SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.


YVTN repeat-like/Quinoprotein amine dehydrogenase alignments

These alignments are sequences aligned to the 0048144 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                    10        20        30        40        50        60        70        80        
                     |         |         |         |         |         |         |         |        
d1mdah_ ..ek--SKVAGSAAAASAAAASDGSSCDHGPGAISRRSHITLPAYFAGTTENWVSCAGCGVTLGHSLGAFLSLAVAGHSGSDFALASTSFAR
d2bbkh_ depr----------------------ILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSR


        90       100       110       120       130       140        150       160       170       18
         |         |         |         |         |         |          |         |         |         
d1mdah_ SAKGKRTDYVEVFDPVTFLPIADIELPDAPRFSVGPRVHIIGNCASSACLLFFLFGSS.AAAGLSVPGASDDQLTKSASCFHIHPGAAATHY
d2bbkh_ IARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPApAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFF


        0       190        200       210       220        230       240       250       260       27
        |         |          |         |         |          |         |         |         |         
d1mdah_ LGSCPASLAASDLAAAPAAA.GIVGAQCTGAQNCSSQAAQANYPGMLVW.AVASSILQGDIPAAGATMKAAIDGNESGRKADNFRSAGFQMV
d2bbkh_ MHCRDGSLAKVAFGTEGTPEiTHTEVFHPEDEFLINHPAYSQKAGRLVWpTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQV


        0       280        290       300       310       320       330       340       350       360
        |         |          |         |         |         |         |         |         |         |
d1mdah_ AKLKNTDGIMILTVEH.SRSCLAAAENTSSVTASVGQTSGPISNGHDSDAIIAAQDGASDNYANSAGTEVLDIYDAASDQDQSSVELDKGPE
d2bbkh_ AYHRALDRIYLLVDQRdEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGP


                  
                  
d1mdah_ SLSVQNE-a.
d2bbkh_ QVITTAD-mg


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048144 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Methylacidiphilum infernorum V4
NoYes   Azoarcus sp. BH72
NoYes   Burkholderia phymatum STM815
NoYes   Ralstonia eutropha JMP134
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Advenella kashmirensis WT001
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Methylotenera mobilis JLW8
NoYes   Methylobacillus flagellatus KT
NoYes   Caulobacter sp. K31
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Paracoccus denitrificans PD1222
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Pseudomonas entomophila L48
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Alcanivorax dieselolei B5
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]