSMLUP00000015098  T............GVKK.....GWQ..R.AYAVV.........C.......DC.......KLFLYDlpegkst.....
ENSMLUP00000006492  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000008454  -............----.....---..-.-----.........-.......--.......-L----............
ENSMLUP00000010385  P............LQDS.....VYS..P.IFLAL.........R.......GS.......CLYKFL............
ENSMLUP00000009012  -............-KPH.....KWV..D.VRVALeqftghdgaR.......DS.......ILFIYY............
ENSMLUP00000000189  G............LSLQ.....RAQ..E.GWFSL.........T.......GS.......ELHAIF............
ENSMLUP00000014285  N............TKKF.....GWV..R.KYVIV.........S.......SK.......KILFYD............
ENSMLUP00000006019  K............FGKK.....SWR..K.VWGLL.........Y.......AGgpsgva.RLESWEvrdggtgpagdr
ENSMLUP00000011245  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000007987  Yta..........LAPG.....LWL..S.GFGLL.........R.......GD.......HLFLCP............
ENSMLUP00000008335  G............GLMN.....SWK..R.RWCVL.........K.......DE.......TFLWFR............
ENSMLUP00000000103  Q............LPVN.....RWT..R.RQVIL.........C.......GT.......CLIVSS............
ENSMLUP00000020572  Q............LPVN.....RWT..R.RQVIL.........C.......GT.......CLIVSS............
ENSMLUP00000009684  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000018770  -............----.....---..E.RHLFL.........F.......ND.......LLVVAK............
ENSMLUP00000007942  K............TQLH.....KWA..E.RLVVL.........C.......GT.......CLIVSS............
ENSMLUP00000008949  G............ENEK.....QWK..P.ALVVL.........T.......DK.......DLLIYD............
ENSMLUP00000007075  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000012217  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014260  -............QVCY.....RWS..K.RWLVV.........K.......DS.......FLLYMC............
ENSMLUP00000021545  K............LTLK.....GYR..Q.HWVVF.........K.......ET.......TLSYYK............
ENSMLUP00000013488  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000000189  -............----.....IKN..K.LYVAV.........V.......GD.......KVQLYK............
ENSMLUP00000005075  -............----.....---..-.-----.........-.......--.......------............
ENSMLUP00000014442  -............----.....---..-.RFVII.........H.......KR.......CIYYFK............


                                                                         50                         
                                                                          |                         
d2elba2               ....................RG...........DV............AGGLAMDIDN..............C...SVM
ENSMLUP00000006551  ....................--...........--............----------..............V...NFA
ENSMLUP00000010306  ....................--...........--............K---------..............-...---
ENSMLUP00000002181  ....................--...........--............----------..............-...---
ENSMLUP00000007103  ....................--...........--............----------..............-...---
ENSMLUP00000015991  ....................--...........--............----------..............-...---
ENSMLUP00000011751  ....................--...........--............------T---..............-...---
ENSMLUP00000006051  ....................--...........--............----------..............-...---
ENSMLUP00000006484  ....................LEdkv........SG............ELFAQAPIEQhpg...........I...AVE
ENSMLUP00000022507  ....................--...........--............----------..............-...---
ENSMLUP00000014236  ....................--...........--............----------..............-...---
ENSMLUP00000006854  ....................--...........--............-----YPLNT..............V...---
ENSMLUP00000003954  ....................YDfergr......RG............SKKGSIDVEK..............I...TCV
ENSMLUP00000009991  ....................DS...........TR............NVYRIISLDG..............S...KAI
ENSMLUP00000007057  ....................--...........--............--QHNCQLHR..............I...SFC
ENSMLUP00000019012  ....................--...........--............-I--------..............-...---
ENSMLUP00000005088  ....................--...........--............--R-------..............-...---
ENSMLUP00000009827  ....................--...........--............----------..............-...---
ENSMLUP00000007432  ....................SK...........GD............QPLYSIPIEN..............I...LAV
ENSMLUP00000014622  ....................--...........--............----------..............-...---
ENSMLUP00000004098  ....................--...........--............----------..............-...-F-
ENSMLUP00000014409  ....................DRhgk........KR............TLKGSIELSR..............I...KCV
ENSMLUP00000004165  ....................PV...........NK............VLKGEIPWSQ..............E...LRP
ENSMLUP00000005117  ....................KDllrrd......ML............YYRGRMDMDD..............M...ELV
ENSMLUP00000011092  ....................--...........--............----------..............-...---
ENSMLUP00000001759  ....................KEd..........KL............TPKIGFPWSE..............I...RNI
ENSMLUP00000005088  ....................--...........--............----------..............L...---
ENSMLUP00000005088  ....................--...........--............----------..............-...---
ENSMLUP00000014421  ....................--...........--............-----F----..............-...---
ENSMLUP00000007415  ....................QNd..........RL............TPKIGFPWSE..............I...RNI
ENSMLUP00000000876  ....................RSa..........SP............YHGFTIVNRL..............-...---
ENSMLUP00000012407  ....................--...........--............-P--------..............-...---
ENSMLUP00000010866  ....................HDd..........KL............TPKIGFPWSE..............I...RNI
ENSMLUP00000015289  ....................--...........--............--------I-..............-...---
ENSMLUP00000014093  ....................--...........--............----------..............-...---
ENSMLUP00000005088  ....................--...........--............---M------..............-...---
ENSMLUP00000016145  ....................YDkmk........RG............SRKGSIDIKN..............I...RCV
ENSMLUP00000000362  ....................--...........--............----------..............-...---
ENSMLUP00000004624  ....................--...........--............----I-----..............-...---
ENSMLUP00000004420  ....................--...........--............---------E..............C...RVR
ENSMLUP00000007170  ....................QP...........GK............DALYTIPVKN..............I...LAV
ENSMLUP00000007524  ....................QSk..........EM............EFLDITSIRD..............T...RFG
ENSMLUP00000011865  ....................--...........KL............FFRRHYPVNS..............I...TFS
ENSMLUP00000009407  ....................PEn..........RL............TPKISFPWNE..............I...RNI
ENSMLUP00000017210  ....................PEn..........RL............TPKISFPWNE..............I...RNI
ENSMLUP00000001866  ....................KDlirr.......DIl...........YYKGRIDMDK..............Y...EVV
ENSMLUP00000007867  ....................SEe..........CK............EKRGTIPLDG..............Q...CCV
ENSMLUP00000011713  ....................--...........--............----------..............-...---
ENSMLUP00000009897  ....................--...........--............----------..............-...---
ENSMLUP00000009921  ....................NV...........ER............DPHFILDVPL..............G...VIS
ENSMLUP00000000027  ....................--...........--............----------..............-...---
ENSMLUP00000019003  ....................--...........--............----------..............-...---
ENSMLUP00000006515  ....................--...........--............----------..............-...---
ENSMLUP00000010025  ....................--...........KQ............TFSPVLKLNA..............V...LVR
ENSMLUP00000003276  ....................--...........--............----------..............-...---
ENSMLUP00000012185  ....................--...........--............----------..............-...---
ENSMLUP00000009828  ....................--...........--............----------..............-...--V
ENSMLUP00000000547  ....................SEdlk........DK............KGDIVLDENC..............C...VES
ENSMLUP00000006939  ....................--...........--............----------..............-...---
ENSMLUP00000013213  ....................--...........--............----------..............-...--K
ENSMLUP00000010899  ....................--...........--............----------..............-...---
ENSMLUP00000014701  ....................--...........--............----------..............-...---
ENSMLUP00000001355  ....................DT...........--............----------..............-...---
ENSMLUP00000004002  ....................IE...........TK............EELDSYRLDS..............I...QAM
ENSMLUP00000003010  .............kilastaDS...........KH............TFSPVIKLNT..............V...LVR
ENSMLUP00000014344  ....................SNa..........EY............RLKEKFFMRK..............V...QIN
ENSMLUP00000011779  .............rtltptpDG...........KT............MLRPVLRLTS..............A...MTR
ENSMLUP00000004968  ....................--...........--............----------..............-...---
ENSMLUP00000006705  ....................PPk..........AS............RPKVSIPLSA..............I...IEV
ENSMLUP00000013438  ....................--...........--............Q---------..............-...---
ENSMLUP00000013178  ....................--...........--............----------..............-...---
ENSMLUP00000017586  ....................--...........--............---------L..............-...---
ENSMLUP00000000009  ....................--...........--............----------..............-...---
ENSMLUP00000009616  ....................REengegy.....EKapsy........SYKQSLNMAA..............V...---
ENSMLUP00000001998  ....................--...........--............----------..............-...---
ENSMLUP00000012742  ....................--...........--............----------..............-...---
ENSMLUP00000000119  ....................--...........--............-----LLLST..............H...RLI
ENSMLUP00000003793  ....................NEe..........DE............KAEGFISLPE..............F...KID
ENSMLUP00000003076  ....................SSa..........EY............RLKEKFVMRK..............I...QIC
ENSMLUP00000013179  ....................SDk..........DK............QQKGEFAIDG..............Y...HVR
ENSMLUP00000012676  ....................--...........--............-L--------..............-...---
ENSMLUP00000013417  ....................PK...........NN............KYFGF-----..............-...---
ENSMLUP00000010021  ....................DK...........GC............NPTHLADFNQ..............V...QTI
ENSMLUP00000005492  ....................EKd..........QKyvfasvd.....SKRPVISLQK..............L...IVR
ENSMLUP00000017245  ....................-Qn..........ST............KDRKVIPLKM..............C...FAA
ENSMLUP00000005975  ....................-Qn..........ST............KDRKVIPLKM..............C...FAA
ENSMLUP00000013604  ....................--...........--............----------..............-...---
ENSMLUP00000013658  ....................EKd..........QKyvfasvd.....SKRPVISLQK..............L...IVR
ENSMLUP00000014884  ....................--...........--............----------..............C...---
ENSMLUP00000015073  ....................--...........--............----------..............-...---
ENSMLUP00000011388  ....................--...........--............----------..............-...---
ENSMLUP00000004364  ....................--...........--............----------..............-...---
ENSMLUP00000009774  ....................--...........--............-------LRG..............V...KLS
ENSMLUP00000008949  ....................--...........--............--RKNIPLRM..............C...YVT
ENSMLUP00000013558  ....................NT...........KL............WAQMQIDKAS..............E...KSI
ENSMLUP00000013327  ....................--...........--............----------..............-...---
ENSMLUP00000013892  ....................ASprms.......GF............IYQGKLPTTG..............M...TIT
ENSMLUP00000011043  ....................QQ...........TE............AVLGECRVRF..............L...SFL
ENSMLUP00000004420  ....................PM...........DR............TVLHSQPIVS..............I...RVW
ENSMLUP00000001083  ....................PRr..........GP............TGIDMFAYKR..............S...FKM
ENSMLUP00000006407  ....................--...........--............--------R-..............-...---
ENSMLUP00000020850  ....................--...........--............----------..............-...---
ENSMLUP00000001631  ....................SP...........DW............QMRSSIPVSH..............I...RAV
ENSMLUP00000007486  ....................--...........--............----------..............-...---
ENSMLUP00000008206  ....................NEs..........GS............KYYKEIPLSE..............I...LRI
ENSMLUP00000013539  ....................YTt..........DK............EPRGIIPLEN..............L...SIR
ENSMLUP00000015365  ..........krtksingslY-...........--............IFRGRINTEV..............M...EVE
ENSMLUP00000020676  ..........krtksingslY-...........--............IFRGRINTEV..............M...EVE
ENSMLUP00000006371  ....................LKg..........SE............GGSETFVYKQ..............A...FKT
ENSMLUP00000007133  ....................ASprms.......GF............IYQGKIPIAG..............M...VVT
ENSMLUP00000002508  ..................stDGh..........RY............LFRGRINTEV..............M...EVE
ENSMLUP00000001462  ....................AKdsr........EE............VVLGSIPLPS..............Y...VTS
ENSMLUP00000015489  ....................TRkv.........DG............--SYDIYTYK..............Q...SFK
ENSMLUP00000019635  ....................--...........--............----------..............-...-I-
ENSMLUP00000005155  ....................--...........--............-KHMSLKMAY..............I...SRR
ENSMLUP00000010240  ....................RRvesgegsgrypSY............SFKRSLKMDE..............Vg..ITE
ENSMLUP00000004993  ....................SEl..........EK............EPLRVIPLKE..............V...HKV
ENSMLUP00000002012  ....................--...........--............----------..............-...---
ENSMLUP00000009146  ....................ASe..........DT............VAMESMPLLG..............F...TIA
ENSMLUP00000002140  ....................EIk..........DS............SGHTKYVYKN..............K...LLT
ENSMLUP00000014437  ....................--...........--............----LVSWPL..............C...SLR
ENSMLUP00000003504  ....................YTt..........DK............EPRGIIPLEN..............L...SIR
ENSMLUP00000001212  ....................DVkaast......GV............PYHGEVPVSL..............A...RAQ
ENSMLUP00000000142  ....................RRgd.........SY............DLKDFVNLHS..............F...QVR
ENSMLUP00000011713  ....................SHq..........DN............HPLASLPLLG..............Y...SLT
ENSMLUP00000011537  ....................FTt..........DK............EPRGIIPLEN..............L...SVQ
ENSMLUP00000008290  ....................--...........--............----------..............-...---
ENSMLUP00000011975  ....................PKrdshtdtf...SY............VFRNMMKLSS..............I...DLN
ENSMLUP00000012342  ....................PKfslvgs.....KF............TVRTRVGLDG..............M...QIV
ENSMLUP00000022464  ....................EKdq.........KYvfasvd......SKRPVISLQK..............L...IVR
ENSMLUP00000006515  ....................THq..........DD............YPLASLPLLG..............Y...SVS
ENSMLUP00000002051  ....................ARl..........SI............YGIWFYDKEE..............-...---
ENSMLUP00000009895  ....................NQl..........AE............KAEGFVNLPD..............F...TVE
ENSMLUP00000003910  ....................DAknlal......GV............PYHGEEPLALrh............A...ICE
ENSMLUP00000010202  ....................CEq..........DR............EPLRTIFLKDvlkthe........C...LVK
ENSMLUP00000000726  ....................--...........--............--------VS..............C...LCL
ENSMLUP00000014255  ....................--...........KV............KPRKIFQWRQ..............L...ENL
ENSMLUP00000009304  ....................QPq..........DE............KAEGLINVSN..............Y...SLE
ENSMLUP00000000726  ....................EVk..........DS............SGRSKYLYKS..............K...LFT
ENSMLUP00000018812  ....................NS...........KL............WTQM------..............-...---
ENSMLUP00000002452  ....................NS...........KL............WTQM------..............-...---
ENSMLUP00000009837  ....................NDt..........GS............RYYKEIPLSE..............I...LSL
ENSMLUP00000015435  ....................KRdd.........TF............TYKAHIPCGN..............L...MLV
ENSMLUP00000009557  ....................TP...........SS............KKSALIKLAN..............IraaEKV
ENSMLUP00000015519  ....................DKk..........ST............IYVDKLDIID..............L...TCL
ENSMLUP00000004997  ....................--...........--............----------..............-...---
ENSMLUP00000009040  ....................PPk..........AS............RPRLSIPCST..............I...TDV
ENSMLUP00000009186  ....................EKdq.........KYifptl.......DKPSVISLQN..............L...IVR
ENSMLUP00000006019  ....................--...........--............----------..............H...---
ENSMLUP00000004311  ....................--...........--............-KPSVISLQK..............L...IAR
ENSMLUP00000006153  ....................SSk..........DQ............QPQMELPLPG..............C...SIA
ENSMLUP00000001771  ....................PRviqvga.....HF............QVRTRIDVAG..............M...KVR
ENSMLUP00000003867  ....................--...........--............----------..............-...---
ENSMLUP00000003333  ....................DEe..........DT............KPQGCMYLPG..............S...TIK
ENSMLUP00000020254  ....................HKkdeg.......KC............PPLEVIKLEG..............A...EVD
ENSMLUP00000007954  ....................EKd..........QKyvfasld.....QKSTVISLKK..............L...IVR
ENSMLUP00000014165  ....................PPk..........SS............KPKLQAACSS..............L...QEV
ENSMLUP00000015532  ....................--...........--............----------..............-...---
ENSMLUP00000006515  ....................RGvsgts......HF............RIRGLLPLRG..............M...LVE
ENSMLUP00000015042  ....................PAg..........GE............DPLGAIHLRG..............C...VVT
ENSMLUP00000000573  ....................SGe..........DT............SCKGHIDLAE..............V...EMV
ENSMLUP00000002140  ....................--...........--............----SIKMNH..............-...LVL
ENSMLUP00000009833  ....................--...........--............----------..............-...---
ENSMLUP00000014256  ....................SPs..........DVir..........KPHGHIELSAs.............C...SIL
ENSMLUP00000014449  ....................--...........--............----------..............-...---
ENSMLUP00000002296  ....................SNaq.........FK............MYKMPIFLNE..............V...LVK
ENSMLUP00000001022  ....................--...........--............---------S..............C...LGL
ENSMLUP00000015339  ....................DS...........KS............LIFDEVDLSD..............A...SVA
ENSMLUP00000012336  ....................SK...........KD............SEKAKIDIKS..............I...KEV
ENSMLUP00000022476  ....................--...........--............---GFIDVSK..............I...KCV
ENSMLUP00000014752  ....................G-...........--............----------..............-...---
ENSMLUP00000011116  ....................IViqkk.......KY............NKQHIIPLEN..............V...TID
ENSMLUP00000006182  ....................DQm..........SP............EPIRILDLTE..............C...SAV
ENSMLUP00000002497  ....................RKgd.........NY............EMKEIIDLQQ..............Y...KIA
ENSMLUP00000001331  ....................DSr..........EE............SVLGSVLLPS..............Y...SVR
ENSMLUP00000009696  ....................PRlrllgq.....KF............SVRARIDVDG..............M...ELK
ENSMLUP00000007783  ....................--...........--............-----VSLKE..............A...ICE
ENSMLUP00000013998  ....................DEyk.........PE............KSLSEDDLKN..............A...VSV
ENSMLUP00000002874  ....................PL...........DH............SLIHCQPLVH..............I...RVW
ENSMLUP00000004775  ....................--...........--............----------..............-...---
ENSMLUP00000002874  ....................--...........EE............EPLWQCPVRL..............V...TFI
ENSMLUP00000015873  ....................TA...........KS............IIFDEVDLTD..............A...SVA
ENSMLUP00000019971  ....................DSr..........EE............SVLGSVLLPS..............Y...SVR
ENSMLUP00000009770  ....................--...........--............---------L..............-...---
ENSMLUP00000008335  ....................NDs..........EE............KLKGTVEIRT..............A...KEI
ENSMLUP00000020205  ....................DVa..........SR............EPVGVIILEG..............C...TVE
ENSMLUP00000014596  ....................HRv..........DT............ECKGVIDLAE..............V...EAV
ENSMLUP00000011059  ....................--...........--............----------..............-...---
ENSMLUP00000019635  ....................NEkkwrhk.....SS............APKRSIPLES..............C...FNI
ENSMLUP00000004596  ....................NEk..........SK............QPKGTFLIKG..............Y...SVR
ENSMLUP00000004060  ....................SPs..........DIir..........KPQGQVELNSr.............C...QIV
ENSMLUP00000010430  ....................GE...........GE............VLLMAHALRR..............I...LYS
ENSMLUP00000000775  ....................PQ...........TQ............VTRLTFPLPS..............V...VLY
ENSMLUP00000006337  ....................DEk..........EE............SILGSIPLLS..............F...RVA
ENSMLUP00000010159  ....................SKaem........RH............TCRGTINLAT..............A...SIT
ENSMLUP00000004167  ....................NEk..........EK............YSKGIIPLSA..............I...STV
ENSMLUP00000001945  ....................--...........--............----------..............-...---
ENSMLUP00000014265  ....................DNef.........KE............KGVGTLHL--..............-...---
ENSMLUP00000004630  ....................GE...........GE............APQSLLTMEE..............I...QSV
ENSMLUP00000014463  ....................--...........--............----------..............-...---
ENSMLUP00000011713  ....................RGltisn......QF............KVHGQLPLYG..............M...TIE
ENSMLUP00000010988  ....................--...........--............----------..............-...---
ENSMLUP00000022232  ....................--...........--............----------..............-...---
ENSMLUP00000012079  ....................KYk..........DP............VTVVVDDLRL..............C...TVK
ENSMLUP00000015465  ....................DDe..........EK............EKKYMLPLDN..............L...KVR
ENSMLUP00000001381  ....................ARq..........NIl...........KCHKCIIISI..............S...DVE
ENSMLUP00000014433  ....................ASe..........DV............AAMESQPLLG..............F...TVT
ENSMLUP00000002430  ....................EP...........SK............KDPEKAKLDI..............S...AVK
ENSMLUP00000001136  ....................--...........--............----------..............-...---
ENSMLUP00000007700  ....................DEe..........EK............EKKYMLPLDN..............L...KIR
ENSMLUP00000002685  ....................RRgp.........EY............IYKGHIFCCN..............L...SVS
ENSMLUP00000003527  ....................--...........--............----------..............-...---
ENSMLUP00000000189  ....................NEr..........AV............TPNGEIRASE..............I...VCL
ENSMLUP00000005172  ....................--...........--............----------..............-...---
ENSMLUP00000005760  ....................EEyqpgkals...EA............ELKNAISIHH..............A...LAT
ENSMLUP00000003875  ....................SEdet........EY............GCRGSICLSK..............A...VIT
ENSMLUP00000014433  ....................PVqsg........MY............KLNNMLSLAG..............M...KVK
ENSMLUP00000010635  ....................KFk..........DN............PTVVVEDLRL..............C...TVK
ENSMLUP00000001299  tgvlcpsltpelqtvikeggS-...........CK............VLDQPIPLDR..............L...VVK
ENSMLUP00000014110  ....................--...........--............----------..............-...---
ENSMLUP00000010539  ....................--...........--............---Q------..............-...---
ENSMLUP00000011416  ....................PKprllgq.....KF............SVREKMDISD..............L...QVQ
ENSMLUP00000001779  ....................--...........--............----------..............-...---
ENSMLUP00000015042  ....................KKs..........DN............SPKGMIPLKG..............S...TLT
ENSMLUP00000005045  ....................--...........--............----------..............-...---
ENSMLUP00000004048  ....................PSke.........EN............RPVGGFSLRG..............S...LVS
ENSMLUP00000015550  ....................DEkn.........SK............EPKTSIYLDA..............C...IEV
ENSMLUP00000005543  ....................NDk..........DT............VERFVLNLST..............A...QVE
ENSMLUP00000002060  ....................ERp..........EA............PDQTLPPLNN..............F...SVA
ENSMLUP00000002846  ....................DKh..........ET............KLKGVIYFQA..............I...EEV
ENSMLUP00000015512  ....................--...........--............----------..............-...---
ENSMLUP00000008542  ....................--...........--............EVLQEWP---..............-...---
ENSMLUP00000014804  ....................DDe..........EK............EKKYMLSVDN..............L...KLR
ENSMLUP00000010863  ....................GE...........DH............SPEGESLVGQ..............M...VDE
ENSMLUP00000000163  ....................SDk..........DP............VERGIINLST..............A...QVE
ENSMLUP00000010492  ....................SEkr.........AT............KPKGLIDLSV..............C...SVY
ENSMLUP00000012859  ....................DEki.........SK............EPKGSIFLDS..............C...MGV
ENSMLUP00000011587  ....................--...........--............----------..............-...---
ENSMLUP00000018248  ....................EG...........-E............SRQNLLTMEQ..............I...MSV
ENSMLUP00000007856  ....................EG...........-E............SRQNLLTMEQ..............I...MSV
ENSMLUP00000014214  ....................G-...........--............----------..............-...---
ENSMLUP00000008400  ....................SKdkmm.......RG............SRRGCVRLRG..............A...VIG
ENSMLUP00000004048  ....................LEggr........KVn...........PPKGQILLDG..............C...TIT
ENSMLUP00000004605  ....................TQk..........NG............QWVGTVLLNA..............C...EII
ENSMLUP00000006812  ....................--...........--............----------..............-...---
ENSMLUP00000014871  ....................--...........--............----------..............-...---
ENSMLUP00000010926  ....................DSvaee.......AA............DLDGEIDLST..............C...YDV
ENSMLUP00000012190  ....................--...........--............----------..............-...---
ENSMLUP00000012996  ....................DStaee.......AD............ELDGEIDLRS..............C...TDV
ENSMLUP00000013711  ....................SNr..........DS............QHVEKIDLGA..............S...VKV
ENSMLUP00000006780  ....................RG...........AV............AGGLIQDLDN..............C...SVM
ENSMLUP00000005342  ....................--...........--............----------..............-...---
ENSMLUP00000006369  ....................NEgem........AH............TCRGTINMST..............A...HFD
ENSMLUP00000010845  ....................PGkl.........DE............DPLLSYNVDV..............C...LAV
ENSMLUP00000015600  ....................DEki.........SK............EPKGCIFLDS..............C...TGV
ENSMLUP00000010640  ....................--...........--............-H--------..............-...---
ENSMLUP00000000416  ....................NDh..........AK............KPIRIIDLNL..............C...QQV
ENSMLUP00000012342  ....................APq..........DV............RAQATIPLLG..............Y...NVD
ENSMLUP00000007987  ....................NDk..........TL............SPKGVIPLSA..............I...EMR
ENSMLUP00000012982  ....................PQrradk......AK............VIRPPFMLEK..............L...VCR
ENSMLUP00000014543  ....................NDh..........SK............KPLRIINLNF..............C...EQV
ENSMLUP00000000775  ....................RG...........DV............AGGLAMDIDN..............C...SVM
ENSMLUP00000004637  ....................EK...........KS............EPQELMQLEG..............Y...TVD
ENSMLUP00000007008  ....................EK...........KA............EPQELLQLDG..............Y...TVD
ENSMLUP00000001540  ....................STksm........MF............AHFETVDLSQ..............V...VLA
ENSMLUP00000007555  ....................YPddek.......RK............NPIGRINLAN..............C...TSR
ENSMLUP00000010202  ....................DNpqnlai.....GA............GAVGSLQLTY..............I...SKV
ENSMLUP00000009696  ....................APq..........DV............KAQRSLPLIG..............F...EVG
ENSMLUP00000000439  ....................GKskddp......DD............SPIELSKVQS..............V...KVV
ENSMLUP00000021531  ....................GKskddp......DD............SPIELSKVQS..............V...KVV
ENSMLUP00000008335  ....................SSek.........NA............LKLGTLVLNSl.............C...SVV
ENSMLUP00000003131  ....................--...........--............----------..............-...---
ENSMLUP00000002636  ....................SSk..........DR............QPHLRLALDA..............C...NVI
ENSMLUP00000012863  ....................ESkqqalpnmk..TG............HKPESVDLCG..............A...HIE
ENSMLUP00000005038  ....................NEqsr........NQ............KPRGTLQLAG..............A...VIS
ENSMLUP00000007090  ....................NKh..........SS............KPIRVIDLSE..............C...AVW
ENSMLUP00000020254  ....................SIr..........ST............QASGGLYLQG..............Y...RVN
ENSMLUP00000006780  ....................PQ...........TQ............VSRANFELTS..............V...TQF
ENSMLUP00000001391  ....................--...........--............----------..............-...---
ENSMLUP00000002099  ....................KKseesynvn...DY............SLRDQLLVES..............C...DNE
ENSMLUP00000004060  ....................SHe..........DK............RPLGHLPVQD..............A...HVE
ENSMLUP00000004167  ....................NDk..........ST............TPNGTINISD..............V...ICL
ENSMLUP00000006989  ....................SM...........IN............RPPVKLTLLT..............C...QVR
ENSMLUP00000015169  ....................--...........--............----------..............-...---
ENSMLUP00000000788  ....................NPl..........DA............FDLGQVFLGS..............R...EQG
ENSMLUP00000010633  ..................yrQPi..........PV............QELVLEDLQD..............G...DVR
ENSMLUP00000012424  ....................TN...........G-............----------..............-...---
ENSMLUP00000021545  ....................--...........--............----------..............-...---
ENSMLUP00000009146  ....................PQkdg........KY............RLKNTLAVAS..............M...KVS
ENSMLUP00000016015  ....................GDl..........EE............SPQGEVPHDS..............L...QDK
ENSMLUP00000010504  ....................PReggrflvf...DH............APFSSIRGEK..............C...EMK
ENSMLUP00000010306  ....................TYgknsldq....SS............APRCALFAED..............S...IVQ
ENSMLUP00000000456  ....................DRt..........DV............IPLLSVNMGGeq............Cg..GCR
ENSMLUP00000009152  ....................--...........--............--------A-..............-...---
ENSMLUP00000008233  ....................--...........--............----------..............-...---
ENSMLUP00000001771  ....................APq..........DI............RAHTSIPLLG..............Y...QVT
ENSMLUP00000002636  ....................DRtd.........LR............THVNAIALGG..............C...EVA
ENSMLUP00000008265  ....................AT...........AN............RQPAKLNLLT..............C...QVK
ENSMLUP00000015858  ....................QIpgd........KY............QVFDSAPRGL..............L...RVE
ENSMLUP00000007197  ....................--...........--............----------..............-...---
ENSMLUP00000010409  ....................TQgs.........STswfgsnqs....KPEFTVDLKG..............A...MIE
ENSMLUP00000006153  ....................DRtd.........LK............THLVSIPLRG..............C...EVI
ENSMLUP00000019004  ....................NDk..........ST............TPNGTINISD..............V...ICL
ENSMLUP00000014933  ....................NEd..........EQ............KCVETVELGS..............Y...EKC
ENSMLUP00000014256  ....................SQe..........DK............LPLGQIKLWE..............A...KVE
ENSMLUP00000010844  ....................NKhf.........NI............HPKGVIPLGG..............C...LVE
ENSMLUP00000006830  ....................DRnr.........SK............VAQQPLSLVG..............C...EVV
ENSMLUP00000008037  ....................--...........--............----------..............-...---
ENSMLUP00000004431  ....................TAq..........DA............NPLDSIDLAS..............A...VFD
ENSMLUP00000003867  ....................--...........--............----------..............-...---
ENSMLUP00000017606  ....................--...........--............----------..............-...---
ENSMLUP00000005123  ....................DSk..........TSaavglrqppklsTPEYTVDLKG..............A...SLA
ENSMLUP00000002234  ....................--...........--............----------..............-...---
ENSMLUP00000020202  ....................--...........--............----------..............-...---
ENSMLUP00000010185  ....................SQtdid.......RE............KLHGCIDVGL..............S...V--
ENSMLUP00000020533  ....................--...........--............----------..............-...---
ENSMLUP00000018072  ....................SRe..........AR............APLGLVVLEG..............C...TVE
ENSMLUP00000000937  ....................GPa..........GS............RPESSVDLRG..............A...ALA
ENSMLUP00000007197  ....................NKele........EG............EPVEKLNLRG..............C...EVV
ENSMLUP00000011043  ....................-Qsrll.......HA............QPIVSIRVWG..............V...VKK
ENSMLUP00000013586  ....................--...........--............----------..............-...---
ENSMLUP00000019004  ....................DLk..........SS............KHDKMFPLSS..............M...KFY
ENSMLUP00000003532  ....................--...........--............----------..............-...---
ENSMLUP00000010845  ....................RDssg........NQ............SLSATYPLSH..............F...QSV
ENSMLUP00000007054  ....................SPeda........WK............GCKGSIQMAV..............C...EIQ
ENSMLUP00000007486  ....................DEkaay.......FR............NFHKVTELHN..............Ik..NIT
ENSMLUP00000003307  ....................--...........TY............QFIASVALHR..............L...LVE
ENSMLUP00000011628  ....................SQq..........KE............TWI-------..............-...---
ENSMLUP00000007987  ....................EKk..........SS............KPEREWSLEG..............A...KVY
ENSMLUP00000002234  ....................SKeea........SG............TPAHQMNLRG..............C...EVT
ENSMLUP00000020202  ....................SKeea........SG............TPAHQMNLRG..............C...EVT
ENSMLUP00000000573  ....................--...........--............----------..............-...---
ENSMLUP00000004701  ....................SLhdym.......QN............VHGKEIDLLR..............T...TVK
ENSMLUP00000000932  ....................AVk..........KA............ERTKVIRPPLl.............V...DKI
ENSMLUP00000005322  ....................SQddv........CK............GSKGSIKMAV..............C...EIK
ENSMLUP00000002246  ....................--...........--............----------..............-...---
ENSMLUP00000012242  ....................TPeeiea......KV............EPALVVPINK..............E...TRI
ENSMLUP00000015202  ....................KHy..........KS............TPGKKVSIVG..............W...MVQ
ENSMLUP00000010100  ....................DEnaq........DE............EDRVLIR--Snvrnikigqe....Cq..DVQ
ENSMLUP00000010936  ....................KGktkt.......SR............DLACFIQFEN..............V...NIY
ENSMLUP00000014437  ....................DEk..........SV............CLRGCPKVTE..............I...SNV
ENSMLUP00000005292  ....................APldiq.......KG............KVHGSIDVGL..............S...VM-
ENSMLUP00000005842  ....................TRqdit.......KG............KLHGSIDVRL..............S...VMS
ENSMLUP00000005470  ....................PSlhdym......QN............IHGKEIDLLR..............T...TVK
ENSMLUP00000004401  ....................LNg..........YP............KPVVQITLQD..............V...CRI
ENSMLUP00000007384  ....................HRsgg........KL............GDGEVFFLRE..............C...TKR
ENSMLUP00000001364  ....................QKpg.........AK............QGPLDLTLKY..............C...VRR
ENSMLUP00000012921  ....................EK...........PQ............DVDLPYPLNN..............F...SVA
ENSMLUP00000007470  ....................KGkakv.......SR............DLVCFLQLDH..............V...NVY
ENSMLUP00000005126  ....................SGe..........ER............TCVENCSLLR..............Ce..SVG
ENSMLUP00000010417  ....................PRpplhllqsg..TF............LCRAVYPMAQ..............C...QLQ
ENSMLUP00000004167  ....................NEqdfk.......GG............FGITIIPMNV..............A...NVK
ENSMLUP00000001037  ....................--...........--............----------..............-...---
ENSMLUP00000005893  ....................KGsske.......PR............HLQLLADLDD..............C...SVF
ENSMLUP00000013677  ....................KGt..........SK............DPRHLQYLAD..............V...NES
ENSMLUP00000004578  ....................--...........--............----------..............-...---
ENSMLUP00000006842  ....................--...........--............----------..............-...---
ENSMLUP00000000788  ....................KEeag........SA............KKGNSIHIKD..............L...NAT
ENSMLUP00000008066  ....................SIndyi.......HS............THGKEMDLLR..............T...TVK
ENSMLUP00000013630  ....................RKelg........KF............AVFVHAKMAE..............L...QVK
ENSMLUP00000007116  ....................--...........-K............AALGTLYLTA..............T...HVI
ENSMLUP00000003711  ....................--...........--............----PVGDVY..............C...TRH
ENSMLUP00000011617  ....................--...........--............----------..............-...---
ENSMLUP00000010157  ....................QPedtdt......GK............EPLFTIAINK..............D...TRV
ENSMLUP00000008290  ....................DEraay.......FR............CYHKVTELNN..............Vk..NVA
ENSMLUP00000009645  ....................--...........--............----------..............-...---
ENSMLUP00000006092  ....................KGt..........SK............EPRHLQFFSEfgnsd.........I...YVS
ENSMLUP00000000518  ....................NEqsk........HQ............KPRGTLSLSG..............A...IVS
ENSMLUP00000004023  ....................TD...........EA............EPVGALLLEH..............C...RVA
ENSMLUP00000006542  ....................AKsl.........KA............TERKHFKSTSnx............W...MVM
ENSMLUP00000001230  ....................NSv..........TY............NFRQSFSLYG..............M...QVL
ENSMLUP00000010734  ....................--...........--............----------..............-...---
ENSMLUP00000003167  ....................SKynn........NF............KIKNKIKLSD..............M...WTA
ENSMLUP00000005624  ....................--...........--............----------..............V...PLR
ENSMLUP00000019375  ....................KEe..........GK............APRCLIHIKD..............L...NAT
ENSMLUP00000010926  ....................--...........--............-PQGTINMNQ..............C...TDV
ENSMLUP00000009859  ....................--...........--............----------..............-...---
ENSMLUP00000001711  ....................SSg..........GKlhll........KTGGVLSLIE..............C...TLI
ENSMLUP00000017505  ....................PEn..........RL............TPKISFPWNE..............I...RNI
ENSMLUP00000007171  ....................SSgk.........GA............RRLGSLVLTSl.............C...SVT
ENSMLUP00000003490  ....................DH...........--............HPRGSIKIDGnssvdvgisshekmR...TVQ
ENSMLUP00000007987  ....................SEs..........SP............EPLSLIQPQD..............V...VCL
ENSMLUP00000004020  ....................--...........--............----------..............-...---
ENSMLUP00000014449  ....................GPekprr......GE............AARRVIRLSD..............C...LRV
ENSMLUP00000016474  ....................--...........--............----------..............-...---
ENSMLUP00000006830  ....................SSk..........DH............SPQLDVNLLG..............S...SVV
ENSMLUP00000016017  ....................--...........QF............STHHVFPLAT..............I...WAE
ENSMLUP00000012677  ....................--...........--............---------N..............V...PLQ
ENSMLUP00000000189  ....................PEt..........SH............RPEKEWPVKS..............L...QVY
ENSMLUP00000009973  ....................KQpdaar......KI............YRQGCKHLTQ..............A...VCT
ENSMLUP00000010385  ....................--...........--............-LLPLLHSRF..............S...QYV
ENSMLUP00000007987  ....................SEqafs.......LG............IGICFIELQG..............C...SVR
ENSMLUP00000009299  ....................--...........--............----------..............-...--D
ENSMLUP00000007456  ....................PK...........SG............QRLQVLDYAHrsl...........V...QAQ
ENSMLUP00000006103  ....................--...........--............----------..............-...---
ENSMLUP00000012783  ....................DEqdke.......QS............NPSMVLDIDK..............Lf..HVR
ENSMLUP00000014471  ....................DEpgr........CN............VLRNPLYLQS..............V...KLQ
ENSMLUP00000000189  ....................--...........--............----------..............-...-SR
ENSMLUP00000012437  ....................--...........--............KHIHLMPLSQ..............I...KKV
ENSMLUP00000021530  ....................--...........--............----------..............-...---
ENSMLUP00000006501  ....................QKsgg........KG............GEDESVTLKS..............C...IRR
ENSMLUP00000003171  ....................PDn..........GA............IAFVLLVDKE..............F...RIK
ENSMLUP00000011174  ....................--...........--............----------..............-...---
ENSMLUP00000011009  ....................--...........--............----------..............-...---
ENSMLUP00000005126  ....................VKnn.........EK............MLSDSHGVET..............I...RDI
ENSMLUP00000008335  ....................--...........--............---GTLDVGL..............Id..SVC
ENSMLUP00000014049  ....................NEarea.......GQ............RPVEEFELCLpdgdvsihgavga.S...---
ENSMLUP00000013909  ....................APdprlspa....SG............ALLQALDLRDpqfsatpvla....S...DVI
ENSMLUP00000019004  ....................QT...........QE............VQEDRMNLRRlqe...........L...TIS
ENSMLUP00000004167  ....................QT...........QE............VQEDRMNLRRlqe...........L...TIS
ENSMLUP00000022232  ....................HKgps........SGggrgssrr....LDCKVIRLAE..............Cv..SVV
ENSMLUP00000018295  ....................SEt..........SH............RPEKEWPMKS..............L...KVY
ENSMLUP00000021849  ....................--...........--............----------..............-...---
ENSMLUP00000006303  ....................SQp..........SV............VVSQVIDMRDeefsvssvla....S...DVI
ENSMLUP00000015098  ....................QP...........GV............VASQVLDLRDeefsvssvla....S...DVI
ENSMLUP00000006492  ....................--...........--............----------..............-...---
ENSMLUP00000008454  ....................--...........--............----------..............-...---
ENSMLUP00000010385  ....................APpvttwd.....WT............RAEKTFSVYE..............I...MCK
ENSMLUP00000009012  ....................VVh..........EE............KKYLHVFLNE..............V...TTL
ENSMLUP00000000189  ....................PEgp.........CE............EPLQLRKLQE..............L...SVQ
ENSMLUP00000014285  ....................SEqdke.......HS............NPYMVLDIDK..............-...---
ENSMLUP00000006019  ..................saGPs..........RR............GERRVIRLAD..............C...VSV
ENSMLUP00000011245  ....................--...........--............----------..............-...---
ENSMLUP00000007987  ....................APgpg........PA............VPEDMVHLRRlqe...........I...SVV
ENSMLUP00000008335  ....................SK...........--............----------..............-...---
ENSMLUP00000000103  ....................VK...........DS............LTGKMHVLPL..............I...GGK
ENSMLUP00000020572  ....................VK...........DS............LTGKMHVLPL..............I...GGK
ENSMLUP00000009684  ....................--...........--............-------L--..............-...---
ENSMLUP00000018770  ....................IKynn........NF............KRKNKIKLSD..............R...WAA
ENSMLUP00000007942  ....................VK...........DC............QTGKMHILPL..............V...GGK
ENSMLUP00000008949  ....................SMprrkea.....WM............SPVHMHPLLS..............T...RLV
ENSMLUP00000007075  ....................--...........--............--------KE..............S...VVS
ENSMLUP00000012217  ....................--...........--............----------..............-...---
ENSMLUP00000014260  ....................LEt..........GT............ISFVQLFDPG..............F...GVQ
ENSMLUP00000021545  ....................SQ...........DE............APGDPIQ---..............-...---
ENSMLUP00000013488  ....................--...........--............----------..............-...---
ENSMLUP00000000189  ....................NLeef........SV............SVSVTGPAHSpss...........L...SSA
ENSMLUP00000005075  ....................--...........--............----------..............-...---
ENSMLUP00000014442  ....................TSt..........SA............SPQGAFSLSG..............Y...NRG


                      60                                                                            
                       |                                                                            
d2elba2               AV.............D.......CE.DR....R.............................................
ENSMLUP00000006551  RG.............T.......TT.TR....S.............................................
ENSMLUP00000010306  --.............-.......--.--....-.............................................
ENSMLUP00000002181  --.............-.......--.-R....-.............................................
ENSMLUP00000007103  --.............-.......--.--....-.............................................
ENSMLUP00000015991  --.............-.......--.--....-.............................................
ENSMLUP00000011751  --.............-.......--.--....-.............................................
ENSMLUP00000006051  --.............-.......--.--....-.............................................
ENSMLUP00000006484  TV.............T.......DS.SR....Y.............................................
ENSMLUP00000022507  --.............-.......--.--....-.............................................
ENSMLUP00000014236  --.............-.......--.--....-.............................................
ENSMLUP00000006854  --.............-.......--.--....-.............................................
ENSMLUP00000003954  ET.............V.......VP.EK....Nppperqippfsfrrgeesgemeqisiierfp..............
ENSMLUP00000009991  --.............-.......--.--....-.............................................
ENSMLUP00000007057  AD.............Dk......TD.KR....I.............................................
ENSMLUP00000019012  --.............-.......--.--....-.............................................
ENSMLUP00000005088  --.............-.......--.--....-.............................................
ENSMLUP00000009827  --.............-.......--.--....-.............................................
ENSMLUP00000007432  EKlee..........E.......SF.KM....K.............................................
ENSMLUP00000014622  --.............-.......--.--....-.............................................
ENSMLUP00000004098  --.............-.......--.--....-.............................................
ENSMLUP00000014409  EIvks..........Disi....PC.HY....K.............................................
ENSMLUP00000004165  EA.............K.......NF.K-....-.............................................
ENSMLUP00000005117  DLe............Dgrdkdw.NL.SV....K.............................................
ENSMLUP00000011092  --.............-.......--.--....-.............................................
ENSMLUP00000001759  SF.............N.......DK.K-....-.............................................
ENSMLUP00000005088  --.............-.......--.--....-.............................................
ENSMLUP00000005088  --.............-.......--.--....-.............................................
ENSMLUP00000014421  --.............-.......--.--....-.............................................
ENSMLUP00000007415  SF.............N.......DK.K-....-.............................................
ENSMLUP00000000876  --.............-.......--.--....-.............................................
ENSMLUP00000012407  --.............-.......--.--....-.............................................
ENSMLUP00000010866  SF.............N.......DK.K-....-.............................................
ENSMLUP00000015289  --.............-.......--.--....-.............................................
ENSMLUP00000014093  --.............-.......--.-F....-.............................................
ENSMLUP00000005088  --.............-.......--.--....-.............................................
ENSMLUP00000016145  EKvnleeq.......T.......PV.ER....Q.............................................
ENSMLUP00000000362  --.............P.......--.--....-.............................................
ENSMLUP00000004624  --.............-.......--.--....-.............................................
ENSMLUP00000004420  FL.............-.......--.--....-.............................................
ENSMLUP00000007170  EKled..........S.......SF.NK....K.............................................
ENSMLUP00000007524  KFakip.........K.......SQ.KL....R.............................................
ENSMLUP00000011865  ST.............D.......PQ.DR....R.............................................
ENSMLUP00000009407  SY.............S.......DK.E-....-.............................................
ENSMLUP00000017210  SY.............S.......DK.E-....-.............................................
ENSMLUP00000001866  DIedgr.........Dddf....NV.SM....K.............................................
ENSMLUP00000007867  EVlp...........D.......RE.GK....R.............................................
ENSMLUP00000011713  --.............-.......--.--....-.............................................
ENSMLUP00000009897  --.............-.......--.--....-.............................................
ENSMLUP00000009921  RVekigaq.......S.......HG.DN....S.............................................
ENSMLUP00000000027  SV.............T.......DS.SR....Y.............................................
ENSMLUP00000019003  SV.............T.......DS.SR....Y.............................................
ENSMLUP00000006515  --.............-.......--.--....-.............................................
ENSMLUP00000010025  SV.............-.......AT.DK....R.............................................
ENSMLUP00000003276  --.............-.......--.--....-.............................................
ENSMLUP00000012185  --.............-.......--.--....-.............................................
ENSMLUP00000009828  --.............-.......--.--....-.............................................
ENSMLUP00000000547  LP.............D.......KD.GK....K.............................................
ENSMLUP00000006939  --.............-.......--.--....-.............................................
ENSMLUP00000013213  --.............-.......--.--....-.............................................
ENSMLUP00000010899  --.............-.......--.--....-.............................................
ENSMLUP00000014701  --.............-.......--.--....-.............................................
ENSMLUP00000001355  --.............-.......--.--....-.............................................
ENSMLUP00000004002  DAvl...........N.......SC.SY....N.............................................
ENSMLUP00000003010  QV.............A.......TD.NK....A.............................................
ENSMLUP00000014344  DKd............D.......TN.EY....K.............................................
ENSMLUP00000011779  EV.............A.......TD.HK....A.............................................
ENSMLUP00000004968  --.............-.......--.--....-.............................................
ENSMLUP00000006705  RTtmpl.........E.......MP.EK....D.............................................
ENSMLUP00000013438  --.............-.......--.--....-.............................................
ENSMLUP00000013178  --.............-.......--.--....-.............................................
ENSMLUP00000017586  --.............-.......--.--....-.............................................
ENSMLUP00000000009  --.............-.......EQ.EH....T.............................................
ENSMLUP00000009616  -Gite..........N.......VK.GD....V.............................................
ENSMLUP00000001998  --.............-.......--.--....-.............................................
ENSMLUP00000012742  --.............-.......--.--....-.............................................
ENSMLUP00000000119  WR.............D.......QR.NH....E.............................................
ENSMLUP00000003793  RA.............S.......EC.RK....K.............................................
ENSMLUP00000003076  DKe............D.......TS.EY....R.............................................
ENSMLUP00000013179  MN.............Ntlrk...DA.KK....D.............................................
ENSMLUP00000012676  --.............-.......--.--....-.............................................
ENSMLUP00000013417  --.............-.......--.--....-.............................................
ENSMLUP00000010021  QYsns..........E.......DK.DR....K.............................................
ENSMLUP00000005492  EV.............A.......NE.EK....A.............................................
ENSMLUP00000017245  RNlsmp.........D.......LE.NR....-.............................................
ENSMLUP00000005975  RNlsmp.........D.......LE.NR....-.............................................
ENSMLUP00000013604  --.............-.......--.--....-.............................................
ENSMLUP00000013658  EV.............A.......NE.EK....A.............................................
ENSMLUP00000014884  --.............-.......--.--....-.............................................
ENSMLUP00000015073  --.............D.......NP.QK....S.............................................
ENSMLUP00000011388  --.............-.......--.--....-.............................................
ENSMLUP00000004364  --.............-.......--.--....-.............................................
ENSMLUP00000009774  LS.............-.......--.--....-.............................................
ENSMLUP00000008949  RSmala.........D.......PE.NR....Q.............................................
ENSMLUP00000013558  --.............-.......--.--....-.............................................
ENSMLUP00000013327  --.............-.......--.ET....Q.............................................
ENSMLUP00000013892  KLe............D.......SE.NH....R.............................................
ENSMLUP00000011043  AV.............G.......RD.VH....T.............................................
ENSMLUP00000004420  GVg............R.......DN.GR....D.............................................
ENSMLUP00000001083  ADlglte........C.......CG.DS....N.............................................
ENSMLUP00000006407  --.............-.......--.--....-.............................................
ENSMLUP00000020850  --.............-.......--.--....-.............................................
ENSMLUP00000001631  ERvde..........G.......AF.QL....P.............................................
ENSMLUP00000007486  --.............-.......--.--....-.............................................
ENSMLUP00000008206  SS.............PqdftnisQG.SN....P.............................................
ENSMLUP00000013539  EV.............E.......DS.KK....P.............................................
ENSMLUP00000015365  NV.............-.......--.--....Edgtadyhshgytvt...............................
ENSMLUP00000020676  NV.............-.......--.--....Edgtadyhshgytvt...............................
ENSMLUP00000006371  ADmglte........N.......IG.DS....G.............................................
ENSMLUP00000007133  RL.............De......IE.GN....D.............................................
ENSMLUP00000002508  NV.............D.......DG.TA....Dfhssghivv....................................
ENSMLUP00000001462  PVgpe..........D.......RI.SR....K.............................................
ENSMLUP00000015489  MAeiglte.......T.......VG.DS....G.............................................
ENSMLUP00000019635  --.............-.......--.--....-.............................................
ENSMLUP00000005155  CT.............P.......SD.PE....P.............................................
ENSMLUP00000010240  YV.............K.......GD.NR....K.............................................
ENSMLUP00000004993  QEckqs.........D.......IM.MR....D.............................................
ENSMLUP00000002012  -K.............-.......--.--....-.............................................
ENSMLUP00000009146  PEkee..........G.......SS.EV....G.............................................
ENSMLUP00000002140  SElgvte........H.......VE.GD....P.............................................
ENSMLUP00000014437  RY.............G.......RD.TT....R.............................................
ENSMLUP00000003504  EV.............E.......DP.RK....P.............................................
ENSMLUP00000001212  GSvaf..........D.......YR.KR....K.............................................
ENSMLUP00000000142  DDssger........D.......NK.KW....T.............................................
ENSMLUP00000011713  IPses..........E.......DI.HK....D.............................................
ENSMLUP00000011537  KV.............D.......DP.KK....P.............................................
ENSMLUP00000008290  --.............-.......--.--....-.............................................
ENSMLUP00000011975  EQ.............-.......VE.GD....D.............................................
ENSMLUP00000012342  ET.............H.......NE.EY....P.............................................
ENSMLUP00000022464  EV.............A.......NE.EK....A.............................................
ENSMLUP00000006515  IPrea..........D.......GI.HK....E.............................................
ENSMLUP00000002051  --.............-.......--.--....-.............................................
ENSMLUP00000009895  KA.............S.......EC.RK....K.............................................
ENSMLUP00000003910  IAa............N.......YK.KK....K.............................................
ENSMLUP00000010202  SG.............D.......LL.MR....D.............................................
ENSMLUP00000000726  EE.............S.......VE.ND....P.............................................
ENSMLUP00000014255  YF.............-.......--.--....-.............................................
ENSMLUP00000009304  SG.............H.......DQ.KK....K.............................................
ENSMLUP00000000726  SElgvte........H.......VE.GD....P.............................................
ENSMLUP00000018812  --.............-.......--.--....-.............................................
ENSMLUP00000002452  --.............-.......--.--....-.............................................
ENSMLUP00000009837  EPakpsali......P.......NG.AN....P.............................................
ENSMLUP00000015435  EV.............-.......IP.KE....P.............................................
ENSMLUP00000009557  EE.............K.......SF.GS....S.............................................
ENSMLUP00000015519  NEqn...........S.......TD.KN....C.............................................
ENSMLUP00000004997  --.............-.......--.--....-.............................................
ENSMLUP00000009040  RAttal.........E.......MP.DR....E.............................................
ENSMLUP00000009186  DI.............A.......NQ.EK....G.............................................
ENSMLUP00000006019  --.............-.......--.--....-.............................................
ENSMLUP00000004311  EV.............A.......NE.ER....G.............................................
ENSMLUP00000006153  YVpk...........D.......GK.KK....Q.............................................
ENSMLUP00000001771  EL.............T.......DA.EF....P.............................................
ENSMLUP00000003867  --.............-.......--.--....-.............................................
ENSMLUP00000003333  EIatn..........P.......EE.AG....K.............................................
ENSMLUP00000020254  ID.............S.......SL.GK....P.............................................
ENSMLUP00000007954  EV.............A.......HEeKG....L.............................................
ENSMLUP00000014165  RRctrl.........E.......MP.DN....L.............................................
ENSMLUP00000015532  --.............-.......--.--....-.............................................
ENSMLUP00000006515  ESk............S.......EW.SV....P.............................................
ENSMLUP00000015042  SVesnp.........Dak.....KS.EE....E.............................................
ENSMLUP00000000573  LPagpsmgap.....K.......HT.SD....K.............................................
ENSMLUP00000002140  EE.............D.......VD.RD....P.............................................
ENSMLUP00000009833  --.............-.......-E.--....-.............................................
ENSMLUP00000014256  RG.............D.......NK.Q-....-.............................................
ENSMLUP00000014449  --.............-.......--.--....-.............................................
ENSMLUP00000002296  LPt............D.......PS.SE....E.............................................
ENSMLUP00000001022  EG.............N.......LQ.GD....P.............................................
ENSMLUP00000015339  EA.............S.......TK.NA....N.............................................
ENSMLUP00000012336  RTgkntdifrsngisD.......QI.SE....D.............................................
ENSMLUP00000022476  EVvkn..........Ddgvi...PC.QN....K.............................................
ENSMLUP00000014752  --.............-.......--.--....-.............................................
ENSMLUP00000011116  SIk............D.......EG.DL....R.............................................
ENSMLUP00000006182  QF.............Dy......SQ.ER....V.............................................
ENSMLUP00000002497  NNpttdk........E.......NK.KW....S.............................................
ENSMLUP00000001331  PDgpg..........A.......PR.GR....R.............................................
ENSMLUP00000009696  ES.............S.......NL.NL....P.............................................
ENSMLUP00000007783  VAl............D.......YK.KK....K.............................................
ENSMLUP00000013998  HHalaskat......D.......YE.KK....P.............................................
ENSMLUP00000002874  GV.............G.......SS.KG....R.............................................
ENSMLUP00000004775  --.............-.......--.--....-.............................................
ENSMLUP00000002874  GV.............G.......RD.--....P.............................................
ENSMLUP00000015873  ES.............S.......TK.NV....N.............................................
ENSMLUP00000019971  PDgpg..........A.......PR.GR....R.............................................
ENSMLUP00000009770  --.............-.......--.--....-.............................................
ENSMLUP00000008335  ID.............N.......TS.-K....E.............................................
ENSMLUP00000020205  LV.............E.......AA.E-....E.............................................
ENSMLUP00000014596  VPgtptmgap.....K.......TV.DE....K.............................................
ENSMLUP00000011059  --.............-.......--.--....-.............................................
ENSMLUP00000019635  NKr............A.......DS.KN....K.............................................
ENSMLUP00000004596  MA.............Phlrk...DS.KK....E.............................................
ENSMLUP00000004060  RE.............E.......GA.Q-....-.............................................
ENSMLUP00000010430  TW.............C.......PD.DC....Q.............................................
ENSMLUP00000000775  ATh............Q.......EN.KR....L.............................................
ENSMLUP00000006337  AVqpapg........D.......GR.GV....Q.............................................
ENSMLUP00000010159  VE.............D.......SC.N-....-.............................................
ENSMLUP00000004167  RV.............Q.......GD.NK....-.............................................
ENSMLUP00000001945  --.............-.......--.--....-.............................................
ENSMLUP00000014265  --.............-.......--.--....-.............................................
ENSMLUP00000004630  EE.............T.......QI.KE....R.............................................
ENSMLUP00000014463  --.............-.......--.--....-.............................................
ENSMLUP00000011713  KSe............D.......EW.GV....P.............................................
ENSMLUP00000010988  --.............-.......--.--....N.............................................
ENSMLUP00000022232  --.............-.......--.--....-.............................................
ENSMLUP00000012079  LC.............P.......DS.ER....R.............................................
ENSMLUP00000015465  DV.............Eks.....FM.SS....K.............................................
ENSMLUP00000001381  TVrnghesevlrslaE.......EF.PL....E.............................................
ENSMLUP00000014433  EVk............D.......EN.SE....S.............................................
ENSMLUP00000002430  EIrlgk.........N.......--.--....Tetfrnngladqiced..............................
ENSMLUP00000001136  --.............-.......--.--....S.............................................
ENSMLUP00000007700  DV.............Ekg.....FM.SN....K.............................................
ENSMLUP00000002685  ES.............P.......RD.PL....G.............................................
ENSMLUP00000003527  --.............-.......--.--....-.............................................
ENSMLUP00000000189  AVspp..........D.......TH.GF....E.............................................
ENSMLUP00000005172  --.............-.......--.--....-.............................................
ENSMLUP00000005760  RAr............D.......YS.KR....P.............................................
ENSMLUP00000003875  PH.............D.......FD.EC....R.............................................
ENSMLUP00000014433  KP.............T.......QE.AY....Q.............................................
ENSMLUP00000010635  HC.............E.......DI.ER....R.............................................
ENSMLUP00000001299  SI.............Dplhvs..VF.GL....R.............................................
ENSMLUP00000014110  --.............-.......--.--....-.............................................
ENSMLUP00000010539  --.............-.......--.--....-.............................................
ENSMLUP00000011416  DT.............S.......KP.PA....A.............................................
ENSMLUP00000001779  --.............-.......--.--....-.............................................
ENSMLUP00000015042  SPcq...........D.......FG.KR....M.............................................
ENSMLUP00000005045  --.............G.......NF.DP....S.............................................
ENSMLUP00000004048  AL.............E.......DN.GV....Ptgvkgnvqg....................................
ENSMLUP00000015550  VQ.............C.......PK.MR....R.............................................
ENSMLUP00000005543  YS.............Edqqa...ML.KT....P.............................................
ENSMLUP00000002060  ECqlmk.........T.......ER.PR....P.............................................
ENSMLUP00000002846  YY.............DhlknankSP.NP....L.............................................
ENSMLUP00000015512  --.............-.......GS.N-....-.............................................
ENSMLUP00000008542  --.............-.......--.--....-.............................................
ENSMLUP00000014804  DV.............Ekg.....FM.SS....K.............................................
ENSMLUP00000010863  PVgvhhslatpat..H.......YT.KK....P.............................................
ENSMLUP00000000163  YS.............Edqqa...MV.KS....P.............................................
ENSMLUP00000010492  VVhd...........S.......LF.DR....P.............................................
ENSMLUP00000012859  VQ.............N.......NK.VR....R.............................................
ENSMLUP00000011587  --.............-.......--.--....-.............................................
ENSMLUP00000018248  EE.............T.......QF.KD....K.............................................
ENSMLUP00000007856  EE.............T.......QF.KD....K.............................................
ENSMLUP00000014214  --.............-.......--.--....-.............................................
ENSMLUP00000008400  ID.............D.......ED.DS....T.............................................
ENSMLUP00000004048  CPcl...........E.......YE.NR....P.............................................
ENSMLUP00000004605  ER.............P.......SK.KD....G.............................................
ENSMLUP00000006812  --.............-.......--.LR....R.............................................
ENSMLUP00000014871  --.............S.......HN.KS....F.............................................
ENSMLUP00000010926  TE.............Y.......PV.QR....N.............................................
ENSMLUP00000012190  -V.............-.......--.--....-.............................................
ENSMLUP00000012996  TE.............Y.......AV.QR....N.............................................
ENSMLUP00000013711  TDeapcg........S.......SH.DP....G.............................................
ENSMLUP00000006780  AV.............D.......CE.DR....R.............................................
ENSMLUP00000005342  --.............-.......--.--....-.............................................
ENSMLUP00000006369  RE.............D.......YC.S-....-.............................................
ENSMLUP00000010845  QI.............Dn......LD.DC....D.............................................
ENSMLUP00000015600  VQ.............N.......NR.LR....K.............................................
ENSMLUP00000010640  --.............-.......--.--....-.............................................
ENSMLUP00000000416  DAgltfnk.......K.......EF.EN....S.............................................
ENSMLUP00000012342  DM.............Pr......SA.DL....P.............................................
ENSMLUP00000007987  SS.............K.......DN.K-....-.............................................
ENSMLUP00000012982  PL.............R.......DP.--....N.............................................
ENSMLUP00000014543  DAgltfnk.......K.......EL.QD....S.............................................
ENSMLUP00000000775  AV.............D.......CE.DR....R.............................................
ENSMLUP00000004637  YT.............Dphpg...LQ.GG....R.............................................
ENSMLUP00000007008  YT.............Dpqpg...LE.GG....R.............................................
ENSMLUP00000001540  ET.............S.......CR.NL....C.............................................
ENSMLUP00000007555  QIepanr........E.......FC.AR....R.............................................
ENSMLUP00000010202  SIatpk.........Q.......KP.KT....P.............................................
ENSMLUP00000009696  PPeag..........E.......RP.DR....R.............................................
ENSMLUP00000000439  ARkr...........R.......DR.SL....P.............................................
ENSMLUP00000021531  ARkr...........R.......DR.SL....P.............................................
ENSMLUP00000008335  PP.............Dek.....VF.KE....T.............................................
ENSMLUP00000003131  --.............-.......--.--....-.............................................
ENSMLUP00000002636  YV.............P.......KD.SR....H.............................................
ENSMLUP00000012863  WTk............E.......KS.SR....K.............................................
ENSMLUP00000005038  PS.............D.......ED.S-....-.............................................
ENSMLUP00000007090  KHagpgfvr......K.......EF.QN....N.............................................
ENSMLUP00000020254  EQ.............T.......LS.FK....Q.............................................
ENSMLUP00000006780  AAh............Q.......EN.KR....L.............................................
ENSMLUP00000001391  --.............-.......--.--....-.............................................
ENSMLUP00000002099  EL.............-.......--.--....Tsspgknsstmlysrqnsas..........................
ENSMLUP00000004060  EV.............Dr......SC.DS....Dedyeaggtgrllssh..............................
ENSMLUP00000004167  AV.............Hkedfyi.NT.GP....I.............................................
ENSMLUP00000006989  PN.............P.......EE.KK....-.............................................
ENSMLUP00000015169  --.............-.......-S.--....-.............................................
ENSMLUP00000000788  YEvseglpknv....Q.......GN.RW....K.............................................
ENSMLUP00000010633  MGgsfrgafs.....N.......SD.KA....K.............................................
ENSMLUP00000012424  --.............-.......--.--....-.............................................
ENSMLUP00000021545  --.............-.......--.--....-.............................................
ENSMLUP00000009146  RP.............V.......ME.KV....P.............................................
ENSMLUP00000016015  LPva...........D.......-I.KA....Vvtgkdcphmkekgalkqnkevle......................
ENSMLUP00000010504  LHg............P.......HK.NL....F.............................................
ENSMLUP00000010306  AVp............E.......HP.KK....E.............................................
ENSMLUP00000000456  RS.............N.......TT.DR....P.............................................
ENSMLUP00000009152  --.............-.......--.--....-.............................................
ENSMLUP00000008233  -S.............N.......NE.RI....K.............................................
ENSMLUP00000001771  TG.............P.......QG.D-....P.............................................
ENSMLUP00000002636  PG.............F.......GP.RH....P.............................................
ENSMLUP00000008265  PN.............A.......ED.KK....S.............................................
ENSMLUP00000015858  EL.............Edq.....GQ.TL....A.............................................
ENSMLUP00000007197  --.............-.......--.--....-.............................................
ENSMLUP00000010409  MAsk...........D.......KS.SK....K.............................................
ENSMLUP00000006153  PG.............L.......DS.RH....P.............................................
ENSMLUP00000019004  AV.............Hkedfyi.NT.GP....I.............................................
ENSMLUP00000014933  QDlr...........A.......LL.KR....K.............................................
ENSMLUP00000014256  EV.............Dr......SC.DS....Dedyeasgrsllsth...............................
ENSMLUP00000010844  AK.............E.......EP.SM....P.............................................
ENSMLUP00000006830  PD.............P.......SP.DH....L.............................................
ENSMLUP00000008037  --.............-.......--.--....Keksalkqnkevle................................
ENSMLUP00000004431  CKa............D.......AE.--....E.............................................
ENSMLUP00000003867  --.............-.......--.--....-.............................................
ENSMLUP00000017606  --.............-.......--.--....-.............................................
ENSMLUP00000005123  WApk...........D.......KS.SK....K.............................................
ENSMLUP00000002234  --.............-.......--.--....-.............................................
ENSMLUP00000020202  --.............-.......--.--....-.............................................
ENSMLUP00000010185  -M.............S.......VK.KS....S.............................................
ENSMLUP00000020533  --.............-.......--.--....-.............................................
ENSMLUP00000018072  LA.............Ea......PV.PE....E.............................................
ENSMLUP00000000937  HGr............H.......LS.SR....R.............................................
ENSMLUP00000007197  PDv............N.......VA.GR....K.............................................
ENSMLUP00000011043  TV.............E.......DR.DF....A.............................................
ENSMLUP00000013586  --.............-.......-Q.KE....D.............................................
ENSMLUP00000019004  LGvr...........K.......RV.KP....P.............................................
ENSMLUP00000003532  --.............-.......--.--....-.............................................
ENSMLUP00000010845  SVl............G.......NL.EA....R.............................................
ENSMLUP00000007054  VH.............S.......VD.NT....R.............................................
ENSMLUP00000007486  RL.............P.......RE.TK....K.............................................
ENSMLUP00000003307  DIp............D.......SK.YI....K.............................................
ENSMLUP00000011628  --.............-.......--.--....-.............................................
ENSMLUP00000007987  LGirkk.........L.......KP.PT....P.............................................
ENSMLUP00000002234  PDvni..........S.......GQ.KF....N.............................................
ENSMLUP00000020202  PDvni..........S.......GQ.KF....N.............................................
ENSMLUP00000000573  --.............-.......--.--....-.............................................
ENSMLUP00000004701  VP.............G.......KR.PP....Ratsacapisspktnglskdmsslhispnsgnvtsasgsqmasgis
ENSMLUP00000000932  VC.............R.......EL.RD....P.............................................
ENSMLUP00000005322  VH.............S.......AD.NT....R.............................................
ENSMLUP00000002246  --.............-.......--.--....-.............................................
ENSMLUP00000012242  RAme...........N.......TK.KR....V.............................................
ENSMLUP00000015202  LP.............D.......DP.EH....P.............................................
ENSMLUP00000010100  PP.............E.......GR.SR....D.............................................
ENSMLUP00000010936  YGiqckmk.......Y.......KA.PT....D.............................................
ENSMLUP00000014437  KCvtrlp........K.......ET.KR....Q.............................................
ENSMLUP00000005292  --.............S.......IK.KK....A.............................................
ENSMLUP00000005842  IN.............K.......KA.QR....-.............................................
ENSMLUP00000005470  VP.............Gk......RL.P-....Ratpatapgtspranglaldrsntqlgggtgevaagngskgaphsa
ENSMLUP00000004401  YKr............R.......HG.LM....P.............................................
ENSMLUP00000007384  HT.............D.......SI.DR....R.............................................
ENSMLUP00000001364  KT.............E.......SI.DK....R.............................................
ENSMLUP00000012921  KCqlmk.........T.......ER.PK....P.............................................
ENSMLUP00000007470  YGq............Dyrnky..KA.PT....D.............................................
ENSMLUP00000005126  PA.............H.......SD.GR....-.............................................
ENSMLUP00000010417  RVfgh..........S.......GG.PC....G.............................................
ENSMLUP00000004167  QV.............D.......RT.M-....K.............................................
ENSMLUP00000001037  --.............-.......--.--....Gslkqnkdlce...................................
ENSMLUP00000005893  SVisgkkq.......Y.......HT.PT....E.............................................
ENSMLUP00000013677  NAyvvtqgrkl....Y.......GM.PT....D.............................................
ENSMLUP00000004578  --.............-.......--.--....-.............................................
ENSMLUP00000006842  --.............-.......--.--....-.............................................
ENSMLUP00000000788  FQt............E.......KI.GN....P.............................................
ENSMLUP00000008066  VP.............G.......KR.PP....Raisafgpsasinglvkdmstvqmgegpeattptpssspspsslqp
ENSMLUP00000013630  DLslkpq........G.......IP.GH....V.............................................
ENSMLUP00000007116  FV.............En......AP.D-....-.............................................
ENSMLUP00000003711  CL.............S.......NI.SD....P.............................................
ENSMLUP00000011617  --.............-.......Q-.--....-.............................................
ENSMLUP00000010157  QAgeld.........Q.......TT.GR....P.............................................
ENSMLUP00000008290  RL.............P.......KS.TK....K.............................................
ENSMLUP00000009645  --.............-.......--.-R....-.............................................
ENSMLUP00000006092  LA.............G.......KK.KHgapaNyg...........................................
ENSMLUP00000000518  LS.............D.......EA.--....P.............................................
ENSMLUP00000004023  QE.............E.......PS.G-....-.............................................
ENSMLUP00000006542  MA.............D.......DP.DH....P.............................................
ENSMLUP00000001230  LF.............E.......SQ.YY....P.............................................
ENSMLUP00000010734  --.............-.......--.--....-.............................................
ENSMLUP00000003167  SCvdevge.......G.......NT.DA....M.............................................
ENSMLUP00000005624  MI.............D.......SV.ES....R.............................................
ENSMLUP00000019375  FQt............E.......KI.GN....P.............................................
ENSMLUP00000010926  VDge...........G.......RT.GQ....K.............................................
ENSMLUP00000009859  --.............-.......--.--....-.............................................
ENSMLUP00000001711  EEsdas.........D.......DD.S-....Kgsgqvfghld...................................
ENSMLUP00000017505  IS.............-.......--.--....-.............................................
ENSMLUP00000007171  GP.............E.......RR.PK....E.............................................
ENSMLUP00000003490  KM.............F.......KC.HP....D.............................................
ENSMLUP00000007987  GVsppptdsg.....D.......LD.RF....P.............................................
ENSMLUP00000004020  --.............-.......--.--....-.............................................
ENSMLUP00000014449  AEasgea........S.......SP.RD....T.............................................
ENSMLUP00000016474  --.............-.......--.--....-.............................................
ENSMLUP00000006830  HK.............Ekq.....VR.KK....E.............................................
ENSMLUP00000016017  PLs............E.......EA.GG....V.............................................
ENSMLUP00000012677  LI.............E.......SV.EC....R.............................................
ENSMLUP00000000189  LG.............V.......KK.KL....Rpptc.........................................
ENSMLUP00000009973  VK.............P.......GD.--....S.............................................
ENSMLUP00000010385  PG.............T.......DL.SR....Q.............................................
ENSMLUP00000007987  ET.............K.......SR.S-....-.............................................
ENSMLUP00000009299  PA.............F.......RP.DQ....S.............................................
ENSMLUP00000007456  QV.............P.......DP.SG....P.............................................
ENSMLUP00000006103  --.............-.......--.--....-.............................................
ENSMLUP00000012783  PVtqgdvyra.....E.......TE.EI....P.............................................
ENSMLUP00000014471  EG.............P.......SE.DL....K.............................................
ENSMLUP00000000189  VA.............A.......IE.DQ....K.............................................
ENSMLUP00000012437  LDiret.........E.......DC.HN....A.............................................
ENSMLUP00000021530  --.............-.......--.--....-.............................................
ENSMLUP00000006501  KT.............D.......SI.EK....R.............................................
ENSMLUP00000003171  VGk............K.......ET.DT....K.............................................
ENSMLUP00000011174  --.............-.......--.GQ....D.............................................
ENSMLUP00000011009  --.............-.......--.GQ....E.............................................
ENSMLUP00000005126  LP.............Dt......SL.GG....P.............................................
ENSMLUP00000008335  AS.............D.......SP.DR....P.............................................
ENSMLUP00000014049  -Elant.........A.......KA.DV....P.............................................
ENSMLUP00000013909  HA.............Q.......SK.DL....P.............................................
ENSMLUP00000019004  TM.............V.......QN.GE....K.............................................
ENSMLUP00000004167  TM.............V.......QN.GE....K.............................................
ENSMLUP00000022232  PVales.........P.......PE.PG....A.............................................
ENSMLUP00000018295  LG.............V.......KK.KL....Rppic.........................................
ENSMLUP00000021849  --.............S.......LL.DE....P.............................................
ENSMLUP00000006303  HA.............S.......RK.DI....P.............................................
ENSMLUP00000015098  HA.............S.......RR.DI....P.............................................
ENSMLUP00000006492  --.............S.......IL.GQ....D.............................................
ENSMLUP00000008454  --.............-.......--.--....-.............................................
ENSMLUP00000010385  ILk............Dsdl....LD.QR....R.............................................
ENSMLUP00000009012  VP.............V.......LN.ED....K.............................................
ENSMLUP00000000189  GD.............S.......EN.--....-.............................................
ENSMLUP00000014285  --.............-.......--.--....-.............................................
ENSMLUP00000006019  LPadg..........Es......CP.RD....T.............................................
ENSMLUP00000011245  --.............-.......--.--....-.............................................
ENSMLUP00000007987  SAa............D.......TP.DK....K.............................................
ENSMLUP00000008335  --.............-.......--.--....-.............................................
ENSMLUP00000000103  VE.............E.......VK.KH....Q.............................................
ENSMLUP00000020572  VE.............E.......VK.KH....Q.............................................
ENSMLUP00000009684  --.............-.......--.--....-.............................................
ENSMLUP00000018770  SCvgevg........Dg......ST.DA....M.............................................
ENSMLUP00000007942  VE.............E.......VK.RR....Q.............................................
ENSMLUP00000008949  HSgpgkgs.......P.......QA.GV....D.............................................
ENSMLUP00000007075  IN.............K.......QD.NK....K.............................................
ENSMLUP00000012217  --.............-.......-C.PT....Q.............................................
ENSMLUP00000014260  VGk............R.......ST.ET....R.............................................
ENSMLUP00000021545  --.............-.......--.--....-.............................................
ENSMLUP00000013488  --.............-.......--.--....-.............................................
ENSMLUP00000000189  LT.............P.......RV.ST....N.............................................
ENSMLUP00000005075  --.............-.......--.--....-.............................................
ENSMLUP00000014442  VPvccwpc.......T.......HN.PA....P.............................................


                                                                                                    
                                                                                                    
d2elba2               ..............................................................................
ENSMLUP00000006551  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000002181  ..............................................................................
ENSMLUP00000007103  ..............................................................................
ENSMLUP00000015991  ..............................................................................
ENSMLUP00000011751  ..............................................................................
ENSMLUP00000006051  ..............................................................................
ENSMLUP00000006484  ..............................................................................
ENSMLUP00000022507  ..............................................................................
ENSMLUP00000014236  ..............................................................................
ENSMLUP00000006854  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000009991  ..............................................................................
ENSMLUP00000007057  ..............................................................................
ENSMLUP00000019012  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000009827  ..............................................................................
ENSMLUP00000007432  ..............................................................................
ENSMLUP00000014622  ..............................................................................
ENSMLUP00000004098  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000004165  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000011092  ..............................................................................
ENSMLUP00000001759  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000007415  ..............................................................................
ENSMLUP00000000876  ..............................................................................
ENSMLUP00000012407  ..............................................................................
ENSMLUP00000010866  ..............................................................................
ENSMLUP00000015289  ..............................................................................
ENSMLUP00000014093  ..............................................................................
ENSMLUP00000005088  ..............................................................................
ENSMLUP00000016145  ..............................................................................
ENSMLUP00000000362  ..............................................................................
ENSMLUP00000004624  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000007170  ..............................................................................
ENSMLUP00000007524  ..............................................................................
ENSMLUP00000011865  ..............................................................................
ENSMLUP00000009407  ..............................................................................
ENSMLUP00000017210  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000007867  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000009897  ..............................................................................
ENSMLUP00000009921  ..............................................................................
ENSMLUP00000000027  ..............................................................................
ENSMLUP00000019003  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000010025  ..............................................................................
ENSMLUP00000003276  ..............................................................................
ENSMLUP00000012185  ..............................................................................
ENSMLUP00000009828  ..............................................................................
ENSMLUP00000000547  ..............................................................................
ENSMLUP00000006939  ..............................................................................
ENSMLUP00000013213  ..............................................................................
ENSMLUP00000010899  ..............................................................................
ENSMLUP00000014701  ..............................................................................
ENSMLUP00000001355  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000003010  ..............................................................................
ENSMLUP00000014344  ..............................................................................
ENSMLUP00000011779  ..............................................................................
ENSMLUP00000004968  ..............................................................................
ENSMLUP00000006705  ..............................................................................
ENSMLUP00000013438  ..............................................................................
ENSMLUP00000013178  ..............................................................................
ENSMLUP00000017586  ..............................................................................
ENSMLUP00000000009  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000001998  ..............................................................................
ENSMLUP00000012742  ..............................................................................
ENSMLUP00000000119  ..............................................................................
ENSMLUP00000003793  ..............................................................................
ENSMLUP00000003076  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000012676  ..............................................................................
ENSMLUP00000013417  ..............................................................................
ENSMLUP00000010021  ..............................................................................
ENSMLUP00000005492  ..............................................................................
ENSMLUP00000017245  ..............................................................................
ENSMLUP00000005975  ..............................................................................
ENSMLUP00000013604  ..............................................................................
ENSMLUP00000013658  ..............................................................................
ENSMLUP00000014884  ..............................................................................
ENSMLUP00000015073  ..............................................................................
ENSMLUP00000011388  ..............................................................................
ENSMLUP00000004364  ..............................................................................
ENSMLUP00000009774  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000013558  ..............................................................................
ENSMLUP00000013327  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000004420  ..............................................................................
ENSMLUP00000001083  ..............................................................................
ENSMLUP00000006407  ..............................................................................
ENSMLUP00000020850  ..............................................................................
ENSMLUP00000001631  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000008206  ..............................................................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  ..............................................................................
ENSMLUP00000020676  ..............................................................................
ENSMLUP00000006371  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000002508  ..............................................................................
ENSMLUP00000001462  ..............................................................................
ENSMLUP00000015489  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000005155  ..............................................................................
ENSMLUP00000010240  ..............................................................................
ENSMLUP00000004993  ..............................................................................
ENSMLUP00000002012  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000003504  ..............................................................................
ENSMLUP00000001212  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000011537  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000011975  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000022464  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000002051  ..............................................................................
ENSMLUP00000009895  ..............................................................................
ENSMLUP00000003910  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000014255  ..............................................................................
ENSMLUP00000009304  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000018812  ..............................................................................
ENSMLUP00000002452  ..............................................................................
ENSMLUP00000009837  ..............................................................................
ENSMLUP00000015435  ..............................................................................
ENSMLUP00000009557  ..............................................................................
ENSMLUP00000015519  ..............................................................................
ENSMLUP00000004997  ..............................................................................
ENSMLUP00000009040  ..............................................................................
ENSMLUP00000009186  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000004311  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000003333  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000007954  ..............................................................................
ENSMLUP00000014165  ..............................................................................
ENSMLUP00000015532  ..............................................................................
ENSMLUP00000006515  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009833  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000001022  ..............................................................................
ENSMLUP00000015339  ..............................................................................
ENSMLUP00000012336  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000014752  ..............................................................................
ENSMLUP00000011116  ..............................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000001331  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000007783  ..............................................................................
ENSMLUP00000013998  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000004775  ..............................................................................
ENSMLUP00000002874  ..............................................................................
ENSMLUP00000015873  ..............................................................................
ENSMLUP00000019971  ..............................................................................
ENSMLUP00000009770  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000020205  ..............................................................................
ENSMLUP00000014596  ..............................................................................
ENSMLUP00000011059  ..............................................................................
ENSMLUP00000019635  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000010430  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000006337  ..............................................................................
ENSMLUP00000010159  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001945  ..............................................................................
ENSMLUP00000014265  ..............................................................................
ENSMLUP00000004630  ..............................................................................
ENSMLUP00000014463  ..............................................................................
ENSMLUP00000011713  ..............................................................................
ENSMLUP00000010988  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000012079  ..............................................................................
ENSMLUP00000015465  ..............................................................................
ENSMLUP00000001381  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000002430  ..............................................................................
ENSMLUP00000001136  ..............................................................................
ENSMLUP00000007700  ..............................................................................
ENSMLUP00000002685  ..............................................................................
ENSMLUP00000003527  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005172  ..............................................................................
ENSMLUP00000005760  ..............................................................................
ENSMLUP00000003875  ..............................................................................
ENSMLUP00000014433  ..............................................................................
ENSMLUP00000010635  ..............................................................................
ENSMLUP00000001299  ..............................................................................
ENSMLUP00000014110  ..............................................................................
ENSMLUP00000010539  ..............................................................................
ENSMLUP00000011416  ..............................................................................
ENSMLUP00000001779  ..............................................................................
ENSMLUP00000015042  ..............................................................................
ENSMLUP00000005045  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000015550  ..............................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  ..............................................................................
ENSMLUP00000002846  ..............................................................................
ENSMLUP00000015512  ..............................................................................
ENSMLUP00000008542  ..............................................................................
ENSMLUP00000014804  ..............................................................................
ENSMLUP00000010863  ..............................................................................
ENSMLUP00000000163  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000012859  ..............................................................................
ENSMLUP00000011587  ..............................................................................
ENSMLUP00000018248  ..............................................................................
ENSMLUP00000007856  ..............................................................................
ENSMLUP00000014214  ..............................................................................
ENSMLUP00000008400  ..............................................................................
ENSMLUP00000004048  ..............................................................................
ENSMLUP00000004605  ..............................................................................
ENSMLUP00000006812  ..............................................................................
ENSMLUP00000014871  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000012190  ..............................................................................
ENSMLUP00000012996  ..............................................................................
ENSMLUP00000013711  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000005342  ..............................................................................
ENSMLUP00000006369  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000015600  ..............................................................................
ENSMLUP00000010640  ..............................................................................
ENSMLUP00000000416  ..............................................................................
ENSMLUP00000012342  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000012982  ..............................................................................
ENSMLUP00000014543  ..............................................................................
ENSMLUP00000000775  ..............................................................................
ENSMLUP00000004637  ..............................................................................
ENSMLUP00000007008  ..............................................................................
ENSMLUP00000001540  ..............................................................................
ENSMLUP00000007555  ..............................................................................
ENSMLUP00000010202  ..............................................................................
ENSMLUP00000009696  ..............................................................................
ENSMLUP00000000439  ..............................................................................
ENSMLUP00000021531  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000003131  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000012863  ..............................................................................
ENSMLUP00000005038  ..............................................................................
ENSMLUP00000007090  ..............................................................................
ENSMLUP00000020254  ..............................................................................
ENSMLUP00000006780  ..............................................................................
ENSMLUP00000001391  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000004060  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000006989  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000009146  ..............................................................................
ENSMLUP00000016015  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000010306  ..............................................................................
ENSMLUP00000000456  ..............................................................................
ENSMLUP00000009152  ..............................................................................
ENSMLUP00000008233  ..............................................................................
ENSMLUP00000001771  ..............................................................................
ENSMLUP00000002636  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000006153  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000014933  ..............................................................................
ENSMLUP00000014256  ..............................................................................
ENSMLUP00000010844  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000008037  ..............................................................................
ENSMLUP00000004431  ..............................................................................
ENSMLUP00000003867  ..............................................................................
ENSMLUP00000017606  ..............................................................................
ENSMLUP00000005123  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000010185  ..............................................................................
ENSMLUP00000020533  ..............................................................................
ENSMLUP00000018072  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000007197  ..............................................................................
ENSMLUP00000011043  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000003532  ..............................................................................
ENSMLUP00000010845  ..............................................................................
ENSMLUP00000007054  ..............................................................................
ENSMLUP00000007486  ..............................................................................
ENSMLUP00000003307  ..............................................................................
ENSMLUP00000011628  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000002234  ..............................................................................
ENSMLUP00000020202  ..............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000004701  lgsfnsrpdgmqqrsysvssadqwseatviansaissdtglgdsvcsspsmssttspkldpppsphanrkkhrrkkst
ENSMLUP00000000932  ..............................................................................
ENSMLUP00000005322  ..............................................................................
ENSMLUP00000002246  ..............................................................................
ENSMLUP00000012242  ..............................................................................
ENSMLUP00000015202  ..............................................................................
ENSMLUP00000010100  ..............................................................................
ENSMLUP00000010936  ..............................................................................
ENSMLUP00000014437  ..............................................................................
ENSMLUP00000005292  ..............................................................................
ENSMLUP00000005842  ..............................................................................
ENSMLUP00000005470  sspawaglrpeglhqrscsvssadqwseaaalppvvsagrgmgdspasgpaevlssspklepppsphsnrkkhrrkks
ENSMLUP00000004401  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000001364  ..............................................................................
ENSMLUP00000012921  ..............................................................................
ENSMLUP00000007470  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000010417  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000001037  ..............................................................................
ENSMLUP00000005893  ..............................................................................
ENSMLUP00000013677  ..............................................................................
ENSMLUP00000004578  ..............................................................................
ENSMLUP00000006842  ..............................................................................
ENSMLUP00000000788  ..............................................................................
ENSMLUP00000008066  psdqtskhllkpdrnlaralstdctpsgdlsplsrepppspmvkkqrrkklttpsktegssgqaegkpakrkmwklks
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000007116  ..............................................................................
ENSMLUP00000003711  ..............................................................................
ENSMLUP00000011617  ..............................................................................
ENSMLUP00000010157  ..............................................................................
ENSMLUP00000008290  ..............................................................................
ENSMLUP00000009645  ..............................................................................
ENSMLUP00000006092  ..............................................................................
ENSMLUP00000000518  ..............................................................................
ENSMLUP00000004023  ..............................................................................
ENSMLUP00000006542  ..............................................................................
ENSMLUP00000001230  ..............................................................................
ENSMLUP00000010734  ..............................................................................
ENSMLUP00000003167  ..............................................................................
ENSMLUP00000005624  ..............................................................................
ENSMLUP00000019375  ..............................................................................
ENSMLUP00000010926  ..............................................................................
ENSMLUP00000009859  ..............................................................................
ENSMLUP00000001711  ..............................................................................
ENSMLUP00000017505  ..............................................................................
ENSMLUP00000007171  ..............................................................................
ENSMLUP00000003490  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000004020  ..............................................................................
ENSMLUP00000014449  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000006830  ..............................................................................
ENSMLUP00000016017  ..............................................................................
ENSMLUP00000012677  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000009973  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000007456  ..............................................................................
ENSMLUP00000006103  ..............................................................................
ENSMLUP00000012783  ..............................................................................
ENSMLUP00000014471  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000012437  ..............................................................................
ENSMLUP00000021530  ..............................................................................
ENSMLUP00000006501  ..............................................................................
ENSMLUP00000003171  ..............................................................................
ENSMLUP00000011174  ..............................................................................
ENSMLUP00000011009  ..............................................................................
ENSMLUP00000005126  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000014049  ..............................................................................
ENSMLUP00000013909  ..............................................................................
ENSMLUP00000019004  ..............................................................................
ENSMLUP00000004167  ..............................................................................
ENSMLUP00000022232  ..............................................................................
ENSMLUP00000018295  ..............................................................................
ENSMLUP00000021849  ..............................................................................
ENSMLUP00000006303  ..............................................................................
ENSMLUP00000015098  ..............................................................................
ENSMLUP00000006492  ..............................................................................
ENSMLUP00000008454  ..............................................................................
ENSMLUP00000010385  ..............................................................................
ENSMLUP00000009012  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000014285  ..............................................................................
ENSMLUP00000006019  ..............................................................................
ENSMLUP00000011245  ..............................................................................
ENSMLUP00000007987  ..............................................................................
ENSMLUP00000008335  ..............................................................................
ENSMLUP00000000103  ..............................................................................
ENSMLUP00000020572  ..............................................................................
ENSMLUP00000009684  ..............................................................................
ENSMLUP00000018770  ..............................................................................
ENSMLUP00000007942  ..............................................................................
ENSMLUP00000008949  ..............................................................................
ENSMLUP00000007075  ..............................................................................
ENSMLUP00000012217  ..............................................................................
ENSMLUP00000014260  ..............................................................................
ENSMLUP00000021545  ..............................................................................
ENSMLUP00000013488  ..............................................................................
ENSMLUP00000000189  ..............................................................................
ENSMLUP00000005075  ..............................................................................
ENSMLUP00000014442  ..............................................................................


                                            70                              80         90       100 
                                             |                               |          |         | 
d2elba2               ...................Y.CFQITSFDGK......................KSSILQAESKKD.HEEWICTINNI-
ENSMLUP00000006551  ...................F.DFEIETKQG-......................TQYTFSSIEREE.------------
ENSMLUP00000010306  ...................-.----------......................------------.------------
ENSMLUP00000002181  ...................-.----------......................------------.------------
ENSMLUP00000007103  ...................-.----------......................RIKVLNADTQET.M-----------
ENSMLUP00000015991  ...................-.----------......................RAKLFRFASEND.LPEWK-------
ENSMLUP00000011751  ...................-.----------......................------------.------------
ENSMLUP00000006051  ...................-.----------......................------------.------------
ENSMLUP00000006484  ...................-.-FVIRI----......................------------.------------
ENSMLUP00000022507  ...................-.-----YPV--......................SSVIFCALDPQD.R-----------
ENSMLUP00000014236  ...................-.-------TQ-......................RTKVLNANTQET.MM----------
ENSMLUP00000006854  ...................-.----------......................------------.------------
ENSMLUP00000003954  ...................Y.PFQVVYDE--......................GPLYVFSPTEEL.RKRWIHQLKNVI
ENSMLUP00000009991  ...................-.----------......................------------.------------
ENSMLUP00000007057  ...................F.TFICKDSESN......................KHLCYVFDSEK-.------------
ENSMLUP00000019012  ...................-.----------......................------------.------------
ENSMLUP00000005088  ...................-.----------......................------------.------------
ENSMLUP00000009827  ...................-.-----ISTK-......................RIKVLMADSQEA.MM----------
ENSMLUP00000007432  ...................N.MFQVIQPE--......................RALYIQANNCVE.AKAWIDILTKV-
ENSMLUP00000014622  ...................-.--Q-------......................------------.------------
ENSMLUP00000004098  ...................-.----------......................------------.------------
ENSMLUP00000014409  ...................Y.PFQVVHDN--......................YLLYVFAPDRES.RQRWVLALK---
ENSMLUP00000004165  ...................-.TFFVHTPN--......................RTYYLMDPSG-N.AHKWCKKIQE--
ENSMLUP00000005117  ...................N.AFKLVSKTTD......................EAHLFCAKKQED.KARWLQA-----
ENSMLUP00000011092  ...................-.----------......................------------.------A-----
ENSMLUP00000001759  ...................-.-FVIKPIDKKa.....................PDFVFY------.------------
ENSMLUP00000005088  ...................-.----------......................------------.------------
ENSMLUP00000005088  ...................-.----------......................------------.------------
ENSMLUP00000014421  ...................-.----------......................------------.------------
ENSMLUP00000007415  ...................-.-FVIKPIDKKa.....................PDFVF-------.------------
ENSMLUP00000000876  ...................-.----------......................------------.------------
ENSMLUP00000012407  ...................-.----------......................------------.------------
ENSMLUP00000010866  ...................-.-FVIKPIDKKa.....................PDFVFY------.------------
ENSMLUP00000015289  ...................-.----------......................------------.------------
ENSMLUP00000014093  ...................-.----------......................------------.------------
ENSMLUP00000005088  ...................-.----------......................------------.------------
ENSMLUP00000016145  ...................Y.PFQIVYKD--......................GLLYVYASNEES.RSQWLKALQN--
ENSMLUP00000000362  ...................-.----------......................------------.------------
ENSMLUP00000004624  ...................-.----------......................------------.------------
ENSMLUP00000004420  ...................-.----------......................------------.------------
ENSMLUP00000007170  ...................N.MFQVIHTE--......................KPLYVQANNCVE.ANEWIDVLCR--
ENSMLUP00000007524  ...................E.VFNLDFPD--......................NNFLLK------.------------
ENSMLUP00000011865  ...................-.----------......................------------.------------
ENSMLUP00000009407  ...................-.-FTIKPLDK-......................KIDVFKFNSSK-.------------
ENSMLUP00000017210  ...................-.-FTIKPLDK-......................KIDVFKFNSSK-.------------
ENSMLUP00000001866  ...................N.AFKLHNKETE......................EVHLFFAKKLEE.KIRWLRAFR---
ENSMLUP00000007867  ...................C.MFCVKTAS--......................RTYEMSASDTRQ.RQEWTAAIQMAI
ENSMLUP00000011713  ...................-.-----P----......................------------.------------
ENSMLUP00000009897  ...................-.-LDITCKDM-......................RNLRF-------.------------
ENSMLUP00000009921  ...................C.GIEIVCKDM-......................RNLRLAYKQEEQ.------------
ENSMLUP00000000027  ...................F.VIRIED----......................------------.------------
ENSMLUP00000019003  ...................F.VIRIED----......................------------.------------
ENSMLUP00000006515  ...................-.----------......................------------.------------
ENSMLUP00000010025  ...................A.FFIICTSELGpp....................QIYELVALTSSD.KNTWMELLEEA-
ENSMLUP00000003276  ...................-.----------......................------------.------------
ENSMLUP00000012185  ...................-.----------......................------------.------------
ENSMLUP00000009828  ...................-.----------......................------------.------------
ENSMLUP00000000547  ...................C.LFLIKCLD--......................KTFEISASDKKK.KQEWIQAIHST-
ENSMLUP00000006939  ...................-.-FFIKFIDRK......................------------.------------
ENSMLUP00000013213  ...................-.----------......................------------.------------
ENSMLUP00000010899  ...................-.----------......................------------.------------
ENSMLUP00000014701  ...................-.----------......................------------.------------
ENSMLUP00000001355  ...................-.----------......................------------.------------
ENSMLUP00000004002  ...................S.ILSITVR---......................------------.------------
ENSMLUP00000003010  ...................-.FFVISMSDNGa.....................QIYELVAQTVSE.KTVWQDLIC---
ENSMLUP00000014344  ...................H.AFEIILKDE-......................NSVIFSAKSAEE.KNNWMAAL----
ENSMLUP00000011779  ...................F.YVIFTWDQEA......................QIYELVAQTVSE.RKNWCALIT---
ENSMLUP00000004968  ...................-.---V------......................------------.------------
ENSMLUP00000006705  ...................N.TFVLKVENG-......................AEYILETIDSLQ.KHSWVADIQGC-
ENSMLUP00000013438  ...................-.----------......................------------.------------
ENSMLUP00000013178  ...................-.----------......................-K----------.------------
ENSMLUP00000017586  ...................-.----------......................------------.------------
ENSMLUP00000000009  ...................F.VFRLDHPK--......................------------.------------
ENSMLUP00000009616  ...................K.KFEIWYNARE......................EVYIIQAPTPEI.KAAWVNEIRKV-
ENSMLUP00000001998  ...................-.----------......................HTFVFRLDSAKT.------------
ENSMLUP00000012742  ...................-.----------......................------------.------------
ENSMLUP00000000119  ...................C.CMAIPLSQ--......................------------.------------
ENSMLUP00000003793  ...................Y.AFKACHPKI-......................KSFYFAAEHLDD.MNRWLNRIN---
ENSMLUP00000003076  ...................H.AFELVSKDE-......................NSIIFSAKSAEE.KNNWMAAL----
ENSMLUP00000013179  ...................C.CFEISAPDK-......................RVYQFTAASPKD.AEEWVQQLK---
ENSMLUP00000012676  ...................-.----------......................------------.------------
ENSMLUP00000013417  ...................-.----------......................------------.------------
ENSMLUP00000010021  ...................G.MLQLKIAGAP......................EPLTVTAPS---.------------
ENSMLUP00000005492  ...................-.MFLISASLQGp.....................EMYEIYTSSKEE.RNAWMAHIRRA-
ENSMLUP00000017245  ...................-.LIELHSPDSR......................NTLILRCKDTAT.AHSWFVAIHT--
ENSMLUP00000005975  ...................-.LIELHSPDSR......................NTLILRCKDTAT.AHSWFVAIHT--
ENSMLUP00000013604  ...................-.----------......................------------.------------
ENSMLUP00000013658  ...................-.MFLISASLQGp.....................EMYEIYTSSKEE.RNAWMAHIRRA-
ENSMLUP00000014884  ...................-.----------......................------------.------------
ENSMLUP00000015073  ...................Y.FI--------......................------------.------------
ENSMLUP00000011388  ...................-.----------......................SFTYMVAENPDV.TKQWVDGLRSI-
ENSMLUP00000004364  ...................-.---LKFEG--......................KTFYLYVSQKEE.K-----------
ENSMLUP00000009774  ...................-.----------......................------------.------------
ENSMLUP00000008949  ...................-.-LEIHSPDAK......................HTVILRGKDSAT.AQAWFSAIHS--
ENSMLUP00000013558  ...................-.----------......................------------.------------
ENSMLUP00000013327  ...................F.ELRVLGKDCNe.....................TSFFFEARSKTA.------------
ENSMLUP00000013892  ...................N.AFEISGSMI-......................ERILVSCNNQQD.LHEWVDHLQK--
ENSMLUP00000011043  ...................F.AFI-------......................------------.------------
ENSMLUP00000004420  ...................F.AYVARDKDTRil....................KCHVFRCDTPA-.------------
ENSMLUP00000001083  ...................L.RFEIWFRRRKar....................DTFVLQAASLAT.KQAWTADIS---
ENSMLUP00000006407  ...................-.----------......................------------.------------
ENSMLUP00000020850  ...................-.----------......................------------.------------
ENSMLUP00000001631  ...................H.VMQVVTQDGSgtl...................HTTYLQCKNVND.LNQWLSALRKA-
ENSMLUP00000007486  ...................-.----------......................------------.------------
ENSMLUP00000008206  ...................H.CFEIITDT--......................MVYFV-------.------------
ENSMLUP00000013539  ...................N.CFELYIPDSKdqvikackteadgrvvegnh..TVYRISAPTPEE.KEEWIRRIRAAI
ENSMLUP00000015365  ...................N.GWKIHNTAKN......................KWFVCMAKTAEE.KQKWLDAI----
ENSMLUP00000020676  ...................N.GWKIHNTAKN......................KWFVCMAKTAEE.KQKWLDAI----
ENSMLUP00000006371  ...................L.CFELWFRRRRar....................EAYTLQAASPEI.KLKWTSSIA---
ENSMLUP00000007133  ...................Y.TFEITGSHIL......................ERIVVHCSNNQD.FQEWLEQLY---
ENSMLUP00000002508  ...................N.GWKIHNTAKN......................KWFVCMAKTPEE.KHEWLEAI----
ENSMLUP00000001462  ...................Y.SFKAEQSGM-......................RTYYFSADTLED.MNAWVRAMNQA-
ENSMLUP00000015489  ...................A.KFEIWFRRRRksq...................DSYILQASSPEV.KAMWTDVIGK--
ENSMLUP00000019635  ...................-.----------......................------------.------------
ENSMLUP00000005155  ...................R.YLEICSADGQ......................DTLFLRATEEAS.ARSWTAAIQA--
ENSMLUP00000010240  ...................-.-FEIWYAGKE......................EIYIVQASNIDV.KMIWLKEIRNI-
ENSMLUP00000004993  ...................N.LFEIVTSS--......................RTFYVQADSPEE.MHSWIKAVSGAI
ENSMLUP00000002012  ...................-.----------......................------------.------------
ENSMLUP00000009146  ...................P.VFHLYHKKT-......................LFYSFKAEDTNS.AQRWIEAMEDA-
ENSMLUP00000002140  ...................C.KFALWSGRTPssd...................NKTVLKASNIET.KQEWIKNIREVI
ENSMLUP00000014437  ...................F.TFEAGRMCDAge....................GLYTFQT-----.------------
ENSMLUP00000003504  ...................N.CFELYNPSHKgqvikackteadgrvvegnh..VVYRISAPSPEE.KEEWMKSIRA--
ENSMLUP00000001212  ...................H.VFKLGLQDG-......................KEYLFQAKDEAE.MSSWLRVVNAAI
ENSMLUP00000000142  ...................H.MFLLIEDQGA......................QGYELFFKTREL.KKKWMEQFEM--
ENSMLUP00000011713  ...................Y.VFKLHFKS--......................HVYYFRAESEYT.FERWMEVIRSA-
ENSMLUP00000011537  ...................F.CLELYNPSCRgqkikacktdgdgkvvegkh..QSYRISASSAEE.RDQWIEAIRA--
ENSMLUP00000008290  ...................-.----------......................------------.------------
ENSMLUP00000011975  ...................R.AFEVWHEREDsv....................RKYLLQARTVIT.KNAWVKEIC---
ENSMLUP00000012342  ...................H.TFQVSGKE--......................RTLELQASSEQD.KEEWIKALQET-
ENSMLUP00000022464  ...................-.MFLISASLQGp.....................EMYEIYTSSKEE.RNAWMAHIRRA-
ENSMLUP00000006515  ...................H.VFKLQFKS--......................HVYFFRAESKYT.FGRWMEVIERA-
ENSMLUP00000002051  ...................-.----------......................------------.------------
ENSMLUP00000009895  ...................H.AFKISHPQI-......................KTFYFAAENTQE.MNVWLNKL----
ENSMLUP00000003910  ...................H.VFKLRLSNG-......................SEWLFHGKDEEE.MLSWLQGVSTA-
ENSMLUP00000010202  ...................N.LFEIITSS--......................RTFYVQADSPED.MHSWIKEIRAA-
ENSMLUP00000000726  ...................C.KFALTSRTGDvv....................ETFVLHSSSPSV.RQTWIHEINQ--
ENSMLUP00000014255  ...................-.----------......................------------.------------
ENSMLUP00000009304  ...................Y.VFQLTHDVY-......................KPFIFAADTLAD.LSMWVRHL----
ENSMLUP00000000726  ...................C.KFALWVGRTPtsd...................NKIVLKASSIEN.KQDWIKHIREVI
ENSMLUP00000018812  ...................-.----------......................------------.------------
ENSMLUP00000002452  ...................-.----------......................------------.------------
ENSMLUP00000009837  ...................H.CFEITTAN--......................VVYY--------.------------
ENSMLUP00000015435  ...................L.SFSVFHYKNPk.....................LQHTVQAKSQQD.KRLWVLHLKR--
ENSMLUP00000009557  ...................H.VMQVIYTDDTgrp...................QTAYLQCKCVNE.LNQWLSALRKV-
ENSMLUP00000015519  ...................A.KFTLVLPK--......................EEVQLKTENTES.GEEWRGFI----
ENSMLUP00000004997  ...................-.----------......................------A-----.------------
ENSMLUP00000009040  ...................N.TFVVKVEGS-......................SEYILETADALH.VKAWVSDIQEC-
ENSMLUP00000009186  ...................-.MFLISAAPP-......................EMYEVHTASRDD.RSTWIRVIQQ--
ENSMLUP00000006019  ...................-.----------......................------------.------------
ENSMLUP00000004311  ...................-.MFLISASSAGp.....................EMYEIHTNSKEE.RNNWMRRIQQA-
ENSMLUP00000006153  ...................H.ELKITQQGT-......................DPLVLAVQSREQ.AEQWLKVIRE--
ENSMLUP00000001771  ...................H.SFLVSGKQ--......................RTLQLQARSQEE.MISWMQACQAAI
ENSMLUP00000003867  ...................F.----------......................------------.------------
ENSMLUP00000003333  ...................F.VFEVIPASWDqsrtgq................DSYVLMASSQAE.MEEWVKFLKRV-
ENSMLUP00000020254  ...................F.VFNCVPQSGN......................RTFCLCATSNQE.MKRWLEAMDKA-
ENSMLUP00000007954  ...................F.LISMGMKDP-......................EMVEVHASSKEE.RNSWIQIIQDT-
ENSMLUP00000014165  ...................Y.TFVLKVKDR-......................TDIIFEVGDEQQ.LNSWMAELRK--
ENSMLUP00000015532  ...................-.----------......................------T-----.------------
ENSMLUP00000006515  ...................H.CFTIYAAQ--......................KTIVVAASTELE.KEKWMHDLNNAI
ENSMLUP00000015042  ...................N.LFEIITADE-......................VHYFLQAATPKE.RTEWIKAIQVA-
ENSMLUP00000000573  ...................A.FFDLKTSK--......................RVYNFCAQDGQS.AQQWMDRIQSCI
ENSMLUP00000002140  ...................C.KFALMNRETS......................ERVILQAANADI.QQAWVQDISQV-
ENSMLUP00000009833  ...................-.----------......................------------.------------
ENSMLUP00000014256  ...................-.TVQLTTEK--......................HTYYLTADSPNI.LEEWIKVLQNV-
ENSMLUP00000014449  ...................-.-F--------......................------------.------------
ENSMLUP00000002296  ...................P.VFHISHID--......................RVYTLRTDNINE.RTAWVQKIKAA-
ENSMLUP00000001022  ...................C.RFALTSRGPEggi...................QRYVLQTADPAV.SQAWIKQV----
ENSMLUP00000015339  ...................N.SFTIITPF--......................RRLMLCAENRKE.MEDWISSLKS--
ENSMLUP00000012336  ...................C.AFSVIYGENY......................ESLDLVANSADV.ANIWVTGLR---
ENSMLUP00000022476  ...................Y.PFQVVHDA--......................NTLYIFAPSAQS.RDQWVKKLKE--
ENSMLUP00000014752  ...................-.----------......................------------.------------
ENSMLUP00000011116  ...................N.GWLIKTPT--......................KSFAVYAATATE.KSEWMNHINKC-
ENSMLUP00000006182  ...................N.CFCLVFPF--......................RTFYLCAKTGVE.ADEWIKILR---
ENSMLUP00000002497  ...................Y.GFYLIHTQGH......................NGLEFYCKTKDL.KKKWLEQF----
ENSMLUP00000001331  ...................F.TFTAEHPGM-......................RTYVLAADTLED.LRGWIRALGRA-
ENSMLUP00000009696  ...................R.TFLVSGKQ--......................RSLELQARTEEE.KKDWVQAINS--
ENSMLUP00000007783  ...................H.VFKLRLNDG-......................NEYLFQAKDDEE.MNTWIQAISSAI
ENSMLUP00000013998  ...................N.VFKLKTADW-......................RVLLFQAQSPDE.MQGWINKINCV-
ENSMLUP00000002874  ...................-.----------......................------------.------------
ENSMLUP00000004775  ...................-.----------......................------------.------------
ENSMLUP00000002874  ...................H.TFGLI-----......................------------.------------
ENSMLUP00000015873  ...................N.SFTVITPC--......................RKLILCADNRKE.MEDWIAALKT--
ENSMLUP00000019971  ...................F.TFTAEHPGM-......................RTYVLAADTLED.LRGWIRALGRA-
ENSMLUP00000009770  ...................-.----------......................------------.------------
ENSMLUP00000008335  ...................N.GIDIIMAD--......................RTFHLIAESPED.ASQWFSVLSQ--
ENSMLUP00000020205  ...................F.TFAVRFAEARa.....................RTYVLAAESQAA.MEGWVKALSRA-
ENSMLUP00000014596  ...................A.FFDVKTTR--......................RVYNFCAQDVPS.AQQWVDQIQSC-
ENSMLUP00000011059  ...................-.----------......................----L-------.------------
ENSMLUP00000019635  ...................H.LVALYTRD--......................EHFAIAADSEAE.QDSWYQAL----
ENSMLUP00000004596  ...................S.CFELTSQDR-......................RSYEFTATNPAE.ARDWVDQIS---
ENSMLUP00000004060  ...................-.TFQLISEK--......................KTYYLTADSPCL.LEEWIRVLQR--
ENSMLUP00000010430  ...................F.AFVARNPRS-......................------------.------------
ENSMLUP00000000775  ...................F.GFVLRTSGGRseshlss...............V-----------.------------
ENSMLUP00000006337  ...................T.TFPAEHAGV-......................RTYFFSAESPEE.QEAWIQAMGEA-
ENSMLUP00000010159  ...................-.-FIISNGGT-......................QTYHLKASSEVE.RQRWVTALE---
ENSMLUP00000004167  ...................-.-FEVVTTQ--......................RTFVFRVEKEEE.RNDWVSILLN--
ENSMLUP00000001945  ...................-.----------......................---AF-------.------------
ENSMLUP00000014265  ...................-.----------......................------------.------------
ENSMLUP00000004630  ...................K.CLLLKIRGG-......................KQFVLQCDSDPE.LVQWKKELRDA-
ENSMLUP00000014463  ...................-.--K-------......................------------.------------
ENSMLUP00000011713  ...................H.CLTLRGQR--......................QSIVVAASSRSE.MEKWVEDIQMA-
ENSMLUP00000010988  ...................V.YLTVTKESG-......................------------.------------
ENSMLUP00000022232  ...................-.----------......................--------T---.------------
ENSMLUP00000012079  ...................F.CFEVVSPS--......................KSCFLQADSERL.LQLWVSAVQSS-
ENSMLUP00000015465  ...................H.IFAIFNTEQRnvykdy................RFLELACDSQED.VDSWKASL----
ENSMLUP00000001381  ...................Q.GFTIVFHGRR......................SNLDLVANSVEE.AQIWMKGLQ---
ENSMLUP00000014433  ...................R.VFQLLHKNM-......................VFYVFKADDAHS.AQKWIEAFQ---
ENSMLUP00000002430  ...................C.AFSILHGENY......................ESLDLVAHSADV.ANIWVSGLR---
ENSMLUP00000001136  ...................N.CFAFT-----......................------------.------------
ENSMLUP00000007700  ...................H.VFAIFNTEQRnvykdl................RQIELACESQEE.VDSWKAS-----
ENSMLUP00000002685  ...................FkVADLTIPK--......................HRHLLQAKNQEE.KRLWIHCLQR--
ENSMLUP00000003527  ...................I.----------......................------------.------------
ENSMLUP00000000189  ...................H.TFEVYTEGE-......................RLYLFGLESADL.AREWVKCIAK--
ENSMLUP00000005172  ...................-.----------......................------------.------------
ENSMLUP00000005760  ...................H.VFYLRTADW-......................RVFLFQASSLEQ.MQSWITRINV--
ENSMLUP00000003875  ...................-.-FDISVND--......................SVWYLRAQDPDH.RQQWIDAIEQ--
ENSMLUP00000014433  ...................N.ELQIESVE--......................RSFILSASSATE.RDEWLEAISRS-
ENSMLUP00000010635  ...................F.CFEVVSPT--......................KSCMLQADSEK-.RQAWIKAVQTS-
ENSMLUP00000001299  ...................N.AFLIQHESRYrqci..................AAFLLQAQTENI.KKTWMAQITAAI
ENSMLUP00000014110  ...................-.----------......................-T----------.------------
ENSMLUP00000010539  ...................-.----------......................------------.------------
ENSMLUP00000011416  ...................P.TFILTGRS--......................RALELRARTEEE.KKEWIQVIEA--
ENSMLUP00000001779  ...................-.----------......................------------.------------
ENSMLUP00000015042  ...................F.VFKITTTKQ-......................QDHFFQAAFLEE.RDGWVRDIKKAI
ENSMLUP00000005045  ...................C.CFTIYHGNHM......................ESLDLITSNPEE.ARTWITGLK---
ENSMLUP00000004048  ...................N.LFKVITKDD-......................THYYIQASSKAE.RAEWIEAIK---
ENSMLUP00000015550  ...................H.AFELKMLDK-......................YSHYLAAETEQE.MEEWLITLKKI-
ENSMLUP00000005543  ...................H.TFAVCTEH--......................RGILLQASSDKD.MHDWLYAFN---
ENSMLUP00000002060  ...................N.TFVIRCLQWTtv....................IERTFHVDSPDE.REEWMRAIQM--
ENSMLUP00000002846  ...................L.TFSVKTHD--......................RIYYMVAPSPEA.MRIWMDVI----
ENSMLUP00000015512  ...................R.KFELVDRNGL......................EKYILQAASKEI.RDCWFSEISK--
ENSMLUP00000008542  ...................-.----------......................------------.------------
ENSMLUP00000014804  ...................H.IFALFNTEQRnvykdy................RQLELACETQEE.VDSWKAS-----
ENSMLUP00000010863  ...................H.VFQLRTADW-......................RLYLFQAPTAKE.MSSWIARINL--
ENSMLUP00000000163  ...................N.IFAVCTKH--......................RGVLLQALNDKD.MSDWLYAFN---
ENSMLUP00000010492  ...................N.CFQIVVQHFSeeh...................YIFYFAGETPEQ.AEDWMKGLQ---
ENSMLUP00000012859  ...................F.AFELKMQDK-......................SSYLLAADSEVE.MEEWITILNK--
ENSMLUP00000011587  ...................-.---L------......................------------.------------
ENSMLUP00000018248  ...................K.CILLRIKGG-......................KQFVLQCESDPE.FVQWKKELT---
ENSMLUP00000007856  ...................K.CILLRIKGG-......................KQFVLQCESDPE.FVQWKKELT---
ENSMLUP00000014214  ...................-.----------......................------------.------------
ENSMLUP00000008400  ...................-.-FTITVDQ--......................KTFHFQARDADE.REKWIHALEET-
ENSMLUP00000004048  ...................H.LIKLKTRTS-......................TEYFLEACSRED.RDAWAFEITGAI
ENSMLUP00000004605  ...................F.CFKLFHPLEQsiwavkgpkgeavgsitqplpsSYLIIRATSESD.GRCWMDALE---
ENSMLUP00000006812  ...................S.AIEIFHVD--......................------------.------------
ENSMLUP00000014871  ...................F.ALELASKE--......................ETIQFQTEDME-.------------
ENSMLUP00000010926  ...................Y.GFQIHTKE--......................GEFTLSAMTSGI.RRNWIQTIM---
ENSMLUP00000012190  ...................-.----------......................------------.------------
ENSMLUP00000012996  ...................Y.GFQIHTKD--......................AVYTLSAMTSGI.RRNWIEALRK--
ENSMLUP00000013711  ...................I.HFNLFVRN--......................QEIKFRVESLES.REMWKGFI----
ENSMLUP00000006780  ...................Y.CFQITTPNGK......................SGIILQAESRKE.NEEWICAINN--
ENSMLUP00000005342  ...................-.-V--------......................------------.------------
ENSMLUP00000006369  ...................-.--IVLTSGA-......................KTYHLKASSDVE.RQQWITALE---
ENSMLUP00000010845  ...................S.CFQVIFPQ--......................DVLRLRAETRQR.AQEWMEALKTA-
ENSMLUP00000015600  ...................Y.AFELKMNDL-......................TYFVLAAETESD.MDEWIHTLNR--
ENSMLUP00000010640  ...................-.----------......................------------.------------
ENSMLUP00000000416  ...................Y.IFDINTID--......................RIFYLVADSEEE.MNKWVRCICD--
ENSMLUP00000012342  ...................H.SFKLTQSK--......................SVHSFAADSEEL.KQKWLKII----
ENSMLUP00000007987  ...................-.-FQVITSQ--......................RVFVFRTESEAQ.RDTWCSTLQSC-
ENSMLUP00000012982  ...................S.FLAIHLTDFQcvs...................SALIVHCPSTAD.RAQWLE------
ENSMLUP00000014543  ...................F.VFDIKTSE--......................RTFYLVAETEED.MNKWVQSICQ--
ENSMLUP00000000775  ...................Y.CFQITSFDGK......................KSSILQAESKKD.HEEWICTINN--
ENSMLUP00000004637  ...................M.FFNAVKEG--......................DTVIFASDDEQD.RILWVQAMYR--
ENSMLUP00000007008  ...................A.FFNAVKEG--......................DTVIFASDDEQD.RILWVQAMYR--
ENSMLUP00000001540  ...................H.SFCVITPQ--......................RKLILAAPNRKD.MEEWINVIKT--
ENSMLUP00000007555  ...................N.TFELITVRPQreddretlvsqcrdtlcv....TKHWLSADTKEE.RDLWMQKLNQV-
ENSMLUP00000010202  ...................F.CFVINALS--......................QRYFLQANDQKD.LKDWVEALNQA-
ENSMLUP00000009696  ...................H.VFKITQSH--......................LSWYFSPETEEL.QRRWMAVLGR--
ENSMLUP00000000439  ...................R.AFEIFTDN--......................KTYVFKAKDEKN.AEEWLQCINVA-
ENSMLUP00000021531  ...................R.AFEIFTDN--......................KTYVFKAKDEKN.AEEWLQCINVA-
ENSMLUP00000008335  ...................G.YWNVTVYGRK......................HCYRLYTKLLNE.ATRWSSAIQNV-
ENSMLUP00000003131  ...................-.---L------......................------------.------------
ENSMLUP00000002636  ...................K.RHELRFSQGAt.....................EILVLALQSREQ.AEEWLKVIREV-
ENSMLUP00000012863  ...................N.VFQITTASG-......................NEFLLQSDIDFI.ILDWFHAIKNAI
ENSMLUP00000005038  ...................H.TFTVNAASG-......................EQYKLRATDAKE.RQHWVSRLQ---
ENSMLUP00000007090  ...................F.VFIVKTTS--......................RTFYLVAKTEEE.MQVWVHSISQ--
ENSMLUP00000020254  ...................S.IIELKPPSEEf.....................KTFYFCAENKTE.NQRWITALK---
ENSMLUP00000006780  ...................V.GFVVRLPESTggesl.................STYVFESNSEGE.K-----------
ENSMLUP00000001391  ...................I.PFRIHNRNG-......................KSYLFLLSSDYE.RSEWREAIQK--
ENSMLUP00000002099  ...................H.LFTLTVLSNHanek..................VEMLLGAETQSE.RARWITALG---
ENSMLUP00000004060  ...................C.TLVIQPPEH-......................SPTYLLIGTKHE.KDTWLYHLTV--
ENSMLUP00000004167  ...................F.TFEIYLPSE-......................RAFLFGAETFQA.QRRWTEAIA---
ENSMLUP00000006989  ...................-.CFDLVTHN--......................RTYHFQAEDEHE.CEAWVSVLQN--
ENSMLUP00000015169  ...................-.----------......................------------.------------
ENSMLUP00000000788  ...................A.GLTIVTPE--......................RRFLFTCPSEKE.QGEWLESFRDV-
ENSMLUP00000010633  ...................N.IFRVRFQDPSpg....................QSHTLQANDVFH.KQQWFNCIRTAI
ENSMLUP00000012424  ...................-.----------......................RTLLLA------.------------
ENSMLUP00000021545  ...................-.----------......................------------.------------
ENSMLUP00000009146  ...................Y.ALKIETSE--......................SCLTLSASSCAE.RDEWHGCLSRA-
ENSMLUP00000016015  ...................L.AFSILYDSN-......................CQLNFIAPDKHE.YCIWTDGLN---
ENSMLUP00000010504  ...................R.LFLLHNTQGTq.....................AEFLFSTETQSE.KLRWISAL----
ENSMLUP00000010306  ...................N.VFCLSNSFG-......................DVYLFQATSQTD.LENWVTAIHSA-
ENSMLUP00000000456  ...................H.AFQVILADR-......................PCLELSAESEAE.MADWMQHLCQA-
ENSMLUP00000009152  ...................-.----------......................------------.------------
ENSMLUP00000008233  ...................N.FFRVSFKNGSqs....................QTHSLQANDTFN.KQQWLNCIRQA-
ENSMLUP00000001771  ...................R.VFQLQQSG--......................QLYTFKADTEEL.RGRWVKAMERA-
ENSMLUP00000002636  ...................F.AFRILRNRQ-......................EVAILEASCSED.MGRWLGLL----
ENSMLUP00000008265  ...................-.-FDLISHN--......................RTYHFQAEDEQD.YVAWISVLTN--
ENSMLUP00000015858  ...................N.VFILRLLENAddre..................ATYMLKASSQSE.MKRWMTSL----
ENSMLUP00000007197  ...................-.----------......................------------.------------
ENSMLUP00000010409  ...................N.VFELKTRQG-......................TELLIQSDNDTV.INDWFKVLSTT-
ENSMLUP00000006153  ...................L.TFRLLRNGQ-......................EVAVLEAASSED.MGRWIGVL----
ENSMLUP00000019004  ...................F.TFEIYLPSE-......................RAFLFGAETFQA.QRRWTEAIA---
ENSMLUP00000014933  ...................H.RFILLRSPGNkv....................SNIKFQAPNGEE.KESWIKALNE--
ENSMLUP00000014256  ...................Y.TIVIHPKDQ-......................GPTYLLIGSKHE.KDTWLYHLTVA-
ENSMLUP00000010844  ...................Y.AMKISHQDFH......................GNILLAAESEFE.QAQWLEMLQE--
ENSMLUP00000006830  ...................Y.SFRILHNGE-......................ELAKLEAKSSEE.MGHWLGLL----
ENSMLUP00000008037  ...................L.AFSILYDPD-......................ETLNFIAPNKYE.YCIWIDGLS---
ENSMLUP00000004431  ...................G.TFEIKTPG--......................RIITLKAANKQV.MLYWLQQLQ---
ENSMLUP00000003867  ...................-.----------......................ICYVFKADDQT-.------------
ENSMLUP00000017606  ...................-.----------......................------------.------------
ENSMLUP00000005123  ...................N.VLELRSHDG-......................SEYLIQHDSEAI.ISTWHKAIA---
ENSMLUP00000002234  ...................-.----------......................------------.----R-------
ENSMLUP00000020202  ...................-.----------......................------------.----R-------
ENSMLUP00000010185  ...................K.CIDLDTEE--......................HIYHLKVKSDDV.FDEWVSKLR---
ENSMLUP00000020533  ...................-.----------......................------------.------------
ENSMLUP00000018072  ...................F.AFTICFNAPGv.....................RPYLLAADGPAA.QEAWVKVLSRA-
ENSMLUP00000000937  ...................N.VLHIRTVPG-......................HEFLLQSDLEAE.LRAWHHALRAVI
ENSMLUP00000007197  ...................F.GIKLLIPVADgm....................NEVYLRCDHENQ.YAQWMAA-----
ENSMLUP00000011043  ...................-.----------......................------------.------------
ENSMLUP00000013586  ...................C.CFTILYGTQFvls...................TLSLAIADSKED.ATKWLSGL----
ENSMLUP00000019004  ...................T.SWGLTAYSEK......................HQWHLCCDSLQT.QMEWMAS-----
ENSMLUP00000003532  ...................-.----------......................----------G-.------------
ENSMLUP00000010845  ...................L.VDTVLYDN--......................SQLQLKAESPWE.ALDWGQKL----
ENSMLUP00000007054  ...................-.-MDLIIPGE-......................QYFYLKARSVAE.RQRWLVALGSA-
ENSMLUP00000007486  ...................H.AVAIIFHDE-......................TSKTFACESELE.AEEWCKHL----
ENSMLUP00000003307  ...................N.AFILQGPK--......................HEWICATEAEDD.KFLWLSVL----
ENSMLUP00000011628  ...................-.----------......................------------.------------
ENSMLUP00000007987  ...................W.GFTLILEK--......................MHLYLSCTDEDE.MWDWTTSI----
ENSMLUP00000002234  ...................I.KLLIPVAEGM......................NEIWLRCDNEKQ.YAHWMAA-----
ENSMLUP00000020202  ...................I.KLLIPVAEGM......................NEIWLRCDNEKQ.YAHWMAA-----
ENSMLUP00000000573  ...................-.----------......................K-----------.------------
ENSMLUP00000004701  .snfkadglsgtaeeqeenF.EFIIVSLTG-......................QTWHFEATTYEE.RDAWVQAIES--
ENSMLUP00000000932  ...................G.SFLLIYLNEFhsav..................GAYTFQASGQAL.CRGWVDSIYNA-
ENSMLUP00000005322  ...................-.-MELIIPGE-......................QHFYMKAVNAAE.RQRWLVALG---
ENSMLUP00000002246  ...................-.----------......................--------S---.------------
ENSMLUP00000012242  ...................Y.NFSVTNPVSGqa....................VAHIFAADNKED.LQKWMEAF----
ENSMLUP00000015202  ...................D.IFQLNNPDKG......................NVYKFQTGSRFH.AILWHKHLDDA-
ENSMLUP00000010100  ...................G.LLTVSLREG-......................SRLHLCAETQDD.AIAWKTAL----
ENSMLUP00000010936  ...................H.CFVLKHPQIQkesq..................YIKYLCCDDERT.LNQWVTGIR---
ENSMLUP00000014437  ...................A.VAIIFTDD--......................SARTFTCDSELE.AEEWYKTLS---
ENSMLUP00000005292  ...................R.RIDLDTEE--......................HIYHLKVKSQDW.FDAWVSKLR---
ENSMLUP00000005842  ...................-.-IDLDTED--......................NIYHLKIKSQDL.FQSWVAQLR---
ENSMLUP00000005470  tgtprpdgpssaaedveesF.EFVVVSLTG-......................QTWHFEASTAEE.RELWVQSVQA--
ENSMLUP00000004401  ...................L.GLEVFCTEDDlc....................SDIYLKFYDPQD.RDE---------
ENSMLUP00000007384  ...................F.CFDVEVADRPg.....................VALTMQAFSEEE.RKQWLEAL----
ENSMLUP00000001364  ...................F.CFDIETNERP......................GTITLQALSEAN.RRLWMEAM----
ENSMLUP00000012921  ...................N.TFIIRCLQWTtv....................IERTFHVDTPEE.REEWTEAIQAV-
ENSMLUP00000007470  ...................C.CLVLKHPQIQkksq..................YIKYLCCDDVRT.LHQWVNGIR---
ENSMLUP00000005126  ...................-.-FELVFSG--......................KKLTLRASSQDE.AEDWLDRVREA-
ENSMLUP00000010417  ...................G.LLSLSFPH--......................EKLLLMSTDREE.LLRWYHSLTVAI
ENSMLUP00000004167  ...................Q.SFEIITPY--......................KSFSFVAESEKE.KQEWIEAVQQS-
ENSMLUP00000001037  ...................L.AFSVSYDHGEee....................AYLNFIAPSKQE.FHLWTDGLS---
ENSMLUP00000005893  ...................F.GFCLKPNKVLqetk..................ELRVLCAEDEQG.RICWMTAFR---
ENSMLUP00000013677  ...................F.GFCIKPNKLRnghk..................GLRIFCSEDEQS.RTCWLSAFR---
ENSMLUP00000004578  ...................-.----------......................------------.------------
ENSMLUP00000006842  ...................-.----------......................-----V------.------------
ENSMLUP00000000788  ...................H.GLQITYRREGhi....................RNLFVYHESGKE.IVDWFNALRA--
ENSMLUP00000008066  ......fgslrniykaeenF.EFLIVSSTG-......................QTWHFEAASFEE.RDAWVQAIES--
ENSMLUP00000013630  ...................F.LLQLLHGQHTk.....................HQFLLRARTESE.KQRWISAM----
ENSMLUP00000007116  ...................-.----------......................------------.------------
ENSMLUP00000003711  ...................F.IFNLCSKDRS......................------------.------------
ENSMLUP00000011617  ...................-.----------......................------------.------------
ENSMLUP00000010157  ...................F.TLSISNQYGEdk....................VTHTLQTESRGD.LQSWMEAL----
ENSMLUP00000008290  ...................H.AIGIYFNDD-......................TSKTFACESDLE.ADEWCKVLQ---
ENSMLUP00000009645  ...................-.----------......................------------.------------
ENSMLUP00000006092  ...................F.CFKPNKARGPr.....................DLKMLCAEEEQS.RMCWVTAIR---
ENSMLUP00000000518  ...................H.MLVVYSANG-......................EMYKLRAADAKE.KQLWVSQLRAC-
ENSMLUP00000004023  ...................-.-FSISFIEDPe.....................RKYHFECYSEEQ.CQEWMGALRRA-
ENSMLUP00000006542  ...................-.DFLLTDSEKG......................NSYKFQAGNRMN.AMLWFKHLSAA-
ENSMLUP00000001230  ...................N.GIRLTSAVPGadik..................VLINFNAPNPQD.RK----------
ENSMLUP00000010734  ...................-.----------......................SYLNLVAFQEEV.AKEWTN------
ENSMLUP00000003167  ...................K.SFVVGWPT--......................VNYVATFSSPEL.KDKWLSLLQRY-
ENSMLUP00000005624  ...................D.MFQLHIACKDs.....................KVVRCHFSTFKQ.CQEWLSRLSRA-
ENSMLUP00000019375  ...................H.GLQITYRREGhi....................R-----------.------------
ENSMLUP00000010926  ...................F.SLCILTPE--......................KEHFIRAETKEI.ISGWLEML----
ENSMLUP00000009859  ...................-.----V-----......................------------.------------
ENSMLUP00000001711  ...................F.KIVVEPPGAAp.....................FTVVLLAPSRQE.KAAWMSDISQC-
ENSMLUP00000017505  ...................-.----------......................------------.------------
ENSMLUP00000007171  ...................T.GLWLVTVSGRk.....................HSVRLCSPRQAE.AERWGVALREVI
ENSMLUP00000003490  ...................E.VMSIRTTD--......................REYFLIGSDREK.IKDWVSFMSS--
ENSMLUP00000007987  ...................F.SFELILTGG-......................RIQHFGTDGADS.LEAWVNAV----
ENSMLUP00000004020  ...................-.----------......................HLIYVEASGAAR.KETWIA------
ENSMLUP00000014449  ...................S.TFFLETKE--......................RLYLLAAPT-AE.RSNWMQAI----
ENSMLUP00000016474  ...................-.----------......................------------.------------
ENSMLUP00000006830  ...................H.KLKITPMNA-......................DVIVLGLQSKDQ.AEQWLRVIQEV-
ENSMLUP00000016017  ...................N.GLKITTPE--......................EQFTLISSTPQE.KTKWLRAISQA-
ENSMLUP00000012677  ...................D.IFQLHLTCKDc.....................KVIRCQFSTFEQ.CQEWLKRLNNAI
ENSMLUP00000000189  ...................W.GFTVVHETEKhek...................QQWYLCCETQME.LREWFAT-----
ENSMLUP00000009973  ...................C.LFSVKCFDDSvh....................GFKVPQNSPPQA.REDWLQAIEE--
ENSMLUP00000010385  ...................N.AFQVIAVDGV......................CSGIIQCLSADD.CIDWLQAIA---
ENSMLUP00000007987  ...................-.-FDLLTPH--......................RCFSFTAESGGA.RQSWAAALQEA-
ENSMLUP00000009299  ...................H.CFVILYGMEFrl....................KTLSLQATSEDE.VNMWIKGL----
ENSMLUP00000007456  ...................P.TFRLSLLSNHqgrp..................TQRLLQASSLSD.MQRWLGAF----
ENSMLUP00000006103  ...................-.--------D-......................------------.------------
ENSMLUP00000012783  ...................K.IFQILYAN--......................------------.------------
ENSMLUP00000014471  ...................F.CVLYLAEKAE......................CLFTLEAHSQEQ.K-----------
ENSMLUP00000000189  ...................-.-FEVITNN--......................RTFAFRAESDAE.RKEWIQALQQA-
ENSMLUP00000012437  ...................F.ALLVRPPTEQan....................VLLSFQMTSEELpKENWLKML----
ENSMLUP00000021530  ...................-.----DKASE-......................KSICFMAMH---.------------
ENSMLUP00000006501  ...................F.CFDVEAVD--......................------------.------------
ENSMLUP00000003171  ...................Y.GLRIDNLS--......................RTLILKCNSYRH.ARLWAGAIE---
ENSMLUP00000011174  ...................Y.CFEVTTSS--......................GSKCFSCRSAAE.RDKWMENLRRA-
ENSMLUP00000011009  ...................F.CFEVTTSS--......................GTKCFACRSAAE.RDKWIENLQRA-
ENSMLUP00000005126  ...................S.FFKIITAK--......................AILKLQAGSAEE.AALWRDLVRK--
ENSMLUP00000008335  ...................N.SFVIITAN--......................RVLHCNADTPEE.MHHWITLLQR--
ENSMLUP00000014049  ...................Y.ILKMESHPHTtcwpg.................RTLYLLAPSFPD.KQRWVTALESV-
ENSMLUP00000013909  ...................R.IFRVTASQLTvppvt.................CTVLLLAESEGE.RERWLQVLG---
ENSMLUP00000019004  ...................V.DILLLVEKG-......................RTLYIHGHTKLD.FTVWHAAIEKA-
ENSMLUP00000004167  ...................V.DILLLVEKG-......................RTLYIHGHTKLD.FTVWHAAIEKA-
ENSMLUP00000022232  ...................A.AFRLDTAQ--......................RSHLLAADAPS-.------------
ENSMLUP00000018295  ...................R.GFTMVHETKKqek...................QQWYLCCEAQME.LPEWFAT-----
ENSMLUP00000021849  ...................H.CFQVTWVG--......................GSRCFSCRSAAE.RDRWIEDLR---
ENSMLUP00000006303  ...................C.IFRVTMSQLSapnnk.................CSILMLADSENE.KSKWVGVLSE--
ENSMLUP00000015098  ...................C.IFRVTASLLGspskt.................SSLLILTENENE.KRKWVGILE---
ENSMLUP00000006492  ...................F.CFEVTYLS--......................GSKCFSCNSASE.RDKWMENLRR--
ENSMLUP00000008454  ...................-.----------......................------------.------------
ENSMLUP00000010385  ...................H.CFTVQSESG-......................EDLYFSVELDCD.LAQWERAFQTA-
ENSMLUP00000009012  ...................H.SFALYTPERTrqr...................WPVRLATATEQD.MNDWLALLN---
ENSMLUP00000000189  ...................Q.VLVLVERR--......................RTLYIQGERRLD.FAGWLGSIQKA-
ENSMLUP00000014285  ...................-.----------......................------------.------------
ENSMLUP00000006019  ...................G.AFLLTTTE--......................RSHLLAAQHR--.-QEWMGPI----
ENSMLUP00000011245  ...................-.-------S--......................------------.------------
ENSMLUP00000007987  ...................E.HLVLVETG--......................RTLYLQGEGRLD.FSAWNVAIGGA-
ENSMLUP00000008335  ...................-.----------......................------------.------------
ENSMLUP00000000103  ...................H.CLAFSSSGPQs.....................QTYYICFDTFTE.YLRWLRQVSK--
ENSMLUP00000020572  ...................H.CLAFSSSGPQs.....................QTYYICFDTFTE.YLRWLRQVSK--
ENSMLUP00000009684  ...................-.----------......................------------.------------
ENSMLUP00000018770  ...................R.SLVLGWP---......................TVNLVATFRPEQ.KGKWLSLLQR--
ENSMLUP00000007942  ...................Y.SLAFSSAGAQa.....................QTYHVSFETLAE.YQRWQ-------
ENSMLUP00000008949  ...................L.SFATRTGTRQgi....................ETHLFRAEISRD.LSHWTRSI----
ENSMLUP00000007075  ...................M.ELKLSSHE--......................-----------E.------------
ENSMLUP00000012217  ...................F.PLILWHPSA-......................RHYYFCMMTEAE.QEKWQAVLQDCI
ENSMLUP00000014260  ...................Y.GVRIDTSH--......................RSLILKCSSYRQ.ARWWGQEITE--
ENSMLUP00000021545  ...................-.----------......................------------.------------
ENSMLUP00000013488  ...................-.----------......................ESYLLMAGTQHD.MEDWVKSIRRVI
ENSMLUP00000000189  ...................L.TYPLFSHS--......................YVSSFSAETELE.KEQWLEAMQGAI
ENSMLUP00000005075  ...................-.------T---......................------------.------------
ENSMLUP00000014442  ...................P.ALPPVQPRS-......................SVWEGSAQXEDE.RKSWMALLRR--


                                                                                                    
                                                                                                    
d2elba2               s.............................................................................
ENSMLUP00000006551  ygklfdfvnakklnikn.............................................................
ENSMLUP00000010306  frwlipisalqvrlgnaagtentsiwelihtksetegrpetifqlccsdsesktnivkvirsilrenfrrh.......
ENSMLUP00000002181  kpcsrplssilgrsnlkfagmpitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrac
ENSMLUP00000007103  mdhplrtisyiadignivvlmarrrmprsnsqenveashpsqdgkrqykmichvfesedaqliaqsigqafsvayqef
ENSMLUP00000015991  ergtgdvkllkhkekgtirllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfaderpkpellairflnae
ENSMLUP00000011751  istcsltlmnldnhqiianhhmqsisfasggdpdttdyvayvakdpvnqrachilecrngmaqdvittigqafelrfk
ENSMLUP00000006051  nlrtsdskqiianhhmqsisfasggdpdttdyvayvakdpvnrrachileccdglaqdvigaigqafelrfkqylr..
ENSMLUP00000006484  qdgtgrsafigigftdrgdafdfnvslqdhfkwvkq..........................................
ENSMLUP00000022507  kwvadsqacrvfgfvarkqgsatdnvchlfaehdpeqpasaivnfvskvmi...........................
ENSMLUP00000014236  dhalrtisyiadignivvlmarrrmpraasqdciettpgapegkkqykmichvfesedaqliaqsigqafsvayqefl
ENSMLUP00000006854  tfcdldpqerkwmkteggapaklfgfvarkqgsttdnachlfaeldpnqpasaivnfvskvml...............
ENSMLUP00000003954  rynsdlvqkyhpcfwidgqylccsqtaknamgcqil..........................................
ENSMLUP00000009991  institpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksqekmeltstpsqesagg
ENSMLUP00000007057  caeeitltigqafnlayrkflesggk....................................................
ENSMLUP00000019012  iaeheirniscaaqdpedlstfayitkdlksnhhychvftafdvnlayeiiltlgqafevayqlal............
ENSMLUP00000005088  gignvkilrhktsgkirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadefpkpeqlairfktpeeaa
ENSMLUP00000009827  dhalqtisyiadigsvlvimarrrlarrpasqahghrlykmichvfhsddaqliaqaigqafavaysqflr.......
ENSMLUP00000007432  sqcnqkrltvyhpsaylnghwlccrassdtapgcspct........................................
ENSMLUP00000014622  iianhhmqsisfasggdtdmtdyvayvakdpinqrachilecceglaqsvistvgqafelrfkqyl............
ENSMLUP00000004098  cgmdpeqrkwqkyckpswifgfvaksqtnsqenvchlfaeydtvqpasqvislvgall....................
ENSMLUP00000014409  eetrnnnslvskyhpnfwmdgrwrccaqleklavgcaqy.......................................
ENSMLUP00000004165  vwrhryqshp....................................................................
ENSMLUP00000005117  caderrrvqedremgmeisenqkklamln.................................................
ENSMLUP00000011092  gkhaltvsyfydatrnvyriisiggakaiinstvtpnmtftktsqkfgqwadsrantvyglgfaseqhltqfaekfqe
ENSMLUP00000001759  aprlrinkrilqlcmgnhelymrrrkpdtievqqmkaqareekhqkqlerqqletekkrretverekeqmmrek....
ENSMLUP00000005088  qnydnkqvrivmrrdqvlklcanhritpdmtlqnmkgtervwvwtacdfadgerkvehlavrfklqdvadsfkkifde
ENSMLUP00000005088  mrrdqvfkvcanhvitktmelkplnvsnnalvwtasdyadgeakveqlavrfktkemadcfkrkfeecqqnllk....
ENSMLUP00000014421  plntiqhcqavmhscnydsilalvckeptqnkpdlhlfqcdeikanlitediesaisds...................
ENSMLUP00000007415  yaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqmerallenekkkremaekekeki.......
ENSMLUP00000000876  nmhnlvepvnkdlefqlhepfllyrnaslsiysiwfydkndchriaklmsevveee......................
ENSMLUP00000012407  pfvldaslgvisrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeyk.
ENSMLUP00000010866  aprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqleraqlenekkkreiaekekek.........
ENSMLUP00000015289  ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlnsqetgptlprqnsqlpaqvqngpsqe
ENSMLUP00000014093  drafsyicrdgttrrwichcfmavkdtgerlshavgcafaaclerkqkreke..........................
ENSMLUP00000005088  lmrreqvlkvcanhwitttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecq........
ENSMLUP00000016145  eirgnphllikyhsgffvegkflccqqsckaapgctl.........................................
ENSMLUP00000000362  drnldkafsyicrdgttrrwichcflalkdsgerlshavgcafaaclerkqrreke......................
ENSMLUP00000004624  iltdgitsqlienvsiyrisyctadkmhgkvfayiaqsqhnenlechaflctkrkmaqavtltvaqafkvafefwqvs
ENSMLUP00000004420  sfmgvgkdihtfafimdtgnqrfechvfwcepnaanvseavqaacmlryqk...........................
ENSMLUP00000007170  vsrcnqnrlssyhpsaylngswlccqetsesalgckpct.......................................
ENSMLUP00000007524  tltvvsgpdmvdltfhnfvsykenvgkdwaedilalvkhpltsn..................................
ENSMLUP00000011865  wtnpdgttskpgspwenvchlfaeldpdqpagaivtfitkvllgq.................................
ENSMLUP00000009407  lrvnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqmerqrlarekqmreeaertrde............
ENSMLUP00000017210  lrvnklilqlcignhdlfmrrrkadslevqqmkaqareekarkqmerqrlarekqmreeaertrde............
ENSMLUP00000001866  eerkmvqedekigfeisenqkrqaam....................................................
ENSMLUP00000007867  rl............................................................................
ENSMLUP00000011713  danssyqdtleflmasrdfcksfwkicvehhaffrlfeepkpkpkpvlfsrgssfrfsgrtqkqvldyvkegghkkvq
ENSMLUP00000009897  alkqeghsrrdmfeiltrhafplahslpifafvn............................................
ENSMLUP00000009921  sklgifenlnkhafplsngqtlfafnyk..................................................
ENSMLUP00000000027  engrrafiglgfgdrgdafdfnvalqdhfkwvkq............................................
ENSMLUP00000019003  engrrafiglgfgdrgdafdfnvalqdhfkwvkq............................................
ENSMLUP00000006515  rklsfkrkrfliklhpevhgpyqdtlefllgsrdecknfwkicveyhtffrlfdqpkpkakavlfsrgssfrysgrtq
ENSMLUP00000010025  vr............................................................................
ENSMLUP00000003276  rrygydsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvversnhqtelevprtpr......
ENSMLUP00000012185  hraakrlwkvcvehhtfyrlvspeqppkakfltlgskfrysgrtqaqtrqastlidrpaphfertsskr.........
ENSMLUP00000009828  kglkynqatptfhqwrdarqvyglnfaskeeattfsnamlfalnimnsqeggpstqrqvqngpspdemdiqrrqv...
ENSMLUP00000000547  i.............................................................................
ENSMLUP00000006939  apdfvfyapclrinkrivplcmgnqelymrrrkpdtievqqmkaqareekhlrqlerqqletekrreav.........
ENSMLUP00000013213  qffiqlrkelhesretllgfnmvnyracknlwkacvehhtffrldrplppqknffahyftlgskfrycgrtevqsvqy
ENSMLUP00000010899  vciehhtffrlvspepppkgflvmgskfrysgrtqaqtrqasalidrpapfferssskr...................
ENSMLUP00000014701  ikirpgefeqfestigfklpnhraakrlwkvcvehhtffrlllpeappkkfltlgskfrysgrtqaqtrrasalidrp
ENSMLUP00000001355  leftmasrdvckafwktcveyhaffrlseepkskpktllcskgssfrysgrtqrqlleyggkgrlkslpferkh....
ENSMLUP00000004002  gagppggstllfqcpevgaerlrtslqkalke..............................................
ENSMLUP00000003010  rm............................................................................
ENSMLUP00000014344  islqyrstlermldvtmlqeekeeqmrlpsad..............................................
ENSMLUP00000011779  et............................................................................
ENSMLUP00000004968  cgaegqhqffaiktgqqaeplvidlkdlfqviynvkkkeeekkk..................................
ENSMLUP00000006705  vdpgdse.......................................................................
ENSMLUP00000013438  yestigfklpsyraakklwkvcvehhtffrltstdtlpkskflalgskfrysgrtqaqtrqasalidrpaphfertas
ENSMLUP00000013178  amlafhtstpaackhlwkcgvenqafykyakssqiktvssskiffkgsrfrysgkvakevveassriqreppevhrtn
ENSMLUP00000017586  ctfayitkdlqtghhychvfstvdvtltyeiiltlgqafevayqlal...............................
ENSMLUP00000000009  ackhlwkcavehhaffrlrgpvqkgsqrsgfirlgsrfrysgkteyqttktnkarrstsferrpskr...........
ENSMLUP00000009616  ltsqlqacreasqhr...............................................................
ENSMLUP00000001998  ckhlwkcavehhaffrlrtpgnsksnrsdfirlgsrfrfsgrteyqathgar..........................
ENSMLUP00000012742  lfsfesgrrcqtgqgifafkcsraeeifnllqdlmqcnsinvmeepviitrnshpaeldlp.................
ENSMLUP00000000119  ivfieeqaagigksakivvhlhpappnkelgplqssknsyiklsfkehgqiefyrrlseemtqrrw............
ENSMLUP00000003793  mlt...........................................................................
ENSMLUP00000003076  islhyrstldrmldsvllkeeneqplrlpspev.............................................
ENSMLUP00000013179  fll...........................................................................
ENSMLUP00000012676  rdkmvvlecmlkkdliynkvtptfhhwkiedkkfgltfqspadarafdrgirraiedisq..................
ENSMLUP00000013417  itkhpadhrlachvfvseestkvlaesvgrafqqfykqfveytc..................................
ENSMLUP00000010021  ltiaenmadlidgycrlvngasqsfiirp.................................................
ENSMLUP00000005492  vesc..........................................................................
ENSMLUP00000017245  nim...........................................................................
ENSMLUP00000005975  nim...........................................................................
ENSMLUP00000013604  lweqelynnfvynsprgyfhtfagdtcqvalnfaneeeakkfrkavtdllgrr.........................
ENSMLUP00000013658  vesc..........................................................................
ENSMLUP00000014884  qkispegkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan......................
ENSMLUP00000015073  rlyslqtglllweqelysqlvystpttffhtfagddcqvglnfadeseaqafqalvqekiqkr...............
ENSMLUP00000011388  ihnfrann......................................................................
ENSMLUP00000004364  kiiltyfaptpeackhlwkcgienqafyklekssqvrtvsssnlffkgsrfrysgrvakevmessaqikreppeihs.
ENSMLUP00000009774  ggpefqhcshffqmknisfcgchprnscyfgfitkhpllsrfachvfvsqesmrpvaqsvgrafleyyqehl......
ENSMLUP00000008949  nvs...........................................................................
ENSMLUP00000013558  ritamdtedqgvkvflisasskdtgqlyaalhhrilalrs......................................
ENSMLUP00000013327  ckhlwkcsvehhtffrmpenesnsmsrklskfgsmsykhrysgrtalqmsrdlsiqlprpdqnvarsrsk........
ENSMLUP00000013892  qtk...........................................................................
ENSMLUP00000011043  maagpasfcchmfwcepnaaslseavqaacmlryqk..........................................
ENSMLUP00000004420  kaiatslheicskimae.............................................................
ENSMLUP00000001083  rllwkqavhn....................................................................
ENSMLUP00000006407  dtrtgryarlpkdpkirevlgfggpdarleeklmtvvagpdpvnttflnfmavqddtakvwaeelfklamnilaqn..
ENSMLUP00000020850  tlrpgliynkvnpifhhwslgdckfgltfqspaeadefqrsllaalaalg............................
ENSMLUP00000001631  sapnpdklatchpgafrgarwtcclqaelsaagcshth........................................
ENSMLUP00000007486  grmcdtgeglftfqtregemiyqkvhsatlaiaeqherlmlemeqkarlqtsltepmtlsks................
ENSMLUP00000008206  genngdsshnpvlaatgigldvaqswekairqalm...........................................
ENSMLUP00000013539  ..............................................................................
ENSMLUP00000015365  irereq........................................................................
ENSMLUP00000020676  irereq........................................................................
ENSMLUP00000006371  qllwrqaahn....................................................................
ENSMLUP00000007133  rli...........................................................................
ENSMLUP00000002508  lkerer........................................................................
ENSMLUP00000001462  aq............................................................................
ENSMLUP00000015489  ilwrqvlr......................................................................
ENSMLUP00000019635  rrcghsenfffievgrsavtgpgefwmqvedsvvaqsmhetileamram.............................
ENSMLUP00000005155  qi............................................................................
ENSMLUP00000010240  llkqqell......................................................................
ENSMLUP00000004993  vaq...........................................................................
ENSMLUP00000002012  scvehhtffqakkllpreknvlsqywtlgsrnpnksvnnqyckkviggmvwnpamrrslsve................
ENSMLUP00000009146  s.............................................................................
ENSMLUP00000002140  qeriihl.......................................................................
ENSMLUP00000014437  qegeqiyqrvhsatlaiaeqhkrvllem..................................................
ENSMLUP00000003504  sisrdpfy......................................................................
ENSMLUP00000001212  atass.........................................................................
ENSMLUP00000000142  aisniypenatanghdfqmfsfeettsckacqmllrgtfyq.....................................
ENSMLUP00000011713  t.............................................................................
ENSMLUP00000011537  sitrvpfy......................................................................
ENSMLUP00000008290  feagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeqherllqsvkns.............................
ENSMLUP00000011975  giqqrlal......................................................................
ENSMLUP00000012342  idafhqryetfrnaiakdndiqsevstaelgkrapr..........................................
ENSMLUP00000022464  vesc..........................................................................
ENSMLUP00000006515  s.............................................................................
ENSMLUP00000002051  cqriaelmknltqye...............................................................
ENSMLUP00000009895  gl............................................................................
ENSMLUP00000003910  inesq.........................................................................
ENSMLUP00000010202  vq............................................................................
ENSMLUP00000000726  ilenqrnfl.....................................................................
ENSMLUP00000014255  rekkfsvevhdprrasvtrrtfghsgiavhtwyacpaliksiwamaisqhqfyldrkqskskihaarslseiaidlte
ENSMLUP00000009304  itcis.........................................................................
ENSMLUP00000000726  qe............................................................................
ENSMLUP00000018812  eiqranprnlrvtatdledysikvfliqatakdteslyaaihhrlvalrs............................
ENSMLUP00000002452  eiqranprnlrvtatdledysikvfliqatakdteslyaaihhrlvalrs............................
ENSMLUP00000009837  vgenvvnpsspspsgsvltsgvgadvarmwevaiqhalm.......................................
ENSMLUP00000015435  lilenhaakipa..................................................................
ENSMLUP00000009557  sinntgllgsyhpgvfrgdkwscchqkdktdlgcdrt.........................................
ENSMLUP00000015519  ltitelsvpqhvsllpgqvirlhevlekekkrr.............................................
ENSMLUP00000004997  hssliksiwvmaisqhqfyldrkqskakipsarslddiamdltemgtprtsklvtleaksqfimasn...........
ENSMLUP00000009040  lspgpcp.......................................................................
ENSMLUP00000009186  svri..........................................................................
ENSMLUP00000006019  flrkfgsdkdvfsfeagrrcdsgeglfafssprardlcgvvtaaiarqkerlpelvgprpcplpratslp........
ENSMLUP00000004311  vesc..........................................................................
ENSMLUP00000006153  v.............................................................................
ENSMLUP00000001771  dqiekrn.......................................................................
ENSMLUP00000003867  gficressggggfhfvcyvfqctnealvdeimmtlkqaftvaavqq................................
ENSMLUP00000003333  a.............................................................................
ENSMLUP00000020254  a.............................................................................
ENSMLUP00000007954  in............................................................................
ENSMLUP00000014165  ctgq..........................................................................
ENSMLUP00000015532  ddienakyisrlfatrhkfykqnkicteqsnspppirrqptwsrsslprqqpyilppmhvqcgehysethtsqd....
ENSMLUP00000006515  eaaks.........................................................................
ENSMLUP00000015042  sr............................................................................
ENSMLUP00000000573  ..............................................................................
ENSMLUP00000002140  letqrdfl......................................................................
ENSMLUP00000009833  gapqslsiktsslaeaenmadlidgycrlqgehkasliihp.....................................
ENSMLUP00000014256  lrv...........................................................................
ENSMLUP00000014449  eagrrcvsgegnfefetrqgneiflaleeaisaqksvpppgpqtqpapap............................
ENSMLUP00000002296  seqyidtekkk...................................................................
ENSMLUP00000001022  aqilesqrdfl...................................................................
ENSMLUP00000015339  vqtrepyevaqfnvehfsgmhnwyacsharpt..............................................
ENSMLUP00000012336  yli...........................................................................
ENSMLUP00000022476  eiknnnnimikyhpkfwadgsyqccrqteklapgceky........................................
ENSMLUP00000014752  lhgkwlfteirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnylprvg......................
ENSMLUP00000011116  vtd...........................................................................
ENSMLUP00000006182  ..............................................................................
ENSMLUP00000002497  emalsnirpdhadsnfhefkmhtfsrvtsckacqmllrgtfyq...................................
ENSMLUP00000001331  s.............................................................................
ENSMLUP00000009696  tllkheqt......................................................................
ENSMLUP00000007783  sadk..........................................................................
ENSMLUP00000013998  aavfsappfpaaigsqkkfsrpllp.....................................................
ENSMLUP00000002874  pardfafvagdkdscmlkchvfrcdvpakaiasalhglcaqil...................................
ENSMLUP00000004775  lecyvrkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgvrkaied...........................
ENSMLUP00000002874  adlgrqsfqcaafwcqphagglseavqaacms..............................................
ENSMLUP00000015873  vqnrehfeptqysmdhfsgmhnwyacsharpt..............................................
ENSMLUP00000019971  s.............................................................................
ENSMLUP00000009770  lsirrcghseqyfflevgrstvigpgelwmqvddcvvaqnmhelflekmkal..........................
ENSMLUP00000008335  v.............................................................................
ENSMLUP00000020205  sfdylrlvvreleqqla.............................................................
ENSMLUP00000014596  l.............................................................................
ENSMLUP00000011059  eknfkdisscsqgikhvdhfgficrespepglsqyicyvfqcaseslvdevmltlkqafsta................
ENSMLUP00000019635  lq............................................................................
ENSMLUP00000004596  fl............................................................................
ENSMLUP00000004060  llkv..........................................................................
ENSMLUP00000010430  pasklfchlfvgrqpgevqilhlllcrsfqlay.............................................
ENSMLUP00000000775  cyifesnnegekicdsvglakqialhaeldrr..............................................
ENSMLUP00000006337  ar............................................................................
ENSMLUP00000010159  lakakavkvlqesd................................................................
ENSMLUP00000004167  al............................................................................
ENSMLUP00000001945  qtdnskvcqyllhlcssqhkfqlqmkarqsnqdaq...........................................
ENSMLUP00000014265  kptanqktqllvradtnlgnillnvlippnmpctrtgknnvlivcvpnppqdeknaapvtmlirvktsedadelhqvl
ENSMLUP00000004630  yreaqqlvqrvpkm................................................................
ENSMLUP00000014463  vlgpnqklkfnpteliiyckdfrivrfrfdesgpesakkvclaiahysqptdlqllfafey.................
ENSMLUP00000011713  id............................................................................
ENSMLUP00000010988  nsivllfkmistraasglyraitethafyrcdtvtsavmmqysrdlkghlaslflnenin..................
ENSMLUP00000022232  qsqilepllswpytllrrygrdkvmfsfeagrrcpsgptspsrrhrgndifqvvetaingqr................
ENSMLUP00000012079  iata..........................................................................
ENSMLUP00000015465  lragv.........................................................................
ENSMLUP00000001381  llv...........................................................................
ENSMLUP00000014433  e.............................................................................
ENSMLUP00000002430  ylv...........................................................................
ENSMLUP00000001136  esshgseefqihvftceikeavsrilysfctafkrssrqvsdv...................................
ENSMLUP00000007700  flragvy.......................................................................
ENSMLUP00000002685  lffenhpas.....................................................................
ENSMLUP00000003527  lfcvrghdgtpesdcfafteshynaelfrihvfrceiqeavsrilysfatafrrsak.....................
ENSMLUP00000000189  a.............................................................................
ENSMLUP00000005172  fyvshdsqdlkifsyiardgasnvfrcnvfkskkksqamrivrtvgqafevchklslqh...................
ENSMLUP00000005760  vaamf.........................................................................
ENSMLUP00000003875  h.............................................................................
ENSMLUP00000014433  ieeya.........................................................................
ENSMLUP00000010635  iatayr........................................................................
ENSMLUP00000001299  sc............................................................................
ENSMLUP00000014110  sildakplvllmewpeatnfacliagycrllmdsrkmvftrp....................................
ENSMLUP00000010539  ewnltnikrwaaspksftldfgdyqdgyysvqttegeqiaqliagyidii............................
ENSMLUP00000011416  tiskhkqnsqtfkafsa.............................................................
ENSMLUP00000001779  cvadarlpkvfawvyrhelkhkavmlrchavlvskpekaqamalllyqtsanalaefkrlkrrd..............
ENSMLUP00000015042  kc............................................................................
ENSMLUP00000005045  ylm...........................................................................
ENSMLUP00000004048  k.............................................................................
ENSMLUP00000015550  iqintdslvqe...................................................................
ENSMLUP00000005543  ..............................................................................
ENSMLUP00000002060  vanslkq.......................................................................
ENSMLUP00000002846  v.............................................................................
ENSMLUP00000015512  llmeq.........................................................................
ENSMLUP00000008542  lttvkrwaaspksftldfgeyqesyysvqttegeqisqliagyidii...............................
ENSMLUP00000014804  flragvyp......................................................................
ENSMLUP00000010863  aaathsappfpaavgsqrrfvrpilp....................................................
ENSMLUP00000000163  ..............................................................................
ENSMLUP00000010492  afcnlrksspgtsn................................................................
ENSMLUP00000012859  ilqlnfeaamqerrng..............................................................
ENSMLUP00000011587  hvldvkpitllmessdamnlacltagyyrllvdsrrsifnm.....................................
ENSMLUP00000018248  etfteaqrllrrap................................................................
ENSMLUP00000007856  etfteaqrllrrap................................................................
ENSMLUP00000014214  cplrsrhllqllsnshrlymnlqpilrhirkleeneekkqyresyisdnldldmdqlekrsrasgss...........
ENSMLUP00000008400  ilrht.........................................................................
ENSMLUP00000004048  hagqpg........................................................................
ENSMLUP00000004605  lalk..........................................................................
ENSMLUP00000006812  qsnyflnfkk....................................................................
ENSMLUP00000014871  takymwrlcvarhkfyrlnqcslqtptvtvnlirrrsssrmslpkpqpyampappplhynghytepytssq.......
ENSMLUP00000010926  khvhpts.......................................................................
ENSMLUP00000012190  tshsvddpmlsfmmpfdlmsnctleqpvfapnyiqgtiqaapdggwegqatfklsfrkggaitffqlm..........
ENSMLUP00000012996  tvrpis........................................................................
ENSMLUP00000013711  ltvvelrvpsnltllpghlymmaealakeearr.............................................
ENSMLUP00000006780  i.............................................................................
ENSMLUP00000005342  kvylqdikvltlllesnsakdlaclvagyyrlfvdpvtsiflwp..................................
ENSMLUP00000006369  lak...........................................................................
ENSMLUP00000010845  anaarsseqnlqvtlrnkaqdpmgghelr.................................................
ENSMLUP00000015600  ilqispegplq...................................................................
ENSMLUP00000010640  krryllqpiavevfsgdgrnyllafqkgirnkvyqrfl........................................
ENSMLUP00000000416  ic............................................................................
ENSMLUP00000012342  fla...........................................................................
ENSMLUP00000007987  lke...........................................................................
ENSMLUP00000012982  ktqqa.........................................................................
ENSMLUP00000014543  icgfsqa.......................................................................
ENSMLUP00000000775  i.............................................................................
ENSMLUP00000004637  atgqsykpipaiqtqkl.............................................................
ENSMLUP00000007008  atgqshkpvpptqvqk..............................................................
ENSMLUP00000001540  vqqge.........................................................................
ENSMLUP00000007555  lv............................................................................
ENSMLUP00000010202  skitv.........................................................................
ENSMLUP00000009696  a.............................................................................
ENSMLUP00000000439  va............................................................................
ENSMLUP00000021531  va............................................................................
ENSMLUP00000008335  tdtkapidtptqqli...............................................................
ENSMLUP00000003131  vtmqssddgslaregegvlrtschvfmvdpdlfnhkihqgiarrfgfectadpdtngc....................
ENSMLUP00000002636  s.............................................................................
ENSMLUP00000012863  drlpkdpstps...................................................................
ENSMLUP00000005038  ictqhhteaigknnpplksrs.........................................................
ENSMLUP00000007090  vcnlghld......................................................................
ENSMLUP00000020254  msikk.........................................................................
ENSMLUP00000006780  icyainl.......................................................................
ENSMLUP00000001391  lqkk..........................................................................
ENSMLUP00000002099  hssgkqp.......................................................................
ENSMLUP00000004060  atggssakvgtay.................................................................
ENSMLUP00000004167  kqfvpffaenltqanydligqlyykdchaldq..............................................
ENSMLUP00000006989  skdeal........................................................................
ENSMLUP00000015169  sgntyfhitignlvrgskllcetslgykmddlltsyisqm......................................
ENSMLUP00000000788  ls............................................................................
ENSMLUP00000010633  ..............................................................................
ENSMLUP00000012424  ldstkvrddvyhsil...............................................................
ENSMLUP00000021545  rqwnvnwdirqvaiefdehinvafscvsascrivheyiggyifls.................................
ENS