SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

WD40 repeat-like alignments in Danio rerio 69_9

These alignments are sequences aligned to the 0048759 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1pgua1               ssislkeii.....................................................................
ENSDARP00000017859  pnyt..........................................................................
ENSDARP00000039257  wiprpp........................................................................
ENSDARP00000042217  wiprpp........................................................................
ENSDARP00000080947  rrgdl.........................................................................
ENSDARP00000026057  dp............................................................................
ENSDARP00000116595  ah............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  iml...........................................................................
ENSDARP00000088166  vnnfcs........................................................................
ENSDARP00000103157  vnnfcs........................................................................
ENSDARP00000111963  ldqlrqeaeqlknqirdarkacadatlsqitanidpvgriqmrt..................................
ENSDARP00000018443  ldqlrqeaeqlknqirdarkacadatlsqitanidpvgriqmrt..................................
ENSDARP00000079424  ldqlrqeaeqlknqirdarkacadatlsqitanidpvgriqmrt..................................
ENSDARP00000015825  lpsicfyt......................................................................
ENSDARP00000024623  wkl...........................................................................
ENSDARP00000051230  eleqlrqeaeqlrnqirdarkacgdstltqitagldpvgriqmrt.................................
ENSDARP00000044330  rldi..........................................................................
ENSDARP00000079567  askam.........................................................................
ENSDARP00000017443  meqlrkeaeklkdditaarktvqdltlqdhvagtavvgrvqlkt..................................
ENSDARP00000107302  qwhppw........................................................................
ENSDARP00000005843  eqmkkeaeglktqieaarkaahdtdmaaaaagvapaprvqlk....................................
ENSDARP00000104051  nlslsks.......................................................................
ENSDARP00000061000  qmtvrgt.......................................................................
ENSDARP00000017497  grhnlqr.......................................................................
ENSDARP00000011435  raklhdvelhqvaekiealgqfvmktr...................................................
ENSDARP00000072190  klhdvelhqvaekmealgqfvmktr.....................................................
ENSDARP00000037531  grhnlqr.......................................................................
ENSDARP00000038258  tvcfyafq......................................................................
ENSDARP00000076048  n.............................................................................
ENSDARP00000060977  lpqhlwrtvdc...................................................................
ENSDARP00000079570  n.............................................................................
ENSDARP00000060431  ylpkk.........................................................................
ENSDARP00000027484  vrtstnkv......................................................................
ENSDARP00000076693  sr............................................................................
ENSDARP00000089117  rhikf.........................................................................
ENSDARP00000079014  kckgt.........................................................................
ENSDARP00000122900  qhmkmhk.......................................................................
ENSDARP00000106094  lic...........................................................................
ENSDARP00000105402  lic...........................................................................
ENSDARP00000107355  fetks.........................................................................
ENSDARP00000099894  kmhrr.........................................................................
ENSDARP00000114236  yqhmkmhr......................................................................
ENSDARP00000068184  ikf...........................................................................
ENSDARP00000024391  pl............................................................................
ENSDARP00000096338  fhvsadgqmqpvpfppdallgpgiprh...................................................
ENSDARP00000117865  fhvsadgqmqpvpfppdallgpgiprh...................................................
ENSDARP00000105810  eeglsr........................................................................
ENSDARP00000109528  pstalhi.......................................................................
ENSDARP00000110967  ktwnp.........................................................................
ENSDARP00000097371  g.............................................................................
ENSDARP00000068663  qllllprtgrlitvtaehnillyqtptlavq...............................................
ENSDARP00000096387  r.............................................................................
ENSDARP00000073472  nnnk..........................................................................
ENSDARP00000056247  r.............................................................................
ENSDARP00000045014  leqlrqeadqlrnqirdarkacsdstlsqmtasldsvgriqmrt..................................
ENSDARP00000090792  sipggkpaysfhvsadgqmqpvpfppdaligpgiprha........................................
ENSDARP00000019743  kpaysfhvsadgqmqpvpfppdaligpgiprha.............................................
ENSDARP00000028733  rkparkiskipfkvldapelqddfylnlvdwsa.............................................
ENSDARP00000104487  ktwnp.........................................................................
ENSDARP00000079959  ktwn..........................................................................
ENSDARP00000065646  pdp...........................................................................
ENSDARP00000005989  kfg...........................................................................
ENSDARP00000062413  dwn...........................................................................
ENSDARP00000003004  ksqkllrsprkptrkiskipfkvldapelqddfylnlvdwsslnvlsvgl............................
ENSDARP00000024168  rsfrva........................................................................
ENSDARP00000077651  led...........................................................................
ENSDARP00000124018  qvcripnkpmhs..................................................................
ENSDARP00000068125  kmawsnmnklvlqs................................................................
ENSDARP00000084377  q.............................................................................
ENSDARP00000109369  tled..........................................................................
ENSDARP00000004327  imhddwissve...................................................................
ENSDARP00000112164  ag............................................................................
ENSDARP00000109556  cyv...........................................................................
ENSDARP00000036145  q.............................................................................
ENSDARP00000101521  vqyepa........................................................................
ENSDARP00000101197  ss............................................................................
ENSDARP00000065847  dnir..........................................................................
ENSDARP00000099567  krlglea.......................................................................
ENSDARP00000038520  ll............................................................................
ENSDARP00000106434  f.............................................................................
ENSDARP00000033992  sahg..........................................................................
ENSDARP00000060548  eggvtsvtlrgdghqfyvgteaaqmyslsytdfkpelt........................................
ENSDARP00000105555  yrlrsslpa.....................................................................
ENSDARP00000087578  rcldlylcprqrkmrvnvnpedlipklpkpkdlq............................................
ENSDARP00000076761  lt............................................................................
ENSDARP00000119160  hng...........................................................................
ENSDARP00000099166  ql............................................................................
ENSDARP00000079110  e.............................................................................
ENSDARP00000028109  dyvrettrdiqrvprnydptlhpfevpreytralnatklervfakpf...............................
ENSDARP00000017792  il............................................................................
ENSDARP00000091471  ngintldievi...................................................................
ENSDARP00000015105  evts..........................................................................
ENSDARP00000005640  fll...........................................................................
ENSDARP00000112282  rlqcvhvaeghtkpl...............................................................
ENSDARP00000010862  eleqlrqeaeqlrnqirdarkacsdsslsqitagldsvgriqmrt.................................
ENSDARP00000112131  kieiei........................................................................
ENSDARP00000117542  kieiei........................................................................
ENSDARP00000027560  kdtyq.........................................................................
ENSDARP00000110861  lfkq..........................................................................
ENSDARP00000102565  ptegdf........................................................................
ENSDARP00000093657  e.............................................................................
ENSDARP00000008451  da............................................................................
ENSDARP00000110420  f.............................................................................
ENSDARP00000101565  p.............................................................................
ENSDARP00000111921  q.............................................................................
ENSDARP00000018714  ai............................................................................
ENSDARP00000097750  qrlklea.......................................................................
ENSDARP00000105810  tdvlfshsdatiiapdssnrlqvlsgstgavvlesee.........................................
ENSDARP00000065337  vagcyeqivfg...................................................................
ENSDARP00000016280  ssgdclkiwdsssmtvve............................................................
ENSDARP00000071264  vttfdlcknlnllvtggmdkvvrmwipyvprnptg...........................................
ENSDARP00000073678  whnk..........................................................................
ENSDARP00000070393  qrlelqgr......................................................................
ENSDARP00000100903  qllas.........................................................................
ENSDARP00000099551  dpt...........................................................................
ENSDARP00000063641  qllas.........................................................................
ENSDARP00000104754  v.............................................................................
ENSDARP00000014740  cvhvaeghskav..................................................................
ENSDARP00000106749  t.............................................................................
ENSDARP00000003237  kptdnlilagraekeccnleihvynseedslyvhhdillpayplcv................................
ENSDARP00000115064  y.............................................................................
ENSDARP00000071531  t.............................................................................
ENSDARP00000105980  en............................................................................
ENSDARP00000113946  sg............................................................................
ENSDARP00000079302  ml............................................................................
ENSDARP00000111824  dkkpq.........................................................................
ENSDARP00000008006  leifdmdfsdtsmdmklrgtlatsnrfhsliwva............................................
ENSDARP00000079585  tqk...........................................................................
ENSDARP00000104171  qldatfstnasleifeldladsalamkscg................................................
ENSDARP00000052711  pppdp.........................................................................
ENSDARP00000059208  pvllsk........................................................................
ENSDARP00000006309  pvlln.........................................................................
ENSDARP00000102210  s.............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  etssli........................................................................
ENSDARP00000092538  ktv...........................................................................
ENSDARP00000031340  savp..........................................................................
ENSDARP00000059344  sfkcvnslkedhgqplfgvqfnwhskegdplvfatvgsnrvtlyechsqgeirllqsyvdadadenfytc........
ENSDARP00000074880  s.............................................................................
ENSDARP00000026454  gggafmvlplhktg................................................................
ENSDARP00000099918  q.............................................................................
ENSDARP00000121552  h.............................................................................
ENSDARP00000007696  pt............................................................................
ENSDARP00000080844  v.............................................................................
ENSDARP00000071301  mivdasgggafivlplsktgridm......................................................
ENSDARP00000079585  sa............................................................................
ENSDARP00000106510  fqia..........................................................................
ENSDARP00000037121  v.............................................................................
ENSDARP00000124137  nln...........................................................................
ENSDARP00000039795  sggg..........................................................................
ENSDARP00000079663  wesrpplpgwhpkgl...............................................................
ENSDARP00000056762  pk............................................................................
ENSDARP00000024476  eqpfiklsqee...................................................................
ENSDARP00000126101  eqpfiklsqee...................................................................
ENSDARP00000087003  rv............................................................................
ENSDARP00000065205  gr............................................................................
ENSDARP00000110420  s.............................................................................
ENSDARP00000059666  ..............................................................................
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  leavi.........................................................................
ENSDARP00000078100  vfslqdedrlviiyacahvaviydhtsks.................................................
ENSDARP00000078191  qifinr........................................................................
ENSDARP00000078965  pkv...........................................................................
ENSDARP00000102373  ea............................................................................
ENSDARP00000006117  ekra..........................................................................
ENSDARP00000111140  ia............................................................................
ENSDARP00000094274  kfr...........................................................................
ENSDARP00000075344  sngfacsmgqgtvclfektekadlykktrvikippkrfsndlsltekqkistlcispseetlvastdlgqlysihlsi
ENSDARP00000106181  qan...........................................................................
ENSDARP00000089501  ktv...........................................................................
ENSDARP00000102443  ad............................................................................
ENSDARP00000038921  ca............................................................................
ENSDARP00000033554  d.............................................................................
ENSDARP00000100360  lqtilclacardeitysgalngdiyvwkginlir............................................
ENSDARP00000014182  hpk...........................................................................
ENSDARP00000027152  icktv.........................................................................
ENSDARP00000108102  v.............................................................................
ENSDARP00000107806  temq..........................................................................
ENSDARP00000007602  d.............................................................................
ENSDARP00000021430  evkr..........................................................................
ENSDARP00000087525  ltsgkdslts....................................................................
ENSDARP00000054317  nytvfeskwipcsakfvcmgnfa.......................................................
ENSDARP00000110907  i.............................................................................
ENSDARP00000074797  l.............................................................................
ENSDARP00000047739  qt............................................................................
ENSDARP00000079585  dghmqtmlsvafgannltftgaingdvfvwrehflvrvvakahtgpvftmyttlrdglivtggkerptkeggavklwd
ENSDARP00000055337  svf...........................................................................
ENSDARP00000058220  vyamnwsvrpdkrfrlalgsfveey.....................................................
ENSDARP00000102332  err...........................................................................
ENSDARP00000003173  dl............................................................................
ENSDARP00000064438  qqp...........................................................................
ENSDARP00000099721  d.............................................................................
ENSDARP00000026825  ad............................................................................
ENSDARP00000100187  qqdshfhfhqi...................................................................
ENSDARP00000059532  glccasfnqdstslavgtktgyrlfsvtsvdkldcihesaetpevyiverl...........................
ENSDARP00000099725  aq............................................................................
ENSDARP00000084300  dv............................................................................
ENSDARP00000124280  ggafivisvrhtgrvsp.............................................................
ENSDARP00000100360  lsvafgannltftgtisgdvcvwkehilvrivakahtgpvftmyttlrdglivtggkerpskeggalklwdqelkrcr
ENSDARP00000110672  kf............................................................................
ENSDARP00000060454  svs...........................................................................
ENSDARP00000098826  kgtqptchd.....................................................................
ENSDARP00000091438  sp............................................................................
ENSDARP00000098798  rle...........................................................................
ENSDARP00000091436  vl............................................................................
ENSDARP00000086480  ym............................................................................
ENSDARP00000099546  kg............................................................................
ENSDARP00000061333  a.............................................................................
ENSDARP00000037790  n.............................................................................
ENSDARP00000032005  d.............................................................................
ENSDARP00000008668  re............................................................................
ENSDARP00000103874  nktfawgyadlscrlsnyesdkavvvyeclsewgqil.........................................
ENSDARP00000043116  valfsghqedvc..................................................................
ENSDARP00000063737  dnqihiidfddennminksvllhdag....................................................
ENSDARP00000106107  anfnqdntslavgtksgykffslssvdkleqiyectdtedvciverlfss............................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  lf............................................................................
ENSDARP00000100360  lvatgqvgkepyicvwdsytvqtvsil...................................................
ENSDARP00000003197  aq............................................................................
ENSDARP00000012553  mldws.........................................................................
ENSDARP00000003663  rlid..........................................................................
ENSDARP00000069897  sk............................................................................
ENSDARP00000018434  edy...........................................................................
ENSDARP00000093342  t.............................................................................
ENSDARP00000100360  vte...........................................................................
ENSDARP00000102548  qg............................................................................
ENSDARP00000041156  nt............................................................................
ENSDARP00000108156  r.............................................................................
ENSDARP00000070070  e.............................................................................
ENSDARP00000018924  rieliq........................................................................
ENSDARP00000123525  d.............................................................................
ENSDARP00000109363  ekd...........................................................................
ENSDARP00000103752  ekd...........................................................................
ENSDARP00000101029  p.............................................................................
ENSDARP00000101492  kvlc..........................................................................
ENSDARP00000038543  gvemgsqv......................................................................
ENSDARP00000079585  tqrf..........................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  gvknnllyldeqtiifpcgnncvrynidqkfqrfipgters.....................................
ENSDARP00000083528  rdqevcvmawgd..................................................................
ENSDARP00000017678  r.............................................................................
ENSDARP00000097777  lsdwgepv......................................................................
ENSDARP00000109722  ..............................................................................
ENSDARP00000083772  sqridtaaildlkwchvpiser........................................................
ENSDARP00000065266  ..............................................................................
ENSDARP00000088806  tfl...........................................................................
ENSDARP00000109028  ..............................................................................
ENSDARP00000095457  tfl...........................................................................
ENSDARP00000086448  lgrlnkvfasqwlnhrqvvcgtkcntlfvvdvlsgqitripmlkdregrgevsqglggvgspfhfhnpgsvggldvq.
ENSDARP00000117869  q.............................................................................
ENSDARP00000035593  tve...........................................................................
ENSDARP00000086251  csdsnilclswkgrvpksekekpvcrr...................................................
ENSDARP00000054352  sfnqdttslvvgdrngyrlfslssvdrmdcihrgtessdvciaerlfssslmvvvsk.....................
ENSDARP00000024810  nq............................................................................
ENSDARP00000100292  vsdvdgggnp....................................................................
ENSDARP00000079585  sfyl..........................................................................
ENSDARP00000009095  sva...........................................................................
ENSDARP00000101029  grm...........................................................................
ENSDARP00000118167  csdsnilclswkgrvprsqke.........................................................
ENSDARP00000101029  pilklnri......................................................................
ENSDARP00000050905  s.............................................................................
ENSDARP00000078100  yl............................................................................
ENSDARP00000046545  psl...........................................................................
ENSDARP00000032408  ee............................................................................
ENSDARP00000104388  dc............................................................................
ENSDARP00000101882  qvsllqfsqvqrqtllsvhpp.........................................................
ENSDARP00000093519  wsrnap........................................................................
ENSDARP00000112439  istatlk.......................................................................
ENSDARP00000071650  gsvqadfspq....................................................................
ENSDARP00000099546  apggpl........................................................................
ENSDARP00000111616  fske..........................................................................
ENSDARP00000019506  psr...........................................................................
ENSDARP00000076262  slrghkgrvvgfaylag.............................................................
ENSDARP00000080599  ivaayahfvicyrikessgwqqvfsspylewaiervalnakvvggphg..............................
ENSDARP00000084220  nhsmirvl......................................................................
ENSDARP00000080965  hnwiavayaqfvvcyrvkestgwqqvftsprldwvidrvalnakvmggs.............................
ENSDARP00000123525  gsgigaftasgqrrciafsdlglkpsifiykypeleltselkgttkl...............................
ENSDARP00000018692  hvwigggsssqklgcvtavdletggslnqel...............................................
ENSDARP00000008672  ttphlayalaiddg................................................................
ENSDARP00000094999  vylt..........................................................................
ENSDARP00000116849  qk............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000072504  rfymv.........................................................................
ENSDARP00000052786  rg............................................................................
ENSDARP00000076812  lavlsetqisiwfsrpsvlivsyiesgkaaaqfgf...........................................
ENSDARP00000047833  lvla..........................................................................
ENSDARP00000097904  n.............................................................................
ENSDARP00000102548  are...........................................................................
ENSDARP00000082368  sdfecvqiipgaqng...............................................................
ENSDARP00000109749  cwqgslwiysdpklapsegfcragvqt...................................................
ENSDARP00000110965  vasgadstqg....................................................................
ENSDARP00000095605  alrl..........................................................................
ENSDARP00000091436  cp............................................................................
ENSDARP00000111846  ksscslvafntdhagggmvglssvnagadgkws.............................................
ENSDARP00000090283  thtgllcqfnsnrqldswvdl.........................................................
ENSDARP00000008223  ..............................................................................
ENSDARP00000005398  ftnrkvnsvcwasvthtdshvllclvgisq................................................
ENSDARP00000020383  ne............................................................................
ENSDARP00000114287  k.............................................................................
ENSDARP00000101793  gylwvasrgd....................................................................
ENSDARP00000059751  shm...........................................................................
ENSDARP00000117166  v.............................................................................
ENSDARP00000046545  rl............................................................................
ENSDARP00000060999  isllninqsvscltagtlgpkstgdtllvgsqtnllaydvhdntdvfykevtdganaivlgklgdiqsp.........
ENSDARP00000084929  mwlg..........................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000111156  drv...........................................................................
ENSDARP00000112085  erlklewvygyrgrdcranvyllptgeivyfia.............................................
ENSDARP00000100913  vasctnhmgqvsivalqnsnpkvtecfnvesrilcmthvpldeplkngegkpenrnacdm..................
ENSDARP00000003198  gkecv.........................................................................
ENSDARP00000027152  fpifenpypmdvhespvtctayfadcppdiipvlysigakhkktgyshkewpvs........................
ENSDARP00000106476  scqdhs........................................................................
ENSDARP00000104791  rvg...........................................................................
ENSDARP00000109373  gglmht........................................................................
ENSDARP00000092538  yavvvllekdlvvidlaqngypifenp...................................................
ENSDARP00000098142  wlgaqngclyvhssvarwrk..........................................................
ENSDARP00000044811  sv............................................................................
ENSDARP00000024810  apdpkq........................................................................
ENSDARP00000075280  gt............................................................................
ENSDARP00000076048  mv............................................................................
ENSDARP00000089501  pyavvvllekdlvvidlaqigypifenp..................................................
ENSDARP00000107630  tfkaledgcvldlclvrwp...........................................................
ENSDARP00000092069  ntvl..........................................................................
ENSDARP00000018100  tiir..........................................................................
ENSDARP00000108631  tiir..........................................................................
ENSDARP00000111537  ddnriseihlssgrtkkktpk.........................................................
ENSDARP00000035593  qrd...........................................................................
ENSDARP00000109913  sd............................................................................
ENSDARP00000103234  tc............................................................................
ENSDARP00000026432  rrvam.........................................................................
ENSDARP00000078268  stq...........................................................................
ENSDARP00000078255  faaapyggpiallkwhnrrspsarpqleiysssgl...........................................
ENSDARP00000102911  gsdkivcygfg...................................................................
ENSDARP00000032159  ss............................................................................
ENSDARP00000079570  tv............................................................................
ENSDARP00000007708  i.............................................................................


                                                         10           20                 30         
                                                          |            |                  |         
d1pgua1               ...........................---------PPQ..PSTQRN.FT.THLSYDP.....TT...N.........
ENSDARP00000017859  ...........................--------LKFT..LAGHTK.AV.SSVKFSP.....SG...E.........
ENSDARP00000039257  ...........................--------EKYA..LSGHRS.PV.TRVIFHP.....VF...S.........
ENSDARP00000042217  ...........................--------EKYA..LSGHRS.PV.TRVIFHP.....VF...S.........
ENSDARP00000080947  ...........................-------KSPKV..LKGHDD.HViTCLQFC-.....-G...N.........
ENSDARP00000026057  ...........................-------TLERH..FKGHKD.VI.SCADFNP.....NN...K.........
ENSDARP00000116595  ...........................------------..----IL.PL.TNVAFNK.....SG...S.........
ENSDARP00000074155  ...........................------------..--GHTE.AV.ISVAFSP.....TG...K.........
ENSDARP00000038728  ...........................------------..LSGHEG.EV.YCCKFHP.....NG...A.........
ENSDARP00000088166  ...........................------------..QIGDDR.PI.SYCQFSP.....NS...K.........
ENSDARP00000103157  ...........................------------..QIGDDR.PI.SYCQFSP.....NS...K.........
ENSDARP00000111963  ...........................---------RRT..LRGHLA.KI.YAMHWGT.....DS...R.........
ENSDARP00000018443  ...........................---------RRT..LRGHLA.KI.YAMHWGT.....DS...R.........
ENSDARP00000079424  ...........................---------RRT..LRGHLA.KI.YAMHWGT.....DS...R.........
ENSDARP00000015825  ...........................------------..FLNAYQ.GL.TAVDFTD.....DS...S.........
ENSDARP00000024623  ...........................----------QE..IVAHSS.NV.SSLVLGKs....SG...R.........
ENSDARP00000051230  ...........................---------RRT..LRGHLA.KI.YAMHWGT.....DS...R.........
ENSDARP00000044330  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079567  ...........................-----------V..LRGHES.EV.FICAWNP.....VS...D.........
ENSDARP00000017443  ...........................---------RKT..LRGHLA.KI.YAMHWGT.....DS...K.........
ENSDARP00000107302  ...........................-------KLYRV..ISGHLG.WV.RSIAVEP.....GN...Q.........
ENSDARP00000005843  ...........................--------TRKT..LKGHLA.KI.YAMHWCT.....DN...R.........
ENSDARP00000104051  ...........................------------..FKAHTM.AV.SFLALHP.....RK...M.........
ENSDARP00000061000  ...........................------------..LKGHSG.WV.TQIATTPq....FP...D.........
ENSDARP00000017497  ...........................---------IQC..RSENSK.GV.YCLQY--.....DD...E.........
ENSDARP00000011435  ...........................----------RT..LKGHGN.KV.LCMDWCK.....DK...R.........
ENSDARP00000072190  ...........................----------RT..LKGHGN.KV.LCMDWCR.....DK...R.........
ENSDARP00000037531  ...........................---------IQC..RSENSK.GV.YCLQYD-.....-D...D.........
ENSDARP00000038258  ...........................------------..--HTEQ.LL.NTAEVSA.....DS...R.........
ENSDARP00000076048  ...........................------------..-----K.DV.TSLDWNS.....EG...T.........
ENSDARP00000060977  ...........................------------..---QQG.AV.RAVRFNA.....DG...N.........
ENSDARP00000079570  ...........................------------..-----K.DV.TSLDWNS.....EG...T.........
ENSDARP00000060431  ...........................--------QLHV..WTGHTK.GV.SAIRLFPk....SG...H.........
ENSDARP00000027484  ...........................------------..----KC.PV.FVVRWTP.....EG...R.........
ENSDARP00000076693  ...........................------------..------.-C.WYVAWNP.....AG...T.........
ENSDARP00000089117  ...........................------------..--GQKS.HV.ECARFSP.....DG...Q.........
ENSDARP00000079014  ...........................------------..FVGHQG.PV.WCLCVYS.....TG...D.........
ENSDARP00000122900  ...........................-----------R..ILGHLS.SV.YCVTFDR.....TG...R.........
ENSDARP00000106094  ...........................-----------T..LQSHRD.DV.NCVAFS-.....-G...D.........
ENSDARP00000105402  ...........................-----------T..LQSHRD.DV.NCVAFS-.....-G...D.........
ENSDARP00000107355  ...........................------------..-----A.RV.KGLSFHP.....KR...P.........
ENSDARP00000099894  ...........................------------..ILGHLS.AV.YCIAFDR.....TG...S.........
ENSDARP00000114236  ...........................-----------R..ILGHLS.SV.YCVAFDR.....TG...R.........
ENSDARP00000068184  ...........................------------..--GPKS.HV.ECARFSP.....DG...Q.........
ENSDARP00000024391  ...........................-----------T..CSGHTR.PV.VDLAFSGitp..YG...Y.........
ENSDARP00000096338  ...........................-------ARQIH..TLSHGE.VV.CAVTIST.....ST...R.........
ENSDARP00000117865  ...........................-------ARQIH..TLSHGE.VV.CAVTIST.....ST...R.........
ENSDARP00000105810  ...........................----------LV..MHPHQG.AV.YYACFSK.....DG...S.........
ENSDARP00000109528  ...........................------------..FDAHDG.EV.NAVRFSP.....GS...R.........
ENSDARP00000110967  ...........................---------RFT..LRSHFD.AI.RALSFHP.....SQ...A.........
ENSDARP00000097371  ...........................------------..------.-I.LSLDLCPt....DT...N.........
ENSDARP00000068663  ...........................----------QQ..FVGYND.DV.LDVKFVGk....DD...T.........
ENSDARP00000096387  ...........................------------..-----N.GV.NALQLDP.....AL...N.........
ENSDARP00000073472  ...........................---------SRE..FPAHSA.KV.HSVAWSC.....DG...K.........
ENSDARP00000056247  ...........................------------..-----N.GV.NALQLDP.....AL...N.........
ENSDARP00000045014  ...........................---------RRT..LRGHLA.KI.YAMHWGS.....DS...R.........
ENSDARP00000090792  ...........................--------RQIN..TLSHGE.VV.CAVTISN.....PT...R.........
ENSDARP00000019743  ...........................--------RQIN..TLSHGE.VV.CAVTISN.....PT...R.........
ENSDARP00000028733  ...........................------------..------.--.-------.....-G...N.........
ENSDARP00000104487  ...........................---------KYT..LRSHFD.GV.RALAFHP.....VE...P.........
ENSDARP00000079959  ...........................--------PKFT..LRNHFD.SI.RGLAFHP.....VE...P.........
ENSDARP00000065646  ...........................-------AEIRL..LRGHKL.PV.TCLVITP.....DE...K.........
ENSDARP00000005989  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000062413  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000003004  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000024168  ...........................----------KV..FRENSD.KI.NCFDFSS.....NG...E.........
ENSDARP00000077651  ...........................------------..----TQ.AV.RAVAFHP.....TG...A.........
ENSDARP00000124018  ...........................------------..FRGGQM.GC.FTLCFSH.....DG...R.........
ENSDARP00000068125  ...........................-----------C..HKIHKE.AV.TGVAVTL.....SG...D.........
ENSDARP00000084377  ...........................----FPCYTQQI..LTEHCN.EV.WFCKFSN.....DG...T.........
ENSDARP00000109369  ...........................------------..----TQ.AV.RAVAFHP.....SG...M.........
ENSDARP00000004327  ...........................------------..------.--.------A.....DS...E.........
ENSDARP00000112164  ...........................------------..------.--.-------.....-G...Q.........
ENSDARP00000109556  ...........................------------..-TSHKG.PC.RVATYSR.....DG...Q.........
ENSDARP00000036145  ...........................----FPCYTQQI..LTEHCN.EV.WFCKFSN.....DG...T.........
ENSDARP00000101521  ...........................------------..---HTD.AI.NCVV-SL.....TS...D.........
ENSDARP00000101197  ...........................------------..------.IV.SSIEFDR.....DC...D.........
ENSDARP00000065847  ...........................-----------Y..FSRHKG.EV.NCCAFSP.....DC...Q.........
ENSDARP00000099567  ...........................-----------E..LQGHSG.CV.NCLEWNE.....KG...D.........
ENSDARP00000038520  ...........................------------..-----E.PI.SCHAWNK.....DR...T.........
ENSDARP00000106434  ...........................------------..-----G.AV.SKIDFSP.....LP...P.........
ENSDARP00000033992  ...........................------------..------.--.-------.....QQ...N.........
ENSDARP00000060548  ...........................------------..ATNHNS.AV.KDVAFPFg....TS...E.........
ENSDARP00000105555  ...........................------------..---HDM.DV.RGLAAVAfp...DG...A.........
ENSDARP00000087578  ...........................---PFPTTQSLV..YRGHSS.LV.RSISVSP.....SG...Q.........
ENSDARP00000076761  ...........................------------..FTRHTG.SV.FCVRLDPl....TN...S.........
ENSDARP00000119160  ...........................------------..-----K.PI.FSVDIHP.....DG...T.........
ENSDARP00000099166  ...........................---------VKE..YVGHRD.GI.WDLAVTRv....QP...L.........
ENSDARP00000079110  ...........................------------..---HMG.AV.WTMKFSH.....CG...R.........
ENSDARP00000028109  ...........................-----------VasLDGHRD.GI.SCISKHAk....SL...S.........
ENSDARP00000017792  ...........................------------..LQGHER.SI.TQIKYNR.....EG...D.........
ENSDARP00000091471  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000015105  ...........................------------..--PPDD.SI.SCLAFSPptm..PG...N.........
ENSDARP00000005640  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000112282  ...........................------------..------.--.--LCLDS.....TD...D.........
ENSDARP00000010862  ...........................---------RRT..LRGHLA.KI.YAMHWGT.....DS...R.........
ENSDARP00000112131  ...........................------------..KINHEG.EV.NRARYMP.....QN...P.........
ENSDARP00000117542  ...........................------------..KINHEG.EV.NRARYMP.....QN...P.........
ENSDARP00000027560  ...........................------------..-----Q.KV.FCGVYSD.....EG...N.........
ENSDARP00000110861  ...........................------------..EHAHED.AI.WTAAWGRsek..DGs..E.........
ENSDARP00000102565  ...........................------------..-EGHQE.AV.NGMHIH-.....-N...G.........
ENSDARP00000093657  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000008451  ...........................------------..------.PA.NAISVCR.....DA...T.........
ENSDARP00000110420  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000101565  ...........................------------..------.--.-------.....KG...N.........
ENSDARP00000111921  ...........................------------..--GPED.SV.SAVKFSPs....SS...Q.........
ENSDARP00000018714  ...........................------------..------.-V.NTIAFHP.....KQ...D.........
ENSDARP00000097750  ...........................-----------V..LNVHDG.CV.NTISWND.....TG...E.........
ENSDARP00000105810  ...........................------------..---LSS.RI.RCSCISR.....NA...A.........
ENSDARP00000065337  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000016280  ...........................---------QFN..PHSATH.PV.AQVCWSS.....SN...Q.........
ENSDARP00000071264  ...........................-----------I..LKGHSA.PV.AYVCVTS.....EN...G.........
ENSDARP00000073678  ...........................------------..-----E.PV.YSLDFQQsg...DGkt.Q.........
ENSDARP00000070393  ...........................------------..LERHTG.CV.NTLHFNP.....SG...T.........
ENSDARP00000100903  ...........................-----------A..LKSHSG.HV.TCLDFSS.....NG...K.........
ENSDARP00000099551  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000063641  ...........................-----------A..LKSHSG.HV.TCLDFSS.....NG...K.........
ENSDARP00000104754  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000014740  ...........................------------..------.--.LCVE--S.....TD...D.........
ENSDARP00000106749  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000003237  ...........................------------..------.--.EWLNFDPnpeeqQG...N.........
ENSDARP00000115064  ...........................------------..--GHSE.GH.TDVCFDD.....QG...K.........
ENSDARP00000071531  ...........................------------..--SHED.MI.HDAQMDY.....YG...T.........
ENSDARP00000105980  ...........................------------..------.YL.RGCKWAP.....DG...S.........
ENSDARP00000113946  ...........................------------..---HIA.DV.NCVLLLGg....AG...A.........
ENSDARP00000079302  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000111824  ...........................--------LELA..MMPHYG.GI.NRVRVTQrg...EQ...T.........
ENSDARP00000008006  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079585  ...........................-----------F..YLGHND.DI.ISLALHP.....DK...I.........
ENSDARP00000104171  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000052711  ...........................---------LYI..LRGSGA.SV.NALHFCC.....DGdgpP.........
ENSDARP00000059208  ...........................------------..IEGFQD.VV.NTAVIIP.....KE...D.........
ENSDARP00000006309  ...........................-----------K..IEGHSD.GV.NAAVLIP.....KE...D.........
ENSDARP00000102210  ...........................------------..------.--.-------.....--...D.........
ENSDARP00000124457  ...........................------------..------.--.--CAFSPk....SH...Q.........
ENSDARP00000010071  ...........................------------..--GHSA.RV.YALYYR-.....-D...G.........
ENSDARP00000092538  ...........................------------..RHGFPY.QP.SSMAFDP.....VQ...K.........
ENSDARP00000031340  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000059344  ...........................------------..------.-A.WTFDCSS.....SH...P.........
ENSDARP00000074880  ...........................------------..------.-V.TALCWNHi....YS...D.........
ENSDARP00000026454  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000099918  ...........................------------..------.--.--VAFDT.....TG...E.........
ENSDARP00000121552  ...........................------------..------.-V.SALCWNKk....YN...D.........
ENSDARP00000007696  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000080844  ...........................------------..------.-V.TSLDWSP.....QY...P.........
ENSDARP00000071301  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079585  ...........................------------..------.--.---CYGR.....SE...D.........
ENSDARP00000106510  ...........................----------RQ..IKAHDG.SV.FTLCQMR.....NG...T.........
ENSDARP00000037121  ...........................------------..------.-I.TCLDWSP.....QY...P.........
ENSDARP00000124137  ...........................------------..------.NV.KRMTSHP.....IY...Q.........
ENSDARP00000039795  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079663  ...........................--------LVAH..LHEHKS.AV.NRIRVSD.....EH...S.........
ENSDARP00000056762  ...........................------------..---HRE.LV.SCVGWTS.....AD...E.........
ENSDARP00000024476  ...........................------------..YGEHHS.SI.MHCRVDC.....SG...R.........
ENSDARP00000126101  ...........................------------..YGEHHS.SI.MHCRVDC.....SG...R.........
ENSDARP00000087003  ...........................------------..------.-V.TCLDWSP.....QY...P.........
ENSDARP00000065205  ...........................------------..------.NV.SCMVWNKk....NP...D.........
ENSDARP00000110420  ...........................------------..------.--.RALACDP.....HS...G.........
ENSDARP00000059666  ...........................------------..------.--.-----SH.....DS...R.........
ENSDARP00000101126  ...........................------------..--GHGT.SI.LCAGVSCe....SE...S.........
ENSDARP00000060548  ...........................------------..--GFNG.HVfSGLKVHP.....DK...E.........
ENSDARP00000078100  ...........................---------QYL..LQGHCS.PI.TCLCTSE.....DR...R.........
ENSDARP00000078191  ...........................------------..---NPG.VP.SVVKFHP.....FN...P.........
ENSDARP00000078965  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000102373  ...........................------------..-----D.II.STVEFNP.....SG...E.........
ENSDARP00000006117  ...........................------------..------.-A.TSLSWHPv....DN...H.........
ENSDARP00000111140  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000094274  ...........................---------LRA..LEGHSD.II.TCAVAV-.....-D...N.........
ENSDARP00000075344  ...........aelqkgecayfeylsh------------..-SFHNN.II.TGLSTCI.....RK...P.........
ENSDARP00000106181  ...........................------------..------.--.-AMSVDC.....LG...Q.........
ENSDARP00000089501  ...........................------------..RHGFPY.QP.SSMAFDP.....VQ...K.........
ENSDARP00000102443  ...........................------------..------.II.STVEFNP.....TG...E.........
ENSDARP00000038921  ...........................------------..------.--.-------.....NG...Q.........
ENSDARP00000033554  ...........................------------..------.II.STVEFNP.....TG...E.........
ENSDARP00000100360  ...........................------------..---TVQ.GA.HGVKIFA.....CH...K.........
ENSDARP00000014182  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000027152  ...........................------------..RHGFPY.QP.TALAFDP.....VQ...K.........
ENSDARP00000108102  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000107806  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000007602  ...........................------------..------.II.STVEFNH.....SG...E.........
ENSDARP00000021430  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000087525  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000054317  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000110907  ...........................------------..-----N.NV.RRMTSHP.....TL...P.........
ENSDARP00000074797  ...........................------------..------.QV.TSVSWNC.....TG...S.........
ENSDARP00000047739  ...........................------------..----HG.AV.FNLEYSP.....DG...S.........
ENSDARP00000079585  qemkrcrafqletglpveivrsvcrgk------------..------.--.-------.....--...G.........
ENSDARP00000055337  ...........................------------..------.--.-SQSFSP.....CG...R.........
ENSDARP00000058220  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000102332  ...........................------------..LLGHSG.VI.FSLCYLQ.....ES...G.........
ENSDARP00000003173  ...........................------------..------.-I.HDVSYDF.....HG...R.........
ENSDARP00000064438  ...........................------------..------.--.-------.....--...E.........
ENSDARP00000099721  ...........................------------..------.II.STVEFNY.....SG...E.........
ENSDARP00000026825  ...........................------------..------.VI.STVEFNQ.....TG...D.........
ENSDARP00000100187  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000059532  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000099725  ...........................------------..------.-L.TSVQFHP.....SA...Q.........
ENSDARP00000084300  ...........................------------..------.-I.STVEFNQ.....TG...E.........
ENSDARP00000124280  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000100360  ...............afrletgqvidc------------..------.--.-------.....--...-.........
ENSDARP00000110672  ...........................--------RLRA..LEGHSD.II.TCAVAV-.....-D...N.........
ENSDARP00000060454  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000098826  ...........................------------..------.--.----FNHltataES...V.........
ENSDARP00000091438  ...........................------------..---FDR.RV.TSLEWHPt....HP...T.........
ENSDARP00000098798  ...........................------------..--AHQS.RV.ITCGWCS.....KK...G.........
ENSDARP00000091436  ...........................------------..------.--.KCVSWNK.....DQ...G.........
ENSDARP00000086480  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000099546  ...........................------------..------.-V.KAVVLCS.....KR...K.........
ENSDARP00000061333  ...........................------------..------.KV.TCMAWAP.....NN...A.........
ENSDARP00000037790  ...........................------------..--PHGN.GL.LYAGFNQ.....DH...G.........
ENSDARP00000032005  ...........................------------..------.II.SAVEFNH.....SG...E.........
ENSDARP00000008668  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000103874  ...........................------------..------.--.--CAICP.....NP...-.........
ENSDARP00000043116  ...........................------------..------.--.---RFTL.....TD...T.........
ENSDARP00000063737  ...........................------------..------.EI.WHISGSP.....--...-.........
ENSDARP00000106107  ...........................------------..------.--.-------.....--...S.........
ENSDARP00000101619  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000025827  ...........................------------..------.--.---VVSH.....DG...K.........
ENSDARP00000100360  ...........................------------..RDMHTH.GI.ACLAFDL.....DG...Q.........
ENSDARP00000003197  ...........................------------..------.--.-CFVITA.....DN...R.........
ENSDARP00000012553  ...........................------------..----DS.AV.RSFSWHP.....HT...D.........
ENSDARP00000003663  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000069897  ...........................------------..------.PV.SHLQLAC.....CP...S.........
ENSDARP00000018434  ...........................------------..------.-V.HVVEFSPydcgsPA...S.........
ENSDARP00000093342  ...........................------------..------.--.HCFVVTA.....DN...R.........
ENSDARP00000100360  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000102548  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000041156  ...........................------------..------.--.QCFVVTA.....DN...R.........
ENSDARP00000108156  ...........................------------..------.GV.NSLQFNQ.....DQ...S.........
ENSDARP00000070070  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000018924  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000123525  ...........................------------..------.--.-------.....-S...K.........
ENSDARP00000109363  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000103752  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000101029  ...........................------------..------.--.CSVAFHP.....SM...P.........
ENSDARP00000101492  ...........................------------..------.--.---DVSS.....CA...G.........
ENSDARP00000038543  ...........................------------..------.--.--LVVSS.....DG...R.........
ENSDARP00000079585  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000104754  ...........................------------..------.--.-------.....-G...G.........
ENSDARP00000075344  ...........................------------..-----Q.GM.HALAIST.....NR...R.........
ENSDARP00000083528  ...........................------------..------.--.------P.....YE...S.........
ENSDARP00000017678  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000097777  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000109722  ...........................------------..------.--.-CVAWYPkhe..PE...C.........
ENSDARP00000083772  ...........................------------..------.--.-------.....--...P.........
ENSDARP00000065266  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000088806  ...........................------------..------.--.--LAFSP.....DR...S.........
ENSDARP00000109028  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000095457  ...........................------------..------.--.--LAFSP.....DR...N.........
ENSDARP00000086448  ...........................------------..---QGC.GI.HAIELNP.....SR...T.........
ENSDARP00000117869  ...........................------------..------.-I.QCIAYDP.....QG...F.........
ENSDARP00000035593  ...........................------------..-HGFPH.QP.SALGFSP.....SL...E.........
ENSDARP00000086251  ...........................------------..------.--.----RYY.....EE...G.........
ENSDARP00000054352  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000024810  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000100292  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079585  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000009095  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000101029  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000118167  ...........................------------..------.KP.VCRRRYC.....EE...G.........
ENSDARP00000101029  ...........................------------..-IGFGGaTM.RCAVWSL.....DG...E.........
ENSDARP00000050905  ...........................------------..------.--.--IDISG.....GS...Q.........
ENSDARP00000078100  ...........................------------..LQGHCS.PI.TCLCTSE.....DR...R.........
ENSDARP00000046545  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000032408  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000104388  ...........................------------..-RGDDS.EV.VGIELSE.....DQ...R.........
ENSDARP00000101882  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000093519  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000112439  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000071650  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000099546  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000111616  ...........................------------..-----K.TI.SHVQWHP.....SI...S.........
ENSDARP00000019506  ...........................------------..------.--.-------.....--...D.........
ENSDARP00000076262  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000080599  ...........................------------..------.--.-------.....DK...D.........
ENSDARP00000084220  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000080965  ...........................------------..------.--.----LGD.....ND...K.........
ENSDARP00000123525  ...........................------------..------.GY.TALALCD.....TG...P.........
ENSDARP00000018692  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000008672  ...........................------------..------.YI.WNIKWCP.....AG...Awelpstsrk
ENSDARP00000094999  ...........................------------..------.--.---ALDS.....NS...D.........
ENSDARP00000116849  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000104388  ...........................------------..---HEG.LV.ENCVLTT.....SG...D.........
ENSDARP00000072504  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000052786  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000076812  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000047833  ...........................------------..------.--.------S.....NG...K.........
ENSDARP00000097904  ...........................------------..------.--.-------.....--...N.........
ENSDARP00000102548  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000082368  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000109749  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000110965  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000095605  ...........................------------..---DSG.RI.KCTCLSV.....SR...K.........
ENSDARP00000091436  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000111846  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000090283  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000008223  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000005398  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000020383  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000114287  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000101793  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000059751  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000117166  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000046545  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000060999  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000084929  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000104754  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000111156  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000112085  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000100913  ...........................------------..------.--.-------.....--...P.........
ENSDARP00000003198  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000027152  ...........................------------..------.--.-------.....--...Ggtwtvgsqt
ENSDARP00000106476  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000104791  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000109373  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000092538  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000098142  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000044811  ...........................------------..------.--.---RFIRe....DT...N.........
ENSDARP00000024810  ...........................------------..------.--.-------.....-K...E.........
ENSDARP00000075280  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000076048  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000089501  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000107630  ...........................------------..------.--.-------.....SE...D.........
ENSDARP00000092069  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000018100  ...........................------------..------.--.----CAV.....NQ...R.........
ENSDARP00000108631  ...........................------------..------.--.----CAV.....NQ...R.........
ENSDARP00000111537  ...........................------------..LQPLLQ.RV.VTMSASQ.....NG...M.........
ENSDARP00000035593  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000109913  ...........................------------..------.--.-------.....DG...L.........
ENSDARP00000103234  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000026432  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000078268  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000078255  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000102911  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000032159  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000079570  ...........................------------..------.--.-------.....--...-.........
ENSDARP00000007708  ...........................------------..------.--.-------.....--...-.........


                                                                        40                          
                                                                         |                          
d1pgua1               ........AIAYP....................C....GKS..........AFVR.CLDDG.................
ENSDARP00000017859  ........WLASS....................Sa...DKL..........IKIW.GAYDG.................
ENSDARP00000039257  ........LMVSA....................Se...DAT..........IKVW.DYEAG.................
ENSDARP00000042217  ........VIVSA....................Se...DAT..........IKVW.DHETG.................
ENSDARP00000080947  ........RIVSG....................Sd...DNT..........LKVW.SAVTG.................
ENSDARP00000026057  ........QLATG....................Sc...DKS..........LMIW.NLAPK.................
ENSDARP00000116595  ........CFITG....................Sy...DRT..........CKIW.DTASG.................
ENSDARP00000074155  ........YLASG....................Sg...DTT..........VRFW.DLSTE.................
ENSDARP00000038728  ........TLASS....................Gy...DRL..........ILMW.NVYG-.................
ENSDARP00000088166  ........LLVTA....................Sw...SGL..........CKLW.KVPDC.................
ENSDARP00000103157  ........LLVTA....................Sw...SGL..........CKLW.KVPDC.................
ENSDARP00000111963  ........LLVSA....................Sq...DGK..........LIIW.DSYTT.................
ENSDARP00000018443  ........LLVSA....................Sq...DGK..........LIIW.DSYTT.................
ENSDARP00000079424  ........LLVSA....................Sq...DGK..........LIIW.DSYTT.................
ENSDARP00000015825  ........LIAGG....................Fa...DST..........VRVW.SVTPKklrkvksaadlnlidke
ENSDARP00000024623  ........LLATG....................Ge...DCR..........VNIW.AVSKP.................
ENSDARP00000051230  ........LLVSA....................Sq...DGK..........LIIW.DSYTT.................
ENSDARP00000044330  ........-----....................-....---..........----.-----.................
ENSDARP00000079567  ........LLASG....................Sg...DST..........ARIW.NLSESstgg.............
ENSDARP00000017443  ........LCVSA....................Sq...DGK..........LIVW.DSYTT.................
ENSDARP00000107302  ........WFVTG....................Sa...DRT..........IKIW.DLASG.................
ENSDARP00000005843  ........LMVSA....................Sq...DGK..........LLIW.DAHSG.................
ENSDARP00000104051  ........IVASS....................Sd...DQL..........WKLW.AIPKG.................
ENSDARP00000061000  ........MILSA....................Sr...DKT..........IIMW.KLTRDe................
ENSDARP00000017497  ........KIISG....................Lr...DNS..........IKIW.DKQTL.................
ENSDARP00000011435  ........RIVSS....................Sq...DGK..........VIVW.DAFTT.................
ENSDARP00000072190  ........RIVSS....................Sq...DGK..........VIVW.DAYTT.................
ENSDARP00000037531  ........KIISG....................Lr...DNS..........IKIW.DKQSL.................
ENSDARP00000038258  ........LLAAG....................Fd...NSA..........VKLW.SLRARklkagphradvskirla
ENSDARP00000076048  ........LLATG....................Sy...DGF..........ARIW.TKDG-.................
ENSDARP00000060977  ........YLLTC....................Gs...DKS..........LKLW.SVSRG.................
ENSDARP00000079570  ........LLATG....................Sy...DGF..........ARIW.TKDG-.................
ENSDARP00000060431  ........LLLSC....................Sm...DCK..........IKLW.EVYN-.................
ENSDARP00000027484  ........RLVTG....................As...SGE..........FTLW.NGLTF.................
ENSDARP00000076693  ........TLATC....................Gg...DRA..........IRIW.GKEGD.................
ENSDARP00000089117  ........YLVTG....................Sv...DGF..........IEVW.NFTTG.................
ENSDARP00000079014  ........LLFSG....................Ss...DKS..........IKVW.DTCT-.................
ENSDARP00000122900  ........RIFTG....................Sd...DCL..........VKIW.ATDDG.................
ENSDARP00000106094  ........LLATC....................Sa...DKS..........ICVY.SSRDF.................
ENSDARP00000105402  ........LLATC....................Sa...DKS..........ICVY.SSRDF.................
ENSDARP00000107355  ........WILAS....................Lh...NGV..........IQLW.DYRMC.................
ENSDARP00000099894  ........RIFTG....................Sd...DAL..........VKIW.SSFDG.................
ENSDARP00000114236  ........RIFTG....................Sd...DCL..........VKIW.ATDNG.................
ENSDARP00000068184  ........YLITG....................Sv...DGF..........IEVW.NFTTG.................
ENSDARP00000024391  ........FLISA....................Ck...DGK..........PMLR.QGDTG.................
ENSDARP00000096338  ........HVYTG....................G....KGC..........VKVW.DISQPgs...............
ENSDARP00000117865  ........HVYTG....................G....KGC..........VKVW.DISQPgs...............
ENSDARP00000105810  ........KIASC....................Ga...SKA..........LRVF.KSTSG.................
ENSDARP00000109528  ........LLATG....................Gm...DRR..........VKLW.EVVSG.................
ENSDARP00000110967  ........VLLSA....................Se...DGT..........LKLW.NLNKAmhskkna..........
ENSDARP00000097371  ........KVLTG....................Ga...DKN..........VVVF.DRREE.................
ENSDARP00000068663  ........HIAVA....................Tn...SSQ..........LKVF.ELST-.................
ENSDARP00000096387  ........RLFTA....................Gr...DSI..........IRIW.SVNQH.................
ENSDARP00000073472  ........RLASG....................Sf...DKT..........ASVF.VLEKD.................
ENSDARP00000056247  ........RLFTA....................Gr...DSI..........IRIW.SVNQH.................
ENSDARP00000045014  ........LLVSA....................Sq...DGK..........LIIW.DGYTT.................
ENSDARP00000090792  ........HVYTG....................G....KGC..........VKIW.DISQPgs...............
ENSDARP00000019743  ........HVYTG....................G....KGC..........VKIW.DISQPgs...............
ENSDARP00000028733  ........LLSVG....................L....GAC..........VYLW.SACTS.................
ENSDARP00000104487  ........VLVTV....................Se...DHT..........LKLW.NLHKTvpakksa..........
ENSDARP00000079959  ........VLITA....................Se...DHT..........LKMW.NLQKTaptkkca..........
ENSDARP00000065646  ........HIFSA....................Sk...DCS..........IIKW.DVESG.................
ENSDARP00000005989  ........-----....................-....---..........----.-----.................
ENSDARP00000062413  ........-----....................-....---..........----.-----.................
ENSDARP00000003004  ........-----....................-....GTC..........VYLW.SACTS.................
ENSDARP00000024168  ........TVISS....................Sd...DDS..........IVLY.DCQEG.................
ENSDARP00000077651  ........LYAVG....................Sn...SKT..........LRVC.AYPDTldtsgtgt.........
ENSDARP00000124018  ........ALAAA....................Ca...DRDafp.......IIIY.EIPSG.................
ENSDARP00000068125  ........SIFTT....................Sq...DST..........LKMF.SKEN-.................
ENSDARP00000084377  ........KLASG....................Sk...DTT..........VIIW.QVDPD.................
ENSDARP00000109369  ........LYAIG....................Sn...SKT..........LRVC.TYPQSlktspqapv........
ENSDARP00000004327  ........WILTG....................Sy...DKT..........ARIW.SMEG-.................
ENSDARP00000112164  ........LVAVG....................Sr...DRT..........IRLL.HIGSL.................
ENSDARP00000109556  ........LIATG....................Sa...DAS..........IKIL.DTERMlaksamplevmmnetaq
ENSDARP00000036145  ........KLATG....................Sk...DTT..........VIIW.QVEPD.................
ENSDARP00000101521  ........LCVSG....................Gh...DQA..........VVVY.DWRAG.................
ENSDARP00000101197  ........YFAIA....................Gv...TKK..........IKVF.EYGT-.................
ENSDARP00000065847  ........LLLTC....................Cd...AGK..........LYLW.KTSTA.................
ENSDARP00000099567  ........LLASG....................Sd...DQH..........AIIW.DPFRH.................
ENSDARP00000038520  ........QIALC....................Pn...NHE..........VHIY.NKAGN.................
ENSDARP00000106434  ........HNYAV....................Ta...STR..........VHIY.GLHSQ.................
ENSDARP00000033992  ........CLAVA....................Ne...EGF..........VTIF.NTGEK.................
ENSDARP00000060548  ........LFATC....................S....HND..........IRVW.HSESS.................
ENSDARP00000105555  ........FVSVS....................R....DRT..........ARVW.VPNPSe................
ENSDARP00000087578  ........WLVSG....................Sd...DCT..........VRFW.EVSTA.................
ENSDARP00000076761  ........LAMSG....................Ge...DDR..........AFLW.RVCDG.................
ENSDARP00000119160  ........KFATG....................GqgedSGK..........VVIW.NMAPVlreedekn.........
ENSDARP00000099166  ........VLGTA....................Sa...DHC..........SMLW.SIETG.................
ENSDARP00000079110  ........LLATA....................Gq...DNI..........VRIW.VLKNAydyfnnmrikyntegrv
ENSDARP00000028109  ........TVISG....................Ac...DGE..........VKVW.NLPKR.................
ENSDARP00000017792  ........LLFSV....................Ak...DPI..........ANVW.YSVNG.................
ENSDARP00000091471  ........-----....................-....---..........----.-----.................
ENSDARP00000015105  ........FLIGG....................Sw...AND..........VRCW.EVQDN.................
ENSDARP00000005640  ........-----....................-....---..........----.-----.................
ENSDARP00000112282  ........LLFTG....................Sk...DRT..........CKVW.NLVTG.................
ENSDARP00000010862  ........LLVSA....................Sq...DGK..........LIVW.DSYTT.................
ENSDARP00000112131  ........CIIATk...................Tp...TSD..........VLVF.DYTKHpskpdp...........
ENSDARP00000117542  ........CIIATk...................Tp...TSD..........VLVF.DYTKHpskpdp...........
ENSDARP00000027560  ........MFLSA....................Cq...DQN..........IRLY.DTSRG.................
ENSDARP00000110861  ........TIVTG....................Sl...DDL..........VKVW.KWSDE.................
ENSDARP00000102565  ........LLYTC....................Sg...DRT..........IRAF.SLITR.................
ENSDARP00000093657  ........-----....................-....---..........----.-----.................
ENSDARP00000008451  ........QVVVA....................G....RNI..........FKIY.GLEED.................
ENSDARP00000110420  ........--LSC....................Ss...DNT..........IRLW.HTDAQntslsrnvisndlqkii
ENSDARP00000101565  ........NFLYT....................N....GKS..........VIIR.NIENP.................
ENSDARP00000111921  ........FLLVS....................Sw...DGS..........VRLY.DASAN.................
ENSDARP00000018714  ........ILAAG....................Di...DGD..........IYLF.SYSCT.................
ENSDARP00000097750  ........YILSG....................Sd...DTN..........LVIT.NPYNR.................
ENSDARP00000105810  ........FVALG....................Se...DGT..........VQVI.EVPSS.................
ENSDARP00000065337  ........-----....................-....---..........---Y.RVCPA.................
ENSDARP00000016280  ........YVVSA....................Ssi..GDK..........LVVS.SLKS-.................
ENSDARP00000071264  ........HIYSV....................St...DNT..........AKIW.HIKDQtclftahpnssqikgel
ENSDARP00000073678  ........RLATA....................Gv...DTT..........VRMW.RVDKGpdg..............
ENSDARP00000070393  ........RLASG....................Sd...DLR..........VVIW.DWARR.................
ENSDARP00000100903  ........YLASC....................Sd...DRT..........IRIW.STKDFl................
ENSDARP00000099551  ........-----....................-....---..........----.-----.................
ENSDARP00000063641  ........YLASC....................Sd...DRT..........IRIW.STKDFl................
ENSDARP00000104754  ........-LACG....................Gd...DSR..........VHLY.VQLSG.................
ENSDARP00000014740  ........LMFTG....................Sk...DRT..........CKVW.NLVTG.................
ENSDARP00000106749  ........-----....................-....---..........----.-----.................
ENSDARP00000003237  ........YAAVG....................Nm...TPV..........IDVW.DLDVVdclepafslgskkekkk
ENSDARP00000115064  ........CIVTC....................Gs...DGD..........VRIW.ESLDD.................
ENSDARP00000071531  ........RLATC....................Ss...DRS..........VKIF.DVKNG.................
ENSDARP00000105980  ........CIVSN....................Sa...DNV..........LRVY.NLPAElyssqw...........
ENSDARP00000113946  ........VCASG....................Sr...DRN..........VNLW.DLNEG.................
ENSDARP00000079302  ........-----....................-....---..........----.-----.................
ENSDARP00000111824  ........LAAVW....................Se...KGQ..........VEIF.DLRLQleavhnstamsafikq.
ENSDARP00000008006  ........-----....................-....---..........----.-----.................
ENSDARP00000079585  ........QVATGqv..................Gk...DPY..........ICVW.DSYAL.................
ENSDARP00000104171  ........-----....................-....---..........----.-----.................
ENSDARP00000052711  ........LLYSG....................Sg...KGA..........VHVW.NLSTR.................
ENSDARP00000059208  ........GVISV....................Sq...DRT..........IRVW.LKRDS.................
ENSDARP00000006309  ........GVITV....................Se...DRT..........IRVWlKRDSG.................
ENSDARP00000102210  ........VLAVC....................Cs...NHS..........VHLH.NRETL.................
ENSDARP00000124457  ........FLALC....................Aq...DGR..........LRIW.NTESK.................
ENSDARP00000010071  ........LLCTG....................Sd...DLS..........AKLW.DVRTG.................
ENSDARP00000092538  ........ILAIG....................Tq...SGA..........LRLF.GRPGV.................
ENSDARP00000031340  ........-----....................-....---..........----.-----.................
ENSDARP00000059344  ........LLAVA....................Gs...RGI..........IRII.NHITM.................
ENSDARP00000074880  ........LFAVGlgsyeftq............Qe...RGM..........LLFY.TLKN-.................
ENSDARP00000026454  ........-----....................-....---..........----.-----.................
ENSDARP00000099918  ........SFLAG....................Dh...HGN..........IYVF.DICRN.................
ENSDARP00000121552  ........LFAVG....................Lg...SHKftelecgm..LLFY.TWRN-.................
ENSDARP00000007696  ........-----....................-....---..........----.-----.................
ENSDARP00000080844  ........ELLVAsyntnedaph..........Ep...DGV..........VLVW.NMKFK.................
ENSDARP00000071301  ........-----....................-....---..........----.-----.................
ENSDARP00000079585  ........LVFSG....................At...TGD..........VYIW.KDTTL.................
ENSDARP00000106510  ........LLTGG....................Gk...DHK..........IILW.DHDLHperdievpdqygtirav
ENSDARP00000037121  ........ELLVA....................Sy...NNNedaphepdgvALVW.NMKFK.................
ENSDARP00000124137  ........YYMTG....................Aq...DGS..........VRMF.EWNRP.................
ENSDARP00000039795  ........-----....................-....--A..........FLVL.PLQKT.................
ENSDARP00000079663  ........IFATC....................Sn...DGT..........VKIW.DSQKM.................
ENSDARP00000056762  ........LYSCS....................D....DHQ..........ILKW.NLLSN.................
ENSDARP00000024476  ........RVASL....................Dv...DGV..........VKVW.AFNP-.................
ENSDARP00000126101  ........RVASL....................Dv...DGV..........VKVW.AFNP-.................
ENSDARP00000087003  ........ELLVAsycsneeaph..........Ep...DGV..........ALVW.NMKYK.................
ENSDARP00000065205  ........LLAVGygqvefknp...........N....SGL..........VCCW.SLKNP.................
ENSDARP00000110420  ........LIAYP....................A....GCV..........VVLL.NPKKN.................
ENSDARP00000059666  ........FVLCV....................S....GDS..........VKVY.STRTE.................
ENSDARP00000101126  ........LVATG....................Ae...GGE..........LTLW.SHDG-.................
ENSDARP00000060548  ........HLIYP....................L....GCT..........VIIK.SLRS-.................
ENSDARP00000078100  ........WIVTA....................Dmgq.ESL..........VIIW.DAYTG.................
ENSDARP00000078191  ........CIAVA....................D....KDS..........ICFW.DWEKG.................
ENSDARP00000078965  ........-----....................-....---..........----.-----.................
ENSDARP00000102373  ........LLATG....................Dk...GGR..........VVVF.QREQEsknqphrrgeynvystf
ENSDARP00000006117  ........KLAVAyscvefqrgpk.........Nm...SSD..........SYIW.NIEN-.................
ENSDARP00000111140  ........-----....................-....GGQ..........IAVF.ELSQPg................
ENSDARP00000094274  ........LVISG....................Sr...DTT..........VKVW.HVPTA.................
ENSDARP00000075344  ........LIATS....................Sl...DRS..........VRIW.NFET-.................
ENSDARP00000106181  ........HAVLS....................G....RRF..........LYVV.NLETP.................
ENSDARP00000089501  ........ILAIG....................Tq...SGA..........LRLF.GRAGV.................
ENSDARP00000102443  ........LLATG....................Dk...GGR..........VVVF.QREQEsknqphrrgeynvystf
ENSDARP00000038921  ........RVAVP....................Laia.GGQ..........IAVF.ELSQPg................
ENSDARP00000033554  ........LLATG....................Dk...GGR..........VVVF.QREQEsknqphrrgeynvystf
ENSDARP00000100360  ........GFATG....................Gr...DGC..........IRLW.DLNFK.................
ENSDARP00000014182  ........-----....................-....---..........----.-----.................
ENSDARP00000027152  ........ILAIG....................Sr...SGG..........IRMY.PFLSFphlg.............
ENSDARP00000108102  ........-----....................-....---..........----.-----.................
ENSDARP00000107806  ........-----....................-....---..........----.-----.................
ENSDARP00000007602  ........LLATG....................Dk...GGR..........VVIF.QQETEnksqpqcrseynvystf
ENSDARP00000021430  ........-----....................-....---..........----.-----.................
ENSDARP00000087525  ........-----....................-....---..........----.-----.................
ENSDARP00000054317  ........-----....................Rg...TGV..........MQIY.EIQHG.................
ENSDARP00000110907  ........YYLTG....................Aq...DGS..........VRMF.EWGHS.................
ENSDARP00000074797  ........VIACGfgrvddgdws..........Ne...KAC..........VCTW.NVDRQ.................
ENSDARP00000047739  ........VLTVA....................Ce...QTE..........VLLF.DPVSS.................
ENSDARP00000079585  ........KILVG....................Tk...DGE..........IMEV.GEKNA.................
ENSDARP00000055337  ........YLAAG....................Nn...YGE..........IAVF.SLSAAlspdas...........
ENSDARP00000058220  ........-----....................-....NNK..........VQLV.GLEEE.................
ENSDARP00000102332  ........WLASA....................Sd...DRS..........VRLW.SVGTLggdagcg..........
ENSDARP00000003173  ........RMATC....................Ss...DQS..........VKVW.DKGDD.................
ENSDARP00000064438  ........VFATG....................Sw...DNEnnk.......VSIW.SVGDRggstldgdl........
ENSDARP00000099721  ........LLATG....................Dk...GGR..........VVIF.QREQEsknrplsrgeynvystf
ENSDARP00000026825  ........LLATG....................Dk...GGR..........VVIF.QRETEskgeseelgesgeynvy
ENSDARP00000100187  ........-----....................-....---..........----.-----.................
ENSDARP00000059532  ........----Fssslvvvvsq..........Sm...PRR..........MNVY.HFKKG.................
ENSDARP00000099725  ........IVMTA....................Gl...DHC..........VSLF.QVDGK.................
ENSDARP00000084300  ........FLATG....................Dk...GGR..........VVIF.QREPLgeynvystfqsh.....
ENSDARP00000124280  ........-----....................-....---..........----.-----.................
ENSDARP00000100360  ........-----....................-....---..........----.----Vrsvcrgkgkilvgtrna
ENSDARP00000110672  ........LVISG....................Slsr.DTT..........VKVW.HVPTA.................
ENSDARP00000060454  ........-LLVG....................Fs...AGQ..........VQLI.DPIKK.................
ENSDARP00000098826  ........CLLVG....................Fs...AGQ..........VQLI.DPIKK.................
ENSDARP00000091438  ........TVAVG....................Sk...GGD..........IILW.DYDVL.................
ENSDARP00000098798  ........LLATS....................Gn...DGT..........VRVW.NVTKS.................
ENSDARP00000091436  ........FIACG....................Ge...DGL..........LKVL.KLETYtddaklkglaa......
ENSDARP00000086480  ........-----....................-....---..........----.-----.................
ENSDARP00000099546  ........LLLAG....................Se...DGL..........IIVW.SLNNL.................
ENSDARP00000061333  ........KFAVC....................Ti...DRV..........VILY.DEQGE.................
ENSDARP00000037790  ........CFACG....................M....ENG..........FRVY.NTDPL.................
ENSDARP00000032005  ........LLATG....................Dr...GGR..........IVIF.QQEQEnkslpqcraeynvystf
ENSDARP00000008668  ........-----....................-....---..........----.-----.................
ENSDARP00000103874  ........-----....................-....---..........----.-----.................
ENSDARP00000043116  ........HLISA....................Gg...DGK..........IIVH.DRGS-.................
ENSDARP00000063737  ........-----....................-....---..........----.----Adkavlttcynktsesrv
ENSDARP00000106107  ........LVAIV....................Slka.PRK..........LKVC.HFKKG.................
ENSDARP00000101619  ........-----....................-....---..........IYVY.QLDHR.................
ENSDARP00000025827  ........LLFSG....................Ghw..DNS..........LRVT.SLVKG.................
ENSDARP00000100360  ........CLVSV....................Glds.KNT..........ICVW.DWRQG.................
ENSDARP00000003197  ........FILLC....................Gfw..DKS..........FRVY.STDTG.................
ENSDARP00000012553  ........KFAVA....................Ll...DDS..........IKIY.KPHS-.................
ENSDARP00000003663  ........-----....................-....---..........----.-----.................
ENSDARP00000069897  ........HCAIP....................Wk...DKN..........IRIY.ENKIN.................
ENSDARP00000018434  ........LLAYG....................G....NKY..........VVVG.TCRFKeedaeve..........
ENSDARP00000093342  ........YILAC....................Gfw..DKS..........FRVY.STETG.................
ENSDARP00000100360  ........-----....................-....---..........----.-----.................
ENSDARP00000102548  ........LIAQG....................C....HSS..........ILII.DPNTA.................
ENSDARP00000041156  ........YILVC....................Gfw..DKS..........FRVY.SSDTG.................
ENSDARP00000108156  ........CFCCA....................M....ETG..........VRIY.NVEPL.................
ENSDARP00000070070  ........-----....................-....---..........----.-----.................
ENSDARP00000018924  ........-----....................-....---..........----.-----.................
ENSDARP00000123525  ........LFAAG....................M....ESV..........LRSI.QIKGN.................
ENSDARP00000109363  ........-----....................-....---..........----.-----.................
ENSDARP00000103752  ........-----....................-....---..........----.-----.................
ENSDARP00000101029  ........LFACG....................Ss...SGA..........VRVF.DIQTS.................
ENSDARP00000101492  ........LVIAG....................Yt...SGD..........VRLW.DTLHW.................
ENSDARP00000038543  ........LLFSG....................Ghw..DCS..........LRVT.MLGKA.................
ENSDARP00000079585  ........-----....................-....---..........----.-----.................
ENSDARP00000104754  ........LIAFG....................T....CNS..........VAIY.NPEEI.................
ENSDARP00000075344  ........YLAVS....................Ecre.KAT..........ITVF.DLEQE.................
ENSDARP00000083528  ........ELLLG....................Sv...NGT..........VKTF.STDKG.................
ENSDARP00000017678  ........-----....................-....---..........--LY.DCIPC.................
ENSDARP00000097777  ........-----....................-....---..........----.-----.................
ENSDARP00000109722  ........LLAVG....................Ht...NGR..........VVLT.SLGQShnsk.............
ENSDARP00000083772  ........LLGMA....................Ta...SGE..........IQLY.KLIEAqqg..............
ENSDARP00000065266  ........-----....................-....---..........----.-----.................
ENSDARP00000088806  ........LMAST....................Hv...NHN..........IYIT.EVKSG.................
ENSDARP00000109028  ........-----....................-....---..........----.-----.................
ENSDARP00000095457  ........LVAST....................Hv...NHN..........IYIT.DVKTG.................
ENSDARP00000086448  ........LLATG....................Gdn..PNS..........LAVY.RLPTL.................
ENSDARP00000117869  ........YLAVG....................Fa...SGA..........LQIV.DACTL.................
ENSDARP00000035593  ........LLAIG....................Tr...SGA..........IKLY.GAPGV.................
ENSDARP00000086251  ........WLATG....................Na...RGV..........VGVT.FTSSHcrrdr............
ENSDARP00000054352  ........-----....................St...PFT..........MNIY.HFKKG.................
ENSDARP00000024810  ........-----....................-....---..........----.-----.................
ENSDARP00000100292  ........KLWCA....................Ls...DGK..........LLVF.DAASW.................
ENSDARP00000079585  ........-----....................-....---..........----.-----.................
ENSDARP00000009095  ........-----....................-....---..........----.-----.................
ENSDARP00000101029  ........CVAAG....................Ys...DGT..........VRIF.SLDSA.................
ENSDARP00000118167  ........WLATG....................Ng...RGV..........VGVT.FTSSHcrrdr............
ENSDARP00000101029  ........EVVYP....................C....HAI..........IVSM.TVSS-.................
ENSDARP00000050905  ........TIATC....................G....GET..........LCVI.NCESG.................
ENSDARP00000078100  ........WIVTA....................Dmgq.ESL..........VIIW.DAYTG.................
ENSDARP00000046545  ........-----....................-....---..........----.-----.................
ENSDARP00000032408  ........-----....................-....---..........----.-----.................
ENSDARP00000104388  ........SILIC....................K....ARS..........IEVL.DTKIW.................
ENSDARP00000101882  ........-----....................-....---..........----.-----.................
ENSDARP00000093519  ........-----....................-....---..........----.-----.................
ENSDARP00000112439  ........-----....................-....---..........----.-----.................
ENSDARP00000071650  ........-----....................-....---..........----.-----.................
ENSDARP00000099546  ........-----....................-....---..........----.-----.................
ENSDARP00000111616  ........GVIVVsmmerlsleeridsstklllN....PSH..........ILFW.SFSDP.................
ENSDARP00000019506  ........LLVLT....................S....QKG..........IQMY.ESDGS.................
ENSDARP00000076262  ........-----....................-....---..........----.-----.................
ENSDARP00000080599  ........KMVAA....................Ss...ENR..........IILW.SIQDG.................
ENSDARP00000084220  ........-----....................-....---..........----.HLSS-.................
ENSDARP00000080965  ........MVAVA....................S....GTE..........IILW.AICPD.................
ENSDARP00000123525  ........YLVSA....................Spmp.DHI..........ITLW.NWESG.................
ENSDARP00000018692  ........-----....................-....---..........----.-----.................
ENSDARP00000008672  apqmprlgVLAAT....................Fa...NGT..........IGVY.SLPHPealekhyqskgegsrsp
ENSDARP00000094999  ........YIAIG....................Ss...IGM..........LYLY.CRRVS.................
ENSDARP00000116849  ........-----....................-....---..........----.-----.................
ENSDARP00000104388  ........LMVTS....................Dd...KSS..........QYIW.HTTTG.................
ENSDARP00000072504  ........-----....................-....---..........----.-----.................
ENSDARP00000052786  ........-----....................-....---..........----.-----.................
ENSDARP00000076812  ........-----....................-....---..........----.-----.................
ENSDARP00000047833  ........LLAVV....................Q....DQC..........VEIR.SARDDf................
ENSDARP00000097904  ........TLLMG....................Gl...QNY..........VAEL.DLTTV.................
ENSDARP00000102548  ........HFVFT....................Dt...DGQ..........VYHI.TVEGN.................
ENSDARP00000082368  ........-----....................-....---..........----.-----.................
ENSDARP00000109749  ........-----....................-....---..........----.-----.................
ENSDARP00000110965  ........-----....................-....---..........----.-----.................
ENSDARP00000095605  ........WLALG....................Ts...AGG..........LHLI.QRDGW.................
ENSDARP00000091436  ........CLAVC....................Ft...NGH..........CQVM.RHESD.................
ENSDARP00000111846  ........-----....................-....---..........----.-----.................
ENSDARP00000090283  ........-----....................-....---..........----.-----.................
ENSDARP00000008223  ........-----....................-....---..........----.-----.................
ENSDARP00000005398  ........-----....................-....---..........----.-----.................
ENSDARP00000020383  ........-----....................-....---..........----.-----.................
ENSDARP00000114287  ........-----....................-....---..........----.-----.................
ENSDARP00000101793  ........-----....................-....---..........----.-----.................
ENSDARP00000059751  ........-----....................-....---..........----.-----.................
ENSDARP00000117166  ........-IAVG....................Ts...HGL..........ALVF.DQNQA.................
ENSDARP00000046545  ........-----....................-....---..........----.-----.................
ENSDARP00000060999  ........-LAII....................Gg...NCA..........LQGF.DYEGN.................
ENSDARP00000084929  ........-----....................Aq...NGW..........LYVH.SAVSN.................
ENSDARP00000104754  ........-----....................-....---..........----.-----.................
ENSDARP00000111156  ........-----....................-....---..........----.-----.................
ENSDARP00000112085  ........-----....................-....-SV..........VVLF.NYEE-.................
ENSDARP00000100913  ........TVCLG....................Me...EGS..........ISVY.KSSQR.................
ENSDARP00000003198  ........-----....................-....---..........----.-----.................
ENSDARP00000027152  .....ypeIIITG....................Ha...DGS..........IKFW.DATAI.................
ENSDARP00000106476  ........-----....................-....---..........----.-----.................
ENSDARP00000104791  ........-----....................-....---..........----.-----.................
ENSDARP00000109373  ........-----....................-....---..........----.-----.................
ENSDARP00000092538  ........-----....................-....---..........----.-----.................
ENSDARP00000098142  ........-----....................-....---..........----.-----.................
ENSDARP00000044811  ........LFLTS....................G....HRD..........VLIF.SVQDR.................
ENSDARP00000024810  ........LLLTG....................Che..DGT..........VRFW.DASGV.................
ENSDARP00000075280  ........-----....................-....---..........----.-----.................
ENSDARP00000076048  ........-----....................-....---..........----.-----.................
ENSDARP00000089501  ........-----....................-....---..........----.-----.................
ENSDARP00000107630  ........CCICV....................Ag...QWS..........VCLW.AQRKG.................
ENSDARP00000092069  ........-LAVL....................Me...NGD..........VVVW.QFSLPlng..............
ENSDARP00000018100  ........QVVIA....................Lt...GGE..........LVYF.EMDPS.................
ENSDARP00000108631  ........QVVIA....................Lt...GGE..........LVYF.EMDPS.................
ENSDARP00000111537  ........WLVGL....................Lv...SGE..........LFLW.NKDKDllktvsav.........
ENSDARP00000035593  ........-----....................-....---..........----.-----.................
ENSDARP00000109913  ........YLFLG....................H....THG..........LSVI.STSSL.................
ENSDARP00000103234  ........-----....................-....---..........----.-----.................
ENSDARP00000026432  ........-----....................-....---..........----.-----.................
ENSDARP00000078268  ........KVAVA....................Dh...DGV..........VSCF.GMKKG.................
ENSDARP00000078255  ........-----....................-....---..........----.-----.................
ENSDARP00000102911  ........-----....................-....---..........----.-----.................
ENSDARP00000032159  ........-----....................-....---..........----.-----.................
ENSDARP00000079570  ........-----....................-....---..........----.-----.................
ENSDARP00000007708  ........-----....................-....---..........----.-----.................


                                                        50        60                                
                                                         |         |                                
d1pgua1               ..................................DSKVPPVVQFTGH...............................
ENSDARP00000017859  ..................................----KFEKTISGH...............................
ENSDARP00000039257  ..................................----DFERTLKGH...............................
ENSDARP00000042217  ..................................----DFERTLKGH...............................
ENSDARP00000080947  ..................................----KCLRTLVGH...............................
ENSDARP00000026057  ..................................----ARAFRFVGH...............................
ENSDARP00000116595  ..................................----EELHTLEGH...............................
ENSDARP00000074155  ..................................----TPHHTSRGH...............................
ENSDARP00000038728  ..................................--DCENYATLKGH...............................
ENSDARP00000088166  ..................................----TLIRTLRGH...............................
ENSDARP00000103157  ..................................----TLIRTLRGH...............................
ENSDARP00000111963  ..................................----NKVHAIPLR...............................
ENSDARP00000018443  ..................................----NKVHAIPLR...............................
ENSDARP00000079424  ..................................----NKVHAIPLR...............................
ENSDARP00000015825  ........................sddvlerimdEKTSSESKILHGH...............................
ENSDARP00000024623  ..................................----NCIMSLTGH...............................
ENSDARP00000051230  ..................................----NKIHAIPLR...............................
ENSDARP00000044330  ..................................------KRKLTAR...............................
ENSDARP00000079567  ..................................STQLVLRHCIREGgqdvp..........................
ENSDARP00000017443  ..................................----NKVHAIPLK...............................
ENSDARP00000107302  ..................................----KLKLSLTGH...............................
ENSDARP00000005843  ..................................----NKVNAVPLK...............................
ENSDARP00000104051  ..................................----EMIMTGEGH...............................
ENSDARP00000061000  ..................................TNYGIPQRALRGH...............................
ENSDARP00000017497  ..................................----ECLKILTGH...............................
ENSDARP00000011435  ..................................----NKEHAVTMP...............................
ENSDARP00000072190  ..................................----NKEHAVTMP...............................
ENSDARP00000037531  ..................................----ECLKVLTGH...............................
ENSDARP00000038258  .......................cdvleeeaddeDASGSEIKTLRGH...............................
ENSDARP00000076048  ..................................----NLASTLGQH...............................
ENSDARP00000060977  ..................................----TLLKTYTGH...............................
ENSDARP00000079570  ..................................----NLSSTLGQH...............................
ENSDARP00000060431  ..................................--ERRCVRTFIGH...............................
ENSDARP00000027484  ..................................----NFETILQAH...............................
ENSDARP00000076693  ..................................--SWECKCVLSDG...............................
ENSDARP00000089117  ..................................----KIRKDLKYQaqdnfmm........................
ENSDARP00000079014  ..................................--TYKCQKTLEGH...............................
ENSDARP00000122900  ..................................----HLLATLRGH...............................
ENSDARP00000106094  ..................................--SELPFSPLSGH...............................
ENSDARP00000105402  ..................................--SELPFSPLSGH...............................
ENSDARP00000107355  ..................................----TLIDKFDEH...............................
ENSDARP00000099894  ..................................----RLHSTLRGH...............................
ENSDARP00000114236  ..................................----RLLATLRGH...............................
ENSDARP00000068184  ..................................----KICKDLKYQaqdnfmm........................
ENSDARP00000024391  ..................................----DWIGTFLGH...............................
ENSDARP00000096338  ..................................KSPMAQLDCLNR-...............................
ENSDARP00000117865  ..................................KSPMAQLDCLNR-...............................
ENSDARP00000105810  ..................................----EKLLELQAH...............................
ENSDARP00000109528  ..................................--RCEPKGALTGS...............................
ENSDARP00000110967  ..................................ALDVEPIYTFRAH...............................
ENSDARP00000097371  ..................................----QIVATLKGH...............................
ENSDARP00000068663  ..................................----NSCQILHGH...............................
ENSDARP00000096387  ..................................--KDPYIASMEHH...............................
ENSDARP00000073472  ..................................--RLVKENNYRGH...............................
ENSDARP00000056247  ..................................-KQDPYIASMEHH...............................
ENSDARP00000045014  ..................................----NKMHAIPLR...............................
ENSDARP00000090792  ..................................KSPVSQLDCLNR-...............................
ENSDARP00000019743  ..................................KSPVSQLDCLNR-...............................
ENSDARP00000028733  ..................................--QVTRLCDLSVD...............................
ENSDARP00000104487  ..................................SFDVEPIYTFRGH...............................
ENSDARP00000079959  ..................................ALDVEPIYTFRAH...............................
ENSDARP00000065646  ..................................----KKVQKIAGGrkgtedc........................
ENSDARP00000005989  ..................................-------------...............................
ENSDARP00000062413  ..................................-------------...............................
ENSDARP00000003004  ..................................--QVTRLCDLSVE...............................
ENSDARP00000024168  ..................................----KPKRTLYSK...............................
ENSDARP00000077651  ..................................NKPPVIRFKRNKH...............................
ENSDARP00000124018  ..................................----KVLSSFNGH...............................
ENSDARP00000068125  ..................................----GLQRSVSFS...............................
ENSDARP00000084377  ..................................SQQLKQLKTLEGH...............................
ENSDARP00000109369  ..................................KQPDICFKRIKHH...............................
ENSDARP00000004327  ..................................----KAVMTVAGH...............................
ENSDARP00000112164  ..................................----KELPLVIQG...............................
ENSDARP00000109556  ................................qnMENHPVIRTLYDH...............................
ENSDARP00000036145  ..................................THQLKLLRTLEGH...............................
ENSDARP00000101521  ..................................----RLCKSFQGH...............................
ENSDARP00000101197  ..................................----VIQDAVDIHypvnemt........................
ENSDARP00000065847  ..................................----KLLASVSGH...............................
ENSDARP00000099567  ..................................---SKLITMHTGH...............................
ENSDARP00000038520  ..................................--NWNKIHVLKEH...............................
ENSDARP00000106434  ..................................----EPIRNFTRF...............................
ENSDARP00000033992  ..................................--QSSVLKEWQAH...............................
ENSDARP00000060548  ..................................----KELLRITVP...............................
ENSDARP00000105555  ..................................NQSFTEMHCMNGH...............................
ENSDARP00000087578  ..................................----RCLKTVQV-...............................
ENSDARP00000076761  ..................................----EVLLECTGH...............................
ENSDARP00000119160  ..................................ENIPKLLCQMDNH...............................
ENSDARP00000099166  ..................................----KCLLKYAGH...............................
ENSDARP00000079110  spspsqeslcssksdteggfgaavedadtedrnvPFRQVPFCKYKGH...............................
ENSDARP00000028109  ..................................----ECTRTVQAH...............................
ENSDARP00000017792  ..................................----ERLGTYNGH...............................
ENSDARP00000091471  ..................................-------------...............................
ENSDARP00000015105  ..................................--GQTVPKAQQMH...............................
ENSDARP00000005640  ..................................-------------...............................
ENSDARP00000112282  ..................................----QEIMSLGDH...............................
ENSDARP00000010862  ..................................----NKIHAIPLR...............................
ENSDARP00000112131  ..................................SGECTPDLRLRGH...............................
ENSDARP00000117542  ..................................SGDCSPDLRLRGH...............................
ENSDARP00000027560  ..................................RFTLKKTVKARDV...............................
ENSDARP00000110861  ..................................--KLELQWTLEGH...............................
ENSDARP00000102565  ..................................----KCVAVFEGH...............................
ENSDARP00000093657  ..................................-------------...............................
ENSDARP00000008451  ..................................----GFVERLNLRvgrkps.........................
ENSDARP00000110420  .................ymdsntstlldtdctisSNSEKVDPQTSE-...............................
ENSDARP00000101565  ..................................----AIADVYTEH...............................
ENSDARP00000111921  ..................................----SMRMKYQH-...............................
ENSDARP00000018714  ..................................EGENKELWSSGHH...............................
ENSDARP00000097750  ..................................----KVKTTIRSG...............................
ENSDARP00000105810  ..................................----KASVKLSGH...............................
ENSDARP00000065337  ..................................DEEWTIEPTFTHHa..............................
ENSDARP00000016280  ..................................----SPVPVMELG...............................
ENSDARP00000071264  ........saciyssaakglyiasdsiallslktKPQPKGIQIVSH-...............................
ENSDARP00000073678  ..................................KAVVEFLS----Nlar............................
ENSDARP00000070393  ..................................----KAELEFDSG...............................
ENSDARP00000100903  ..................................DRDHKCLRANIE-...............................
ENSDARP00000099551  ..................................-------------...............................
ENSDARP00000063641  ..................................DRDHKCLRANIE-...............................
ENSDARP00000104754  ..................................--QFQRVLTLTGH...............................
ENSDARP00000014740  ..................................----QEIMSLGGH...............................
ENSDARP00000106749  ..................................---------LDGS...............................
ENSDARP00000003237  .................................kKKAKKAAEPIEGH...............................
ENSDARP00000115064  ..................................----DDPKSINV-...............................
ENSDARP00000071531  ..................................--GQILVADLRGH...............................
ENSDARP00000105980  ..................................DLLSEMSPVLKMA...............................
ENSDARP00000113946  ..................................-PRGALMHTLGGRgtist..........................
ENSDARP00000079302  ..................................-----------GH...............................
ENSDARP00000111824  ..................................EKEATPLFSFAGH...............................
ENSDARP00000008006  ..................................-------------...............................
ENSDARP00000079585  ..................................----TTVSILRDV...............................
ENSDARP00000104171  ..................................--------SFSS-...............................
ENSDARP00000052711  ..................................----RAERVLESH...............................
ENSDARP00000059208  ..................................---GQYWPSVYHT...............................
ENSDARP00000006309  ..................................----QYWPSIYHT...............................
ENSDARP00000102210  ..................................----HQVGQFQGH...............................
ENSDARP00000124457  ..................................--TLQQEYVPSAH...............................
ENSDARP00000010071  ..................................----QCVYGIQTH...............................
ENSDARP00000092538  ..................................----ECYCQHES-...............................
ENSDARP00000031340  ..................................-------------...............................
ENSDARP00000059344  ..................................----QCVKHYVGH...............................
ENSDARP00000074880  ..................................--PSFPEFIFNT-...............................
ENSDARP00000026454  ..................................-RIDKAYPTVCGH...............................
ENSDARP00000099918  ..................................----RFKLVQKT-...............................
ENSDARP00000121552  ..................................--NNHPEFLFNT-...............................
ENSDARP00000007696  ..................................---------VCGH...............................
ENSDARP00000080844  ..................................----KATPEYIFH...............................
ENSDARP00000071301  ..................................-----SQPTVCGH...............................
ENSDARP00000079585  ..................................------MKSIKAH...............................
ENSDARP00000106510  ..............aegkgdqflvgtsrnfilrgTFNDGFQVEVQGH...............................
ENSDARP00000037121  ..................................----KTTPEYIYHc..............................
ENSDARP00000124137  ..................................----QQLICFRQA...............................
ENSDARP00000039795  ..................................GRIDKAYPTVCGH...............................
ENSDARP00000079663  ..................................EGKTTTTRSVLTYsr.............................
ENSDARP00000056762  ..................................--DTSVVVKLQD-...............................
ENSDARP00000024476  ..................................--IMQTKATIMS-...............................
ENSDARP00000126101  ..................................--IMQTKATIMS-...............................
ENSDARP00000087003  ..................................----KTTPEYVFH...............................
ENSDARP00000065205  ..................................-----TWPDRVFH...............................
ENSDARP00000110420  ..................................----KQHHIINSS...............................
ENSDARP00000059666  ..................................----EWLHNLQGH...............................
ENSDARP00000101126  ..................................----SPVSKLRMS...............................
ENSDARP00000060548  ..................................----GKQSFLHGH...............................
ENSDARP00000078100  ..................................---IPVKTLFDCH...............................
ENSDARP00000078191  ..................................----ERLDYFYNGnp.............................
ENSDARP00000078965  ..................................----------CGH...............................
ENSDARP00000102373  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000006117  ..................................--NKQPEMTLKS-...............................
ENSDARP00000111140  ..................................KLPDTALPTIQN-...............................
ENSDARP00000094274  ..................................----TEQRNLGGH...............................
ENSDARP00000075344  ..................................----NVLELYKEF...............................
ENSDARP00000106181  ..................................--SEAPRKISRQS...............................
ENSDARP00000089501  ..................................----ECYCQHES-...............................
ENSDARP00000102443  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000038921  ..................................KLPDTALPTIQN-...............................
ENSDARP00000033554  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000100360  ..................................-----PITVIDLRetdqgy.........................
ENSDARP00000014182  ..................................---------VSGH...............................
ENSDARP00000027152  ..................................RPGVDCHSQHES-...............................
ENSDARP00000108102  ..................................-----------GH...............................
ENSDARP00000107806  ..................................--------VLKGH...............................
ENSDARP00000007602  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000021430  ..................................-------------...............................
ENSDARP00000087525  ..................................----------GGH...............................
ENSDARP00000054317  ..................................--ELQLVREIEK-...............................
ENSDARP00000110907  ..................................----QQITCYRSP...............................
ENSDARP00000074797  ..................................NLNPKRPDVIIDV...............................
ENSDARP00000047739  ..................................----RHIKTLVEA...............................
ENSDARP00000079585  ..................................----ASNTIINGH...............................
ENSDARP00000055337  ..................................ERSQK--------...............................
ENSDARP00000058220  ..................................SSEFVCRNTFDH-...............................
ENSDARP00000102332  ..................................KESPTCLRVLYGH...............................
ENSDARP00000003173  ..................................-GEWHCTASWKTH...............................
ENSDARP00000064438  ..................................DEEPQLLCDSQH-...............................
ENSDARP00000099721  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000026825  ............................stfqshEPDFDYLKSLEI-...............................
ENSDARP00000100187  ..................................-----RLQSFIGH...............................
ENSDARP00000059532  ..................................----TEICNYSY-...............................
ENSDARP00000099725  ..................................--SNPKIQTVHLE...............................
ENSDARP00000084300  ..................................EPEFDYLKSLEI-...............................
ENSDARP00000124280  ..................................-----LHARVCGH...............................
ENSDARP00000100360  ............................eiievgEKNAACNILVNGH...............................
ENSDARP00000110672  ..................................----TEQRNLGGH...............................
ENSDARP00000060454  ..................................----ETSKLFNEDrli............................
ENSDARP00000098826  ..................................----ETSKLFNEErli............................
ENSDARP00000091438  ..................................----NKTSFIQGKg..............................
ENSDARP00000098798  ..................................QYTLQQTCVFNKTddssedcmsnlgsp.................
ENSDARP00000091436  ..................................PSNLSMNQTLEGH...............................
ENSDARP00000086480  ..................................------------H...............................
ENSDARP00000099546  ..................................----QPLHTLSGH...............................
ENSDARP00000061333  ..................................----KRDRFTTKPadpkygk........................
ENSDARP00000037790  ..................................----KEKEKQEFL...............................
ENSDARP00000032005  ...............................qshEPEFDYLKSLEI-...............................
ENSDARP00000008668  ..................................-----VVHTYTGH...............................
ENSDARP00000103874  ..................................-------------...............................
ENSDARP00000043116  ..................................----DYSVVFYGH...............................
ENSDARP00000063737  .......ltcaavwrmppewesgshespddssnnPQTLELLCHLDNS...............................
ENSDARP00000106107  ..................................----TEICNYSY-...............................
ENSDARP00000101619  ..................................YNEFKLRAIMSEH...............................
ENSDARP00000025827  ..................................----KTVGQHIRH...............................
ENSDARP00000100360  ..................................----KVLAAAQGC...............................
ENSDARP00000003197  ..................................----KLTQIVFGH...............................
ENSDARP00000012553  ..................................----STAPTLKHR...............................
ENSDARP00000003663  ..................................-------------...............................
ENSDARP00000069897  ..................................--NLEPPLELTGH...............................
ENSDARP00000018434  ..................................GVEFNSLQVFMH-...............................
ENSDARP00000093342  ..................................----KLTQIVFGH...............................
ENSDARP00000100360  ..................................-------------...............................
ENSDARP00000102548  ..................................----QTIQVLERH...............................
ENSDARP00000041156  ..................................----KLTQIVFGH...............................
ENSDARP00000108156  ..................................----MEKGHLDHE...............................
ENSDARP00000070070  ..................................-------------...............................
ENSDARP00000018924  ..................................--------DFEM-...............................
ENSDARP00000123525  ..................................--KLEVVQTWAL-...............................
ENSDARP00000109363  ..................................-------------...............................
ENSDARP00000103752  ..................................-------------...............................
ENSDARP00000101029  ..................................----SLIAQHRQH...............................
ENSDARP00000101492  ..................................----DKFYLKPTHsirnet.........................
ENSDARP00000038543  ..................................----KLVGRICRH...............................
ENSDARP00000079585  ..................................-------------...............................
ENSDARP00000104754  ..................................----RVVDLLNKH...............................
ENSDARP00000075344  ..................................--QNRRRKVLTGGem.............................
ENSDARP00000083528  ..................................--IFTATKECGDP...............................
ENSDARP00000017678  ..................................----VEVQTLKEH...............................
ENSDARP00000097777  ..................................-------------...............................
ENSDARP00000109722  ..................................SKDLAG------Kefvpk..........................
ENSDARP00000083772  ..................................SSGLECELSTDLG...............................
ENSDARP00000065266  ..................................-------------...............................
ENSDARP00000088806  ..................................----KCVHSLVGH...............................
ENSDARP00000109028  ..................................-------------...............................
ENSDARP00000095457  ..................................----KCLHSLVGH...............................
ENSDARP00000086448  ..................................----DPVCVGDDG...............................
ENSDARP00000117869  ..................................HNDGKECLQFTQD...............................
ENSDARP00000035593  ..................................----EFMGLHDE-...............................
ENSDARP00000086251  ..................................NTPQRINFNLRGH...............................
ENSDARP00000054352  ..................................----TEICNYSY-...............................
ENSDARP00000024810  ..................................-------------...............................
ENSDARP00000100292  ..................................--SMQHNSVQVG-...............................
ENSDARP00000079585  ..................................-----------EH...............................
ENSDARP00000009095  ..................................-------------...............................
ENSDARP00000101029  ..................................----EMELKLQPQ...............................
ENSDARP00000118167  ..................................NTPQRINFNLRGH...............................
ENSDARP00000101029  ..................................----GQQRFFIGH...............................
ENSDARP00000050905  ..................................----LVLKKYKVP...............................
ENSDARP00000078100  ..................................---IPVKTLFDCH...............................
ENSDARP00000046545  ..................................-------------...............................
ENSDARP00000032408  ..................................-------------...............................
ENSDARP00000104388  ..................................----KMAEKFKAK...............................
ENSDARP00000101882  ..................................-------------...............................
ENSDARP00000093519  ..................................-------------...............................
ENSDARP00000112439  ..................................-------------...............................
ENSDARP00000071650  ..................................-------------...............................
ENSDARP00000099546  ..................................------KSTLRGF...............................
ENSDARP00000111616  ..................................--INPQQLQLEC-...............................
ENSDARP00000019506  ..................................--IMVYWHALET-...............................
ENSDARP00000076262  ..................................-------------...............................
ENSDARP00000080599  ..................................-GNGSEIGVFSL-...............................
ENSDARP00000084220  ..................................----TERSLLKGF...............................
ENSDARP00000080965  ..................................-GNGNEIGVFSL-...............................
ENSDARP00000123525  ..................................----LPLCSHSLL...............................
ENSDARP00000018692  ..................................-------------...............................
ENSDARP00000008672  .................................lI-----------Crvkkllslkmgsnqadhka............
ENSDARP00000094999  ..................................-----QMNKYNLEg..............................
ENSDARP00000116849  ..................................-------------...............................
ENSDARP00000104388  ..................................----ENIFRINGQ...............................
ENSDARP00000072504  ..................................-------------...............................
ENSDARP00000052786  ..................................-------------...............................
ENSDARP00000076812  ..................................-------------...............................
ENSDARP00000047833  ..................................GSIIGKCQVPKD-...............................
ENSDARP00000097904  ..................................----QETQKFTV-...............................
ENSDARP00000102548  ..................................TVKDGARIPPDG-...............................
ENSDARP00000082368  ..................................-------------...............................
ENSDARP00000109749  ..................................-------------...............................
ENSDARP00000110965  ..................................-------------...............................
ENSDARP00000095605  ..................................----KQKLILTHK...............................
ENSDARP00000091436  ..................................----DSPVIIETG...............................
ENSDARP00000111846  ..................................------VTQISCH...............................
ENSDARP00000090283  ..................................-------------...............................
ENSDARP00000008223  ..................................-------------...............................
ENSDARP00000005398  ..................................-------------...............................
ENSDARP00000020383  ..................................-------------...............................
ENSDARP00000114287  ..................................-------------...............................
ENSDARP00000101793  ..................................-------------...............................
ENSDARP00000059751  ..................................-------------...............................
ENSDARP00000117166  ..................................-LRLCLGTTATGA...............................
ENSDARP00000046545  ..................................-------------...............................
ENSDARP00000060999  ..................................----DLFWTVTGD...............................
ENSDARP00000084929  ..................................--WKKCLHSIKL-...............................
ENSDARP00000104754  ..................................-------------...............................
ENSDARP00000111156  ..................................-------------...............................
ENSDARP00000112085  ..................................----RTQRHYVGH...............................
ENSDARP00000100913  ..................................SKKVRLQHFFSPD...............................
ENSDARP00000003198  ..................................-------------...............................
ENSDARP00000027152  ..................................--TLQMLYKLKTSkvfekpktgdmgrsadlvee...........
ENSDARP00000106476  ..................................-------------...............................
ENSDARP00000104791  ..................................-------------...............................
ENSDARP00000109373  ..................................--------LLSGH...............................
ENSDARP00000092538  ..................................-------------...............................
ENSDARP00000098142  ..................................-------------...............................
ENSDARP00000044811  ..................................----KVKTVIQF-...............................
ENSDARP00000024810  ..................................--SLKPLYKLSTAsifqtdcehndsltqageeewppfrkvgcfd
ENSDARP00000075280  ..................................-------------...............................
ENSDARP00000076048  ..................................-------------...............................
ENSDARP00000089501  ..................................-------------...............................
ENSDARP00000107630  ..................................DQTWSLSHSWTF-...............................
ENSDARP00000092069  ..................................KESVVSCSTIKSG...............................
ENSDARP00000018100  ..................................GQLNEYTERKEM-...............................
ENSDARP00000108631  ..................................GQLNEYTERKEM-...............................
ENSDARP00000111537  ..................................PEVHQLLSHIKAS...............................
ENSDARP00000035593  ..................................-------------...............................
ENSDARP00000109913  ..................................----TCVKTWQDE...............................
ENSDARP00000103234  ..................................-------------...............................
ENSDARP00000026432  ..................................-------------...............................
ENSDARP00000078268  ..................................----EAVPVFKS-...............................
ENSDARP00000078255  ..................................-------------...............................
ENSDARP00000102911  ..................................-------------...............................
ENSDARP00000032159  ..................................-------------...............................
ENSDARP00000079570  ..................................---------LRGH...............................
ENSDARP00000007708  ..................................-------------...............................


                                     70                                      80                     
                                      |                                       |                     
d1pgua1               .....GSSVVTTV...KFSPI.....................KG.........SQYLCS......G............
ENSDARP00000017859  .....-KLGISDV...AWSS-.....................DS.........-NLLVS......A............
ENSDARP00000039257  .....-TDSVQDI...SFDQ-.....................TG.........-KLLAS......C............
ENSDARP00000042217  .....-TDSVQDI...SFDH-.....................TG.........-KLLAS......C............
ENSDARP00000080947  .....-TGGVWSS...QMRD-.....................--.........-NIIIS......G............
ENSDARP00000026057  .....-TDVITGV...NFAP-.....................SG.........-SLVAS......S............
ENSDARP00000116595  .....-RNVVYAI...AFNNP.....................YG.........-DKVAT......G............
ENSDARP00000074155  .....-THWVLSI...AWSP-.....................DG.........-KKLAS......G............
ENSDARP00000038728  .....-SGAVMEL...HYNT-.....................DG.........-SLLFS......A............
ENSDARP00000088166  .....-NTNVGAI...SFHPQatltlee..............S-.........DVNMAS......C............
ENSDARP00000103157  .....-NTNVGAI...SFHPQatltlee..............S-.........DVNMAS......C............
ENSDARP00000111963  .....-SSWVMTC...AYAP-.....................SG.........-NYVAC......G............
ENSDARP00000018443  .....-SSWVMTC...AYAP-.....................SG.........-NYVAC......G............
ENSDARP00000079424  .....-SSWVMTC...AYAP-.....................SG.........-NYVAC......G............
ENSDARP00000015825  .....-SGPVYGV...SFSP-.....................DR.........-NYLLS......S............
ENSDARP00000024623  .....-TSAVGCI...QFNS-.....................SE.........-ERVVA......G............
ENSDARP00000051230  .....-SSWVMTC...AYAP-.....................SG.........-NFVAC......G............
ENSDARP00000044330  .....-SDRVKSV...DLHP-.....................SE.........-PWMLA......S............
ENSDARP00000079567  .....SNKDVTSL...DWNS-.....................EG.........-TLLAT......G............
ENSDARP00000017443  .....-SSWVMTC...SYAP-.....................SG.........-NMVAC......G............
ENSDARP00000107302  .....-ISTVRGV...AVSN-.....................RS.........-PYLFS......C............
ENSDARP00000005843  .....-SSWVMTC...SYAP-.....................SG.........-NLVAS......G............
ENSDARP00000104051  .....-TDWLSSC...SFHP-.....................SG.........-DFLGT......T............
ENSDARP00000061000  .....-SHFVSDV...VISS-.....................DG.........-QFALS......G............
ENSDARP00000017497  .....-TGSVLCL...QYDE-.....................--.........-RVIVT......G............
ENSDARP00000011435  .....-CTWVMAC...AYAP-.....................SG.........-CAVAC......G............
ENSDARP00000072190  .....-CTWVMAC...AYAP-.....................SG.........-CAVAC......G............
ENSDARP00000037531  .....-TGSVLCL...QYDE-.....................--.........-RVIVT......G............
ENSDARP00000038258  .....-SGPVYRT...AFLT-.....................DA.........-SGLLS......C............
ENSDARP00000076048  .....-KGPIFAL...KWNK-.....................KG.........-NFILS......A............
ENSDARP00000060977  .....-GYEVLDA...DGSY-.....................DN.........-SQLCS......C............
ENSDARP00000079570  .....-KGPIFAL...KWNK-.....................KG.........-NSILS......A............
ENSDARP00000060431  .....-SKAVRDV...CFNN-.....................SG.........-TQFLS......A............
ENSDARP00000027484  .....-DSPVRAM...TWSH-.....................ND.........-MWMLT......A............
ENSDARP00000076693  .....HQRTVRKV...AWSP-.....................CG.........-KYLAS......A............
ENSDARP00000089117  .....MDDAVLCM...SFSR-.....................DT.........-EMLAT......G............
ENSDARP00000079014  .....-DGIVLAL...CIQG-.....................--.........-NKLYS......G............
ENSDARP00000122900  .....-AAEISDM...AVNY-.....................EN.........-TLLAA......G............
ENSDARP00000106094  .....-GYGVHCC...CFSA-.....................CG.........-QYLAS......C............
ENSDARP00000105402  .....-GYGVHCC...CFSA-.....................CG.........-QYLAS......C............
ENSDARP00000107355  .....-DGPVRGI...DFHK-.....................QQ.........-PLFVS......G............
ENSDARP00000099894  .....-YAEISDL...AVNF-.....................EN.........-TLIAA......G............
ENSDARP00000114236  .....-AAEISDM...TVNF-.....................EN.........-TLLAS......A............
ENSDARP00000068184  .....MDEAVLCL...AVSH-.....................DS.........-HVIAS......G............
ENSDARP00000024391  .....-KGAVWGA...TLNT-.....................EA.........-TKAAT......A............
ENSDARP00000096338  .....-DNYIRSC...KILP-.....................DG.........-RTLIV......G............
ENSDARP00000117865  .....-DNYIRSC...KLLP-.....................DG.........-RTLIV......G............
ENSDARP00000105810  .....-EEDVLCC...AFSP-.....................DD.........-RHIAT......C............
ENSDARP00000109528  .....-NAGITSI...EFDS-.....................AG.........-SYLLA......A............
ENSDARP00000110967  .....-SGAVLSL...AMGE-.....................EG.........-ESCFS......G............
ENSDARP00000097371  .....-TKKVSSV...IYHP-.....................AQ.........-AVVFS......A............
ENSDARP00000068663  .....-TDTILSI...DVFR-.....................KG.........-SMFAT......C............
ENSDARP00000096387  .....-TDWVNDI...VLCC-.....................NG.........-KTLIS......A............
ENSDARP00000073472  .....-GDSVDQL...CWHP-.....................TN.........PDLFVT......A............
ENSDARP00000056247  .....-TDWVNDI...ILCC-.....................NG.........-KTLIS......A............
ENSDARP00000045014  .....-SSWVMTC...AYAP-.....................SG.........-NYVAC......G............
ENSDARP00000090792  .....-DNYIRSC...KLLP-.....................DG.........-RTLIV......G............
ENSDARP00000019743  .....-DNYIRSC...KLLP-.....................DG.........-RTLIV......G............
ENSDARP00000028733  .....-GDSVTSV...CWNE-.....................RG.........-SLVAV......G............
ENSDARP00000104487  .....-IGPVLSL...AVTS-.....................SG.........-EQCFS......G............
ENSDARP00000079959  .....-RGPVLCV...VMSS-.....................SG.........-EQCFS......G............
ENSDARP00000065646  .....HTAHILCM...AISS-.....................DG.........-KYLAS......G............
ENSDARP00000005989  .....--------...---Q-.....................DQ.........-LLLAT......G............
ENSDARP00000062413  .....--DGLFDV...TWSE-.....................NN.........EHVLVT......G............
ENSDARP00000003004  .....-GDSVTSV...GWSE-.....................RG.........-NLVAV......G............
ENSDARP00000024168  .....-KYGVDLI...RYTH-.....................AA.........NTVVYS......S............
ENSDARP00000077651  .....HKGSIYCV...AWSP-.....................CG.........-QLLAT......G............
ENSDARP00000124018  .....-LSVVYDL...CWSR-.....................DD.........-KGLLT......A............
ENSDARP00000068125  .....-NMALSSC...LMLP-.....................DD.........-KIVVC......S............
ENSDARP00000084377  .....-AYGVSYL...AWSP-.....................DD.........-TYLIA......C............
ENSDARP00000109369  .....-KGSIYCV...AWSP-.....................CG.........-QLLAT......G............
ENSDARP00000004327  .....-ADVVKDV...AWVKR.....................DGl........NSVLLT......A............
ENSDARP00000112164  .....HSGSVRAV...LVCE-.....................EK.........-DLVIS......A............
ENSDARP00000109556  .....-VDEVTCL...SFHP-.....................TE.........-QILAS......G............
ENSDARP00000036145  .....-AYGVSYL...AWSP-.....................DD.........-VYLIA......C............
ENSDARP00000101521  .....-NREITKL...CCFK-.....................GS.........-SLIFS......A............
ENSDARP00000101197  .....CNSKISCI...SWSS-.....................YH.........KNLLAS......S............
ENSDARP00000065847  .....-TGPVKCC...VFSS-.....................DG.........-RLFAS......A............
ENSDARP00000099567  .....-AANIFSV...KFLPH.....................SD.........DRILIT......G............
ENSDARP00000038520  .....-NGQVTGI...DWAP-.....................ES.........-NRIVT......C............
ENSDARP00000106434  .....-HDTAYGG...SFRG-.....................DG.........-KLLVA......G............
ENSDARP00000033992  .....-DNAVFDI...AWVP-.....................GT.........-NCLVT......A............
ENSDARP00000060548  .....-NITCHAL...GFMR-.....................DG.........-RSIFS......A............
ENSDARP00000105555  .....-SNFVSCV...CIISP.....................NEtyp......RGLIAT......G............
ENSDARP00000087578  .....-GGAVKGV...AWNP-.....................NP.........SICLVA......V............
ENSDARP00000076761  .....-KDSVVCV...GFSS-.....................DS.........-ALAAS......G............
ENSDARP00000119160  .....-LACVNCV...RWSN-.....................NG.........-LYLAS......G............
ENSDARP00000099166  .....-AGSVNSI...KFHP-.....................TE.........-QMALT......A............
ENSDARP00000079110  .....-TADLLDL...SWSK-.....................--.........NYFLLS......S............
ENSDARP00000028109  .....-EGFVRGI...CSRF-.....................CG.........-TSFFT......V............
ENSDARP00000017792  .....-TGAVWCV...DVDW-.....................DT.........-KNVLT......G............
ENSDARP00000091471  .....--------...-----.....................DG.........-RYMLS......G............
ENSDARP00000015105  .....-TGPVLDV...CWSD-.....................DG.........-SKVFT......A............
ENSDARP00000005640  .....--EPITCH...AWNR-.....................DR.........-TQIAI......S............
ENSDARP00000112282  .....-PSSVVSV...RYCS-.....................--.........-SLVFT......V............
ENSDARP00000010862  .....-SSWVMTC...AYAP-.....................SG.........-NYVAC......G............
ENSDARP00000112131  .....-QKEGYGL...SWNP-.....................NL.........SGCLLS......A............
ENSDARP00000117542  .....-QKEGYGL...SWNP-.....................NL.........SGNLLS......A............
ENSDARP00000027560  .....-GWSILDV...CFTP-.....................DA.........-RCVLY......S............
ENSDARP00000110861  .....-QLGVVSV...NISQ-.....................NG.........-AIAAS......S............
ENSDARP00000102565  .....-SSKVNCL...LVSC-.....................GGgl.......QQRLYS......G............
ENSDARP00000093657  .....---PLSCH...AWNK-.....................DR.........-TQIAI......S............
ENSDARP00000008451  .....LNFSCADV...MWHQM.....................EE.........-NLLAT......A............
ENSDARP00000110420  .....NRTGIRTM...CVSP-.....................DG.........-LHLAS......G............
ENSDARP00000101565  .....-PHQVIVA...KYCP-.....................SG.........-FYIAS......G............
ENSDARP00000111921  .....-LAPVLDC...AFSD-.....................--.........PTHAWS......G............
ENSDARP00000018714  .....-LKSCRKV...LFSS-.....................DG.........-QKLFS......V............
ENSDARP00000097750  .....HRANIFSA...KFMPH.....................TN.........DQQIVS......C............
ENSDARP00000105810  .....-TKTVHHC...QFTD-.....................DC.........-EILIT......S............
ENSDARP00000065337  .....HTASLNAV...SSSN-.....................--.........-QFIAT......G............
ENSDARP00000016280  .....EGKKQTRV...SLNS-.....................TS.........-QFLVS......G............
ENSDARP00000071264  .....-KEPVLCC...GYSE-.....................QF.........-RQVVS......C............
ENSDARP00000073678  .....HTKAVNVV...RFSP-.....................TA.........-EVLAS......G............
ENSDARP00000070393  .....HKSNVFQA...KFLPH.....................SG.........DSTLAM......C............
ENSDARP00000100903  .....-FDHATLV...RFSP-.....................DS.........-RAFIT......W............
ENSDARP00000099551  .....--------...-----.....................--.........------......-............
ENSDARP00000063641  .....-FDHATLV...RFSP-.....................DS.........-RAFIT......W............
ENSDARP00000104754  .....-EDWVRGV...EWANK.....................DG.........ELWLAS......C............
ENSDARP00000014740  .....-PNNVVSV...RYSS-.....................--.........-SLVFT......V............
ENSDARP00000106749  .....-NEGITSI...EFDP-.....................TG.........-TRILA......A............
ENSDARP00000003237  .....-TDAVLDL...SWNRL.....................VR.........-NVLAS......A............
ENSDARP00000115064  .....-GEKVYSV...ALKN-.....................--.........-GKLVT......A............
ENSDARP00000071531  .....-EGPVWQV...AWAHPm....................YG.........-NILAS......C............
ENSDARP00000105980  .....EGDTIYDY...CWFPKmtstdp...............DT.........-CFIAS......S............
ENSDARP00000113946  .....HRGWVWCL...ASSG-.....................--.........-PLLAS......G............
ENSDARP00000079302  .....-FGCVNAI...EFSN-.....................NG.........GQWLVS......G............
ENSDARP00000111824  .....-MSEGFAI...DWSP-.....................KV.........PGRMVS......G............
ENSDARP00000008006  .....-----FGM...DVQP-.....................SS.........-GRLIG......G............
ENSDARP00000079585  .....HTHGVACL...AFDA-.....................DG.........-QRLAS......V............
ENSDARP00000104171  .....-PHRYHKL...VWGP-.....................HGienqglp..SGVLIA......G............
ENSDARP00000052711  .....AGNSVIWL...NTFN-.....................NS.........RSCLIS......Q............
ENSDARP00000059208  .....MPVACSCM...SFNP-.....................ET.........-RRISV......G............
ENSDARP00000006309  .....VSSPCSCV...SYHH-.....................ES.........-RRIFI......G............
ENSDARP00000102210  .....-TAPVCGV...RFSH-.....................MS.........PHLLFS......G............
ENSDARP00000124457  .....LSAACTCV...TWGPCravqevpqrkrrkcdaassaeQ-.........SDLLAL......G............
ENSDARP00000010071  .....---TCATV...KFDE-.....................--.........-QKLVT......G............
ENSDARP00000092538  .....-GAAVIQL...QFLI-.....................NE.........-GALVS......A............
ENSDARP00000031340  .....------RL...QFAN-.....................DD.........KHLLAC......C............
ENSDARP00000059344  .....-GNAINEL...KFHP-.....................RD.........PNLLLS......V............
ENSDARP00000074880  .....-DSGVMCV...DIHE-.....................QL.........SYLVAV......G............
ENSDARP00000026454  .....-TGPVLDI...DWCPH.....................ND.........-QVIAS......G............
ENSDARP00000099918  .....-GQACTAL...AFNL-.....................RR.........TTEFLV......A............
ENSDARP00000121552  .....-DSGVMCV...DIHE-.....................QK.........SHLVAV......G............
ENSDARP00000007696  .....-AAPVLDV...QWCPH.....................DD.........-NVIAS......A............
ENSDARP00000080844  .....CQSSVMSV...GFAQ-.....................FH.........PNLVIG......G............
ENSDARP00000071301  .....-TGPVLDI...EFCPH.....................ND.........-NIIAS......G............
ENSDARP00000079585  .....-DGPVFAM...CSLD-.....................--.........-KIYVT......G............
ENSDARP00000106510  .....-TDELWGL...ATHP-.....................FK.........-DLFLT......C............
ENSDARP00000037121  .....QQSPVVSVgfaLFHP-.....................--.........-NLLVG......G............
ENSDARP00000124137  .....GNARVTRL...YFNS-.....................QG.........-NKCGV......A............
ENSDARP00000039795  .....-TGPVLDI...DWCPH.....................ND.........-HVIAS......G............
ENSDARP00000079663  .....IGGHVKTL...TFCQ-.....................GS.........-HYLAV......A............
ENSDARP00000056762  .....-EIYPIDL...HWFP-.....................KTvsgkkqaa.AEIFAL......T............
ENSDARP00000024476  .....-KSPLLSL...EWAA-.....................KP.........DRLLLL......G............
ENSDARP00000126101  .....-KSPLLSL...EWAA-.....................KP.........DRLLLL......G............
ENSDARP00000087003  .....CQSAVMSA...AFAQ-.....................FH.........PNLVVG......G............
ENSDARP00000065205  .....CESGVTAL...DFSA-.....................SN.........ANQLAV......G............
ENSDARP00000110420  .....-RKTITTV...SFSP-.....................DG.........-KYVVT......G............
ENSDARP00000059666  .....-NNQVTGI...AFNP-.....................AN.........QLQVYS......C............
ENSDARP00000101126  .....ADDDVTCV...AFSP-.....................SA.........-PCMLY......A............
ENSDARP00000060548  .....-TNNVSCI...SVSK-.....................SG.........-RYIAS......G............
ENSDARP00000078100  .....PEGGVAAL...ALSK-.....................DS.........-KYLVT......Vgaglvqrvcirn
ENSDARP00000078191  .....RYTRITAM...EYLNGh....................DC.........-SLLLT......A............
ENSDARP00000078965  .....-QGNVLDI...KWNPF.....................HD.........-NIIAS......C............
ENSDARP00000102373  .....-EEKINKI...RWLPQ.....................QN.........AAYFLL......S............
ENSDARP00000006117  .....-VSPLVCL...EYNL-.....................KN.........ISILIG......G............
ENSDARP00000111140  .....-SVNVADF...CWDP-.....................FD.........PHRLVV......A............
ENSDARP00000094274  .....-SGGVTCL...CAPPPesckrlarafdla........DK.........ERFVLS......G............
ENSDARP00000075344  .....-QEEAYSV...ALHP-.....................TG.........-LYILV......G............
ENSDARP00000106181  .....-KWDVGTV...QWNPH.....................KS.........DAHIFA......A............
ENSDARP00000089501  .....-GSAVIQL...EFLV-.....................NV.........-GALVS......A............
ENSDARP00000102443  .....-EEKINKI...RWLPQ.....................QN.........AAYFLL......S............
ENSDARP00000038921  .....-SVNVADF...CWDP-.....................FD.........PHRLVV......A............
ENSDARP00000033554  .....-EEKINKI...RWLPQ.....................QN.........AAYFLL......S............
ENSDARP00000100360  .....KGLSVRSV...CWRG-.....................--.........-DHILV......G............
ENSDARP00000014182  .....-RGNVLDI...KWNHF.....................ND.........-FCIAS......C............
ENSDARP00000027152  .....-GAAVLQM...QFLI-.....................NE.........-GALVT......A............
ENSDARP00000108102  .....-SGPVLDI...DWCPH.....................ND.........-NILAS......C............
ENSDARP00000107806  .....-FDIVRFL...VQID-.....................--.........DLRFAS......A............
ENSDARP00000007602  .....-EEKINKI...RWLPQ.....................KN.........AAQFLL......S............
ENSDARP00000021430  .....---TATSL...SWHP-.....................DG.........NHKLAV......Aysslefqrapn.
ENSDARP00000087525  .....-QGSVMDI...KWSPF.....................MD.........-NIIAS......S............
ENSDARP00000054317  .....-SKPIKCG...TFGA-.....................TSlq.......QRHLAT......G............
ENSDARP00000110907  .....GNSRVTRI...RFNY-.....................QG.........-NKFGI......V............
ENSDARP00000074797  .....-ATPVMCL...CFHP-.....................VR.........PSVVAG......G............
ENSDARP00000047739  .....HEDCVNNI...RFLD-.....................--.........NRLFAT......C............
ENSDARP00000079585  .....TQGRIWGL...ATHP-.....................SK.........-DVFIS......A............
ENSDARP00000055337  .....--------...-----.....................--.........------......-............
ENSDARP00000058220  .....-PYPTTKI...MWIP-.....................DTkgvy.....PDLLAT......S............
ENSDARP00000102332  .....-QARVFCV...KLTP-.....................--.........-SRLFS......A............
ENSDARP00000003173  .....-SGSVWRV...TWAHPe....................FG.........-QVLAS......C............
ENSDARP00000064438  .....-EGDVMDL...QFLD-.....................--.........QDRLVS......A............
ENSDARP00000099721  .....-EEKINKI...RWLPQ.....................QN.........AAHFLL......S............
ENSDARP00000026825  .....-EEKINKI...RWLPQ.....................QN.........AAHFLL......S............
ENSDARP00000100187  .....-SGTAKCL...APLA-.....................GE.........-DYFLS......G............
ENSDARP00000059532  .....-SNNILAV...RLNR-.....................--.........-QRLVV......C............
ENSDARP00000099725  .....-KFPVRRA...AFSA-.....................DG.........EQIVAT......G............
ENSDARP00000084300  .....-EEKINKI...RWLPP.....................HN.........PAHFLL......T............
ENSDARP00000124280  .....-SARVLDV...KWDPF.....................ND.........-LRIAS......C............
ENSDARP00000100360  .....MDGPVWGL...GAHP-.....................TR.........-DVFLS......A............
ENSDARP00000110672  .....-SGGVTCL...CAPPPesckrlarafdla........DK.........ERFVLS......G............
ENSDARP00000060454  .....DKSAVTCL...KWIPG.....................SE.........-NLFLV......S............
ENSDARP00000098826  .....DKSRVTCV...RWVPG.....................SE.........-SLFLV......A............
ENSDARP00000091438  .....AGDFIGGM...KFCPR.....................DS.........-SKVFV......A............
ENSDARP00000098798  .....GDPSLAPV...AWSV-.....................SG.........-KYLAA......A............
ENSDARP00000091436  .....-SGAVQVV...TWNE-.....................QY.........-QKLTT......S............
ENSDARP00000086480  .....-RDVITHI...VCSK-.....................--.........TDFILT......A............
ENSDARP00000099546  .....-KAGVLSL...KLTD-.....................KT.........-NNCLS......T............
ENSDARP00000061333  .....KTYVVKSM...AFSP-.....................DS.........-TKIAV......A............
ENSDARP00000037790  .....-EGGVGHV...EMLF-.....................RC.........-NYLALv.....G............
ENSDARP00000032005  .....-EEKINKI...RWLPQ.....................KN.........AAHFLL......S............
ENSDARP00000008668  .....-QADVHLL...LPFG-.....................--.........-NHLIS......V............
ENSDARP00000103874  .....--------...-----.....................--.........-KLVIT......G............
ENSDARP00000043116  .....-NQEVNCI...DCKG-.....................--.........-AVIVS......G............
ENSDARP00000063737  .....AHGSMACV...LWEPMg....................DG.........-KRVIS......L............
ENSDARP00000106107  .....-SNTILAV...KLNR-.....................--.........-QRLIV......C............
ENSDARP00000101619  .....-KKTITAI...SWCP-.....................HN.........PEVFAS......A............
ENSDARP00000025827  .....-MDIVTCL...ATDH-.....................FG.........-IHLIS......G............
ENSDARP00000100360  .....-IGKIFDI...SWDL-.....................YQ.........QSKLVS......C............
ENSDARP00000003197  .....-LDVVTCL...ARSE-.....................SYigg......DCYVLS......G............
ENSDARP00000012553  .....CQRSVCAL...QWKPL.....................CG.........-SALAV......A............
ENSDARP00000003663  .....-KSKVTCL...KWLP-.....................KS.........ENLFLA......S............
ENSDARP00000069897  .....-HGDVSAM...VFGTE.....................RD.........QPILCS......A............
ENSDARP00000018434  .....-GVRVDAI...AWSP-.....................EThldklpp..VIRFST......A............
ENSDARP00000093342  .....-WDVVTCL...ARSE-.....................SYigg......DCYIVS......G............
ENSDARP00000100360  .....----VTAA...CLSY-.....................DK.........-KLLAT......G............
ENSDARP00000102548  .....-KANVVKV...KWSR-.....................ENyhhslsspySLRLAS......A............
ENSDARP00000041156  .....-WDVVTCL...ARSE-.....................SYigg......DCYIVS......G............
ENSDARP00000108156  .....QVGSIALC...SMLH-.....................RS.........-NLLAVvg....G............
ENSDARP00000070070  .....---RICCA...AFHP-.....................SS.........NLLMAA......G............
ENSDARP00000018924  .....-PTVCTSI...RVSR-.....................DG.........QYILAA......G............
ENSDARP00000123525  .....-EEAASAM...CFSP-.....................DG.........-ETLLL......T............
ENSDARP00000109363  .....--------...-----.....................--.........------......-............
ENSDARP00000103752  .....--------...-----.....................--.........------......-............
ENSDARP00000101029  .....-CGSVECV...IYSP-.....................DG.........-QCLFS......A............
ENSDARP00000101492  .....PAPYASHV...RVNK-.....................--.........-TIAAA......A............
ENSDARP00000038543  .....-IDVVTCL...ALDL-.....................CG.........-IYLIS......G............
ENSDARP00000079585  .....--------...-----.....................--.........------......-............
ENSDARP00000104754  .....-TGRVNAV...QWVHEpdcs.................P-.........ENQLIS......G............
ENSDARP00000075344  .....VVDEFVCM...AFSP-.....................DS.........-KYLIGqa....G............
ENSDARP00000083528  .....SQGKFTGL...AVTD-.....................--.........-SSMIT......C............
ENSDARP00000017678  .....-HDQVLHL...AFSH-.....................RG.........-HRFSS......C............
ENSDARP00000097777  .....-------C...AACP-.....................NN.........-STIIT......A............
ENSDARP00000109722  .....HARQCNTL...AWNPV.....................DS.........-NWLAA......G............
ENSDARP00000083772  .....PDRLALSL...DWSTGrge..................SS.........DVRVVS......S............
ENSDARP00000065266  .....--------...-----.....................--.........------......-............
ENSDARP00000088806  .....-RRTPWCL...TFHP-.....................II.........PGLIAS......G............
ENSDARP00000109028  .....----VCCV...APRP-.....................SE.........PDVFLC......G............
ENSDARP00000095457  .....-RRTPWCV...TFHP-.....................TI.........PGLVAS......G............
ENSDARP00000086448  .....HNDWIFSI...AWIS-.....................--.........DTMAVS......G............
ENSDARP00000117869  .....---SITHL...TFSQ-.....................DS.........-HYLAA......A............
ENSDARP00000035593  .....-NAAVTQV...HFLP-.....................NQ.........-VELVT......L............
ENSDARP00000086251  .....-NSEVVLV...RWNE-.....................PF.........-QKLAT......C............
ENSDARP00000054352  .....-SSSILAL...KLNR-.....................--.........-QRLIV......C............
ENSDARP00000024810  .....----PSAL...AYDP-.....................KL.........-QLMAI......G............
ENSDARP00000100292  .....-TSRLTCMl..AVNE-.....................--.........-QQLWI......G............
ENSDARP00000079585  .....-TDDILCL...TVNQHp....................KY.........QNIIAT......G............
ENSDARP00000009095  .....----VTSM...SFPLG.....................DV.........-NNFVV......G............
ENSDARP00000101029  .....-PDSVCAL...QFSH-.....................YG.........-DVLLS......G............
ENSDARP00000118167  .....-NSEVVLV...RWNE-.....................PF.........-QKLAT......C............
ENSDARP00000101029  .....-TDKVSAL...ALNA-.....................SS.........-TVLASaq....T............
ENSDARP00000050905  .....-GEDFFSL...AWSTVlmsrtggsar...........PC.........-NILAA......G............
ENSDARP00000078100  .....PEGGVAAL...ALSK-.....................DS.........-KYLVT......V............
ENSDARP00000046545  .....-------L...QWHP-.....................NK.........-PLLAV......G............
ENSDARP00000032408  .....---PVECL...IHIP-.....................GT.........-RCLVT......S............
ENSDARP00000104388  .....RTEKFVAA...VLSK-.....................NS.........QSIIAS......M............
ENSDARP00000101882  .....-SSKNSSV...RLDS-.....................ET.........------......-............
ENSDARP00000093519  .....-THCISSL...LVME-.....................DL.........-ATIIT......G............
ENSDARP00000112439  .....--------...-----.....................--.........------......-............
ENSDARP00000071650  .....-DPCVKCV...RFSL-.....................DL.........-TLLLS......G............
ENSDARP00000099546  .....-TKGVKAV...VLCS-.....................KR.........-KLLLA......G............
ENSDARP00000111616  .....-PDDVLCF...QFSP-.....................SD.........HNIIAG......G............
ENSDARP00000019506  .....-PETPTAK...AVFA-.....................RGiaavr....EKFICV......G............
ENSDARP00000076262  .....-NDGCSDV...WTCT-.....................--.........-PVVCS......A............
ENSDARP00000080599  .....-GVPVDSL...FFIG-.....................--.........-SQLVA......T............
ENSDARP00000084220  .....-TGAVTDL...AFAHL.....................DS.........-TLLGC......V............
ENSDARP00000080965  .....-NVPVEAL...FFVG-.....................--.........-NQLIA......T............
ENSDARP00000123525  .....-DEDISAL...VFNP-.....................MN.........-WCQIC......A............
ENSDARP00000018692  .....DRSPILCM...VIIRAads..................C-.........SDWLVA......G............
ENSDARP00000008672  .....QSGVCFAL...DWLYV.....................KP.........HNILAA......G............
ENSDARP00000094999  .....KCEAITAV...KLLS-.....................CF.........DDLVAV......G............
ENSDARP00000116849  .....--DAASCM...TVHD-.....................--.........-KFLAL......G............
ENSDARP00000104388  .....---KISQL...LITH-.....................ND.........-QFVVS......L............
ENSDARP00000072504  .....--------...-----.....................--.........------......-............
ENSDARP00000052786  .....--------...-----.....................--.........--HIVL......G............
ENSDARP00000076812  .....----YQQV...EWKP-.....................DD.........-SMIAV......A............
ENSDARP00000047833  .....PNPHWRRV...AWSH-.....................DC.........-ALLAY......A............
ENSDARP00000097904  .....---EVPGV...AIMR-.....................QT.........SRFFFC......G............
ENSDARP00000102548  .....SMGSIACI...AWKG-.....................--.........-DTLVL......G............
ENSDARP00000082368  .....--------...-----.....................--.........------......-............
ENSDARP00000109749  .....-EAGVSDV...HWIS-.....................DR.........-ALLLA......S............
ENSDARP00000110965  .....--------...-----.....................--.........------......-............
ENSDARP00000095605  .....-EGSITQV...SCCPH.....................DE.........-DFIAV......A............
ENSDARP00000091436  .....-MWNVASI...QWNH-.....................CG.........-SVLAIagslrnS............
ENSDARP00000111846  .....-ADLVTDL...DFSPF.....................DD.........-YLLAT......C............
ENSDARP00000090283  .....--------...-----.....................--.........------......-............
ENSDARP00000008223  .....--------...-----.....................--.........------......-............
ENSDARP00000005398  .....---TPGCV...SLLP-.....................AS.........------......-............
ENSDARP00000020383  .....--------...-----.....................--.........---LVV......G............
ENSDARP00000114287  .....--------...-----.....................--.........------......-............
ENSDARP00000101793  .....--------...-----.....................--.........------......-............
ENSDARP00000059751  .....--------...-----.....................--.........------......-............
ENSDARP00000117166  .....EYGAVSAL...SINH-.....................DC.........-TRLLC......G............
ENSDARP00000046545  .....-----NCV...SFCT-.....................SK.........-QVLAA......G............
ENSDARP00000060999  .....NVRSLVLC...DFTA-.....................DG.........KNELLV......G............
ENSDARP00000084929  .....-KDSVLSL...VHVK-.....................--.........-GRVLV......A............
ENSDARP00000104754  .....--------...-----.....................--.........------......-............
ENSDARP00000111156  .....--------...-----.....................--.........------......-............
ENSDARP00000112085  .....-TDCVKCL...AVHP-.....................DK.........-IRIAT......G............
ENSDARP00000100913  .....-KSSVTCL...VYTS-.....................--.........-GCLYA......G............
ENSDARP00000003198  .....--------...-----.....................--.........------......-............
ENSDARP00000027152  .....DPYAVQMI...SWCP-.....................QS.........-RIFCV......V............
ENSDARP00000106476  .....--------...-----.....................--.........-QLFLS......S............
ENSDARP00000104791  .....--------...-----.....................--.........------......-............
ENSDARP00000109373  .....-MSAVTAL...AYGG-.....................--.........-RHLVS......C............
ENSDARP00000092538  .....--------...-----.....................--.........------......-............
ENSDARP00000098142  .....--------...-----.....................--.........------......-............
ENSDARP00000044811  .....-EDSVTFL...DLSD-.....................DK.........-HRLYA......L............
ENSDARP00000024810  pysddPRLGIQKI...SLCK-.....................YS.........-GKLVV......A............
ENSDARP00000075280  .....---DINAL...CRSH-.....................SE.........-RMVAV......A............
ENSDARP00000076048  .....--------...-----.....................--.........------......-............
ENSDARP00000089501  .....--------...-----.....................--.........------......-............
ENSDARP00000107630  .....-AQSVMSL...QAIA-.....................DS.........SGLLCV......Tlgqleiaearvl
ENSDARP00000092069  .....-VSSPSAL...TWWQYehggr................K-.........MSGLII......G............
ENSDARP00000018100  .....-SADVVCM...SLANVppgeq................R-.........SRFLAV......G............
ENSDARP00000108631  .....-SADVVCM...SLANVppgeq................R-.........SRFLAV......G............
ENSDARP00000111537  .....LSPVPLSL...LVSE-.....................SA.........-QRVVL......A............
ENSDARP00000035593  .....--------...-----.....................--.........--LLLT......G............
ENSDARP00000109913  .....-RVEITSI...SCAS-.....................LGnv.......THLLGT......V............
ENSDARP00000103234  .....--------...-----.....................--.........------......-............
ENSDARP00000026432  .....------CV...LSSPH.....................-Gr........RQHLAV......S............
ENSDARP00000078268  .....--------...-----.....................--.........------......-............
ENSDARP00000078255  .....--------...-----.....................--.........------......-............
ENSDARP00000102911  .....--------...---S-.....................CP.........-HFLAT......A............
ENSDARP00000032159  .....--------...-----.....................--.........------......-............
ENSDARP00000079570  .....-ESEVFIC...AWNP-.....................VC.........-DLLAS......G............
ENSDARP00000007708  .....--------...-----.....................--.........------......-............


                                                                                                    
                                                                                                    
d1pgua1               ..............................................................................
ENSDARP00000017859  ..............................................................................
ENSDARP00000039257  ..............................................................................
ENSDARP00000042217  ..............................................................................
ENSDARP00000080947  ..............................................................................
ENSDARP00000026057  ..............................................................................
ENSDARP00000116595  ..............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  ..............................................................................
ENSDARP00000088166  ..............................................................................
ENSDARP00000103157  ..............................................................................
ENSDARP00000111963  ..............................................................................
ENSDARP00000018443  ..............................................................................
ENSDARP00000079424  ..............................................................................
ENSDARP00000015825  ..............................................................................
ENSDARP00000024623  ..............................................................................
ENSDARP00000051230  ..............................................................................
ENSDARP00000044330  ..............................................................................
ENSDARP00000079567  ..............................................................................
ENSDARP00000017443  ..............................................................................
ENSDARP00000107302  ..............................................................................
ENSDARP00000005843  ..............................................................................
ENSDARP00000104051  ..............................................................................
ENSDARP00000061000  ..............................................................................
ENSDARP00000017497  ..............................................................................
ENSDARP00000011435  ..............................................................................
ENSDARP00000072190  ..............................................................................
ENSDARP00000037531  ..............................................................................
ENSDARP00000038258  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000060977  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000060431  ..............................................................................
ENSDARP00000027484  ..............................................................................
ENSDARP00000076693  ..............................................................................
ENSDARP00000089117  ..............................................................................
ENSDARP00000079014  ..............................................................................
ENSDARP00000122900  ..............................................................................
ENSDARP00000106094  ..............................................................................
ENSDARP00000105402  ..............................................................................
ENSDARP00000107355  ..............................................................................
ENSDARP00000099894  ..............................................................................
ENSDARP00000114236  ..............................................................................
ENSDARP00000068184  ..............................................................................
ENSDARP00000024391  ..............................................................................
ENSDARP00000096338  ..............................................................................
ENSDARP00000117865  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000109528  ..............................................................................
ENSDARP00000110967  ..............................................................................
ENSDARP00000097371  ..............................................................................
ENSDARP00000068663  ..............................................................................
ENSDARP00000096387  ..............................................................................
ENSDARP00000073472  ..............................................................................
ENSDARP00000056247  ..............................................................................
ENSDARP00000045014  ..............................................................................
ENSDARP00000090792  ..............................................................................
ENSDARP00000019743  ..............................................................................
ENSDARP00000028733  ..............................................................................
ENSDARP00000104487  ..............................................................................
ENSDARP00000079959  ..............................................................................
ENSDARP00000065646  ..............................................................................
ENSDARP00000005989  ..............................................................................
ENSDARP00000062413  ..............................................................................
ENSDARP00000003004  ..............................................................................
ENSDARP00000024168  ..............................................................................
ENSDARP00000077651  ..............................................................................
ENSDARP00000124018  ..............................................................................
ENSDARP00000068125  ..............................................................................
ENSDARP00000084377  ..............................................................................
ENSDARP00000109369  ..............................................................................
ENSDARP00000004327  ..............................................................................
ENSDARP00000112164  ..............................................................................
ENSDARP00000109556  ..............................................................................
ENSDARP00000036145  ..............................................................................
ENSDARP00000101521  ..............................................................................
ENSDARP00000101197  ..............................................................................
ENSDARP00000065847  ..............................................................................
ENSDARP00000099567  ..............................................................................
ENSDARP00000038520  ..............................................................................
ENSDARP00000106434  ..............................................................................
ENSDARP00000033992  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000105555  ..............................................................................
ENSDARP00000087578  ..............................................................................
ENSDARP00000076761  ..............................................................................
ENSDARP00000119160  ..............................................................................
ENSDARP00000099166  ..............................................................................
ENSDARP00000079110  ..............................................................................
ENSDARP00000028109  ..............................................................................
ENSDARP00000017792  ..............................................................................
ENSDARP00000091471  ..............................................................................
ENSDARP00000015105  ..............................................................................
ENSDARP00000005640  ..............................................................................
ENSDARP00000112282  ..............................................................................
ENSDARP00000010862  ..............................................................................
ENSDARP00000112131  ..............................................................................
ENSDARP00000117542  ..............................................................................
ENSDARP00000027560  ..............................................................................
ENSDARP00000110861  ..............................................................................
ENSDARP00000102565  ..............................................................................
ENSDARP00000093657  ..............................................................................
ENSDARP00000008451  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000101565  ..............................................................................
ENSDARP00000111921  ..............................................................................
ENSDARP00000018714  ..............................................................................
ENSDARP00000097750  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000065337  ..............................................................................
ENSDARP00000016280  ..............................................................................
ENSDARP00000071264  ..............................................................................
ENSDARP00000073678  ..............................................................................
ENSDARP00000070393  ..............................................................................
ENSDARP00000100903  ..............................................................................
ENSDARP00000099551  ..............................................................................
ENSDARP00000063641  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000014740  ..............................................................................
ENSDARP00000106749  ..............................................................................
ENSDARP00000003237  ..............................................................................
ENSDARP00000115064  ..............................................................................
ENSDARP00000071531  ..............................................................................
ENSDARP00000105980  ..............................................................................
ENSDARP00000113946  ..............................................................................
ENSDARP00000079302  ..............................................................................
ENSDARP00000111824  ..............................................................................
ENSDARP00000008006  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104171  ..............................................................................
ENSDARP00000052711  ..............................................................................
ENSDARP00000059208  ..............................................................................
ENSDARP00000006309  ..............................................................................
ENSDARP00000102210  ..............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000031340  ..............................................................................
ENSDARP00000059344  ..............................................................................
ENSDARP00000074880  ..............................................................................
ENSDARP00000026454  ..............................................................................
ENSDARP00000099918  ..............................................................................
ENSDARP00000121552  ..............................................................................
ENSDARP00000007696  ..............................................................................
ENSDARP00000080844  ..............................................................................
ENSDARP00000071301  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000106510  ..............................................................................
ENSDARP00000037121  ..............................................................................
ENSDARP00000124137  ..............................................................................
ENSDARP00000039795  ..............................................................................
ENSDARP00000079663  ..............................................................................
ENSDARP00000056762  ..............................................................................
ENSDARP00000024476  ..............................................................................
ENSDARP00000126101  ..............................................................................
ENSDARP00000087003  ..............................................................................
ENSDARP00000065205  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000059666  ..............................................................................
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000078100  wtdeseepacqvdlspkygcqkqilfnpsdstqlvsnsssqvlfynwaqerghleysapeitdktfnavigslsqsvf
ENSDARP00000078191  ..............................................................................
ENSDARP00000078965  ..............................................................................
ENSDARP00000102373  ..............................................................................
ENSDARP00000006117  ..............................................................................
ENSDARP00000111140  ..............................................................................
ENSDARP00000094274  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000106181  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000102443  ..............................................................................
ENSDARP00000038921  ..............................................................................
ENSDARP00000033554  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000014182  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000108102  ..............................................................................
ENSDARP00000107806  ..............................................................................
ENSDARP00000007602  ..............................................................................
ENSDARP00000021430  ..............................................................................
ENSDARP00000087525  ..............................................................................
ENSDARP00000054317  ..............................................................................
ENSDARP00000110907  ..............................................................................
ENSDARP00000074797  ..............................................................................
ENSDARP00000047739  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000055337  ..............................................................................
ENSDARP00000058220  ..............................................................................
ENSDARP00000102332  ..............................................................................
ENSDARP00000003173  ..............................................................................
ENSDARP00000064438  ..............................................................................
ENSDARP00000099721  ..............................................................................
ENSDARP00000026825  ..............................................................................
ENSDARP00000100187  ..............................................................................
ENSDARP00000059532  ..............................................................................
ENSDARP00000099725  ..............................................................................
ENSDARP00000084300  ..............................................................................
ENSDARP00000124280  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000110672  ..............................................................................
ENSDARP00000060454  ..............................................................................
ENSDARP00000098826  ..............................................................................
ENSDARP00000091438  ..............................................................................
ENSDARP00000098798  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000086480  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000061333  ..............................................................................
ENSDARP00000037790  ..............................................................................
ENSDARP00000032005  ..............................................................................
ENSDARP00000008668  ..............................................................................
ENSDARP00000103874  ..............................................................................
ENSDARP00000043116  ..............................................................................
ENSDARP00000063737  ..............................................................................
ENSDARP00000106107  ..............................................................................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000003197  ..............................................................................
ENSDARP00000012553  ..............................................................................
ENSDARP00000003663  ..............................................................................
ENSDARP00000069897  ..............................................................................
ENSDARP00000018434  ..............................................................................
ENSDARP00000093342  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000041156  ..............................................................................
ENSDARP00000108156  ..............................................................................
ENSDARP00000070070  ..............................................................................
ENSDARP00000018924  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000109363  ..............................................................................
ENSDARP00000103752  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000101492  ..............................................................................
ENSDARP00000038543  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000083528  ..............................................................................
ENSDARP00000017678  ..............................................................................
ENSDARP00000097777  ..............................................................................
ENSDARP00000109722  ..............................................................................
ENSDARP00000083772  ..............................................................................
ENSDARP00000065266  ..............................................................................
ENSDARP00000088806  ..............................................................................
ENSDARP00000109028  ..............................................................................
ENSDARP00000095457  ..............................................................................
ENSDARP00000086448  ..............................................................................
ENSDARP00000117869  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000086251  ..............................................................................
ENSDARP00000054352  ..............................................................................
ENSDARP00000024810  ..............................................................................
ENSDARP00000100292  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000009095  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000118167  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000050905  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000032408  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000101882  ..............................................................................
ENSDARP00000093519  ..............................................................................
ENSDARP00000112439  ..............................................................................
ENSDARP00000071650  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000111616  ..............................................................................
ENSDARP00000019506  ..............................................................................
ENSDARP00000076262  ..............................................................................
ENSDARP00000080599  ..............................................................................
ENSDARP00000084220  ..............................................................................
ENSDARP00000080965  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000018692  ..............................................................................
ENSDARP00000008672  ..............................................................................
ENSDARP00000094999  ..............................................................................
ENSDARP00000116849  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000072504  ..............................................................................
ENSDARP00000052786  ..............................................................................
ENSDARP00000076812  ..............................................................................
ENSDARP00000047833  ..............................................................................
ENSDARP00000097904  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000082368  ..............................................................................
ENSDARP00000109749  ..............................................................................
ENSDARP00000110965  ..............................................................................
ENSDARP00000095605  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000111846  ..............................................................................
ENSDARP00000090283  ..............................................................................
ENSDARP00000008223  ..............................................................................
ENSDARP00000005398  ..............................................................................
ENSDARP00000020383  ..............................................................................
ENSDARP00000114287  ..............................................................................
ENSDARP00000101793  ..............................................................................
ENSDARP00000059751  ..............................................................................
ENSDARP00000117166  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000060999  ..............................................................................
ENSDARP00000084929  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000111156  ..............................................................................
ENSDARP00000112085  ..............................................................................
ENSDARP00000100913  ..............................................................................
ENSDARP00000003198  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000106476  ..............................................................................
ENSDARP00000104791  ..............................................................................
ENSDARP00000109373  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000098142  ..............................................................................
ENSDARP00000044811  ..............................................................................
ENSDARP00000024810  ..............................................................................
ENSDARP00000075280  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000107630  ccpgndgpfsqtvvctdtlqavvgvsncrlvccstp..........................................
ENSDARP00000092069  ..............................................................................
ENSDARP00000018100  ..............................................................................
ENSDARP00000108631  ..............................................................................
ENSDARP00000111537  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000109913  ..............................................................................
ENSDARP00000103234  ..............................................................................
ENSDARP00000026432  ..............................................................................
ENSDARP00000078268  ..............................................................................
ENSDARP00000078255  ..............................................................................
ENSDARP00000102911  ..............................................................................
ENSDARP00000032159  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000007708  ..............................................................................


                                                90          100                                     
                                                 |            |                                     
d1pgua1               ..........DE.SG..........KVI.VWGW..TFDKESNSVEVN...............................
ENSDARP00000017859  ..........SD.DK..........TLK.IWDV..SSGK--------...............................
ENSDARP00000039257  ..........SA.DM..........TIK.LWDF..QGFE--------...............................
ENSDARP00000042217  ..........SA.DM..........TIK.LWDF..QGFE--------...............................
ENSDARP00000080947  ..........ST.DR..........TLK.VWNA..ETGE--------...............................
ENSDARP00000026057  ..........SR.DQ..........TVR.LWTP..SIKG--------...............................
ENSDARP00000116595  ..........SF.DK..........TCK.LWSA..ETGK--------...............................
ENSDARP00000074155  ..........CK.NS..........QIF.LWDP..VTGKQ-------...............................
ENSDARP00000038728  ..........ST.DK..........TVC.VWDS..ETGE--------...............................
ENSDARP00000088166  ..........AA.DG..........SVK.LWSL..DSDE--------...............................
ENSDARP00000103157  ..........AA.DG..........SVK.LWSL..DSDE--------...............................
ENSDARP00000111963  ..........GL.DN..........ICS.IYNL..KTREGNVR----...............................
ENSDARP00000018443  ..........GL.DN..........ICS.IYSL..KTREGNVR----...............................
ENSDARP00000079424  ..........GL.DN..........ICS.IYSL..KTREGNVR----...............................
ENSDARP00000015825  ..........SE.DG..........TIR.LWSL..QTFT--------...............................
ENSDARP00000024623  ..........SL.SG..........SLR.LWDL..EAAK--------...............................
ENSDARP00000051230  ..........GL.DN..........ICS.IYSL..KTREGNVR----...............................
ENSDARP00000044330  ..........LY.NG..........SVC.VWNH..ETQT--------...............................
ENSDARP00000079567  ..........SY.DG..........FAR.IWTK..DGN---------...............................
ENSDARP00000017443  ..........GL.DN..........MCS.IYNLkaKDGNVK------...............................
ENSDARP00000107302  ..........GE.DK..........QVK.CWDL..EYNK--------...............................
ENSDARP00000005843  ..........GL.DN..........MCT.VYNL..KTPVIK------...............................
ENSDARP00000104051  ..........SG.DT..........TVK.IWDF..AQSR--------...............................
ENSDARP00000061000  ..........SW.DG..........TLR.LWDL..TTGT--------...............................
ENSDARP00000017497  ..........SS.DS..........TVR.VWDV..NSGE--------...............................
ENSDARP00000011435  ..........GL.DN..........KCS.VYPL..SLDKNENLAA--...............................
ENSDARP00000072190  ..........GL.DN..........KCS.VYPL..SLDKNENLAS--...............................
ENSDARP00000037531  ..........SS.DS..........TVR.VWDV..SSGE--------...............................
ENSDARP00000038258  ..........SE.DS..........TVR.YWDL..KSFT--------...............................
ENSDARP00000076048  ..........GV.DK..........TTI.IWDA..HTGE--------...............................
ENSDARP00000060977  ..........SS.DK..........TVI.LWDV..ASGQ--------...............................
ENSDARP00000079570  ..........GV.DK..........TTI.IWDA..HTGE--------...............................
ENSDARP00000060431  ..........AY.DR..........YIK.LWDS..ETGQ--------...............................
ENSDARP00000027484  ..........DH.GG..........YVK.YWQ-..SNMN--------...............................
ENSDARP00000076693  ..........SF.DA..........TTC.IWKK..TDEDFE------...............................
ENSDARP00000089117  ..........AQ.DG..........KIK.VWKI..QSGQ--------...............................
ENSDARP00000079014  ..........SA.DC..........TII.VWDI..QTLQ--------...............................
ENSDARP00000122900  ..........SC.DK..........MIR.VWCL..QTCA--------...............................
ENSDARP00000106094  ..........ST.DA..........TTM.VWSM..DTGEIE------...............................
ENSDARP00000105402  ..........ST.DA..........TTM.VWSM..DTGEIE------...............................
ENSDARP00000107355  ..........GD.DY..........KIK.VWNY..KLRR--------...............................
ENSDARP00000099894  ..........SC.DK..........TIR.VWCL..RTCA--------...............................
ENSDARP00000114236  ..........SC.DK..........IVR.VWCL..RTCA--------...............................
ENSDARP00000068184  ..........AQ.DG..........KIQ.VWRI..LNGT--------...............................
ENSDARP00000024391  ..........AA.DF..........TAK.VWDA..VTGD--------...............................
ENSDARP00000096338  ..........GE.AS..........TLS.IWDL..ATPTPR------...............................
ENSDARP00000117865  ..........GE.AS..........TLS.IWDL..ATPTPR------...............................
ENSDARP00000105810  ..........AS.DK..........KVK.LWNV..ERGV--------...............................
ENSDARP00000109528  ..........SN.DF..........ASR.IWTV..DDYR--------...............................
ENSDARP00000110967  ..........GL.DG..........TIR.GWKI..PDLNVDPYDNYDpgv............................
ENSDARP00000097371  ..........SS.DS..........TIR.VWSV..TGGN--------...............................
ENSDARP00000068663  ..........AK.DK..........SVR.VWRMdvSSGRVH------...............................
ENSDARP00000096387  ..........SS.DT..........TVK.VWNA..HKGF--------...............................
ENSDARP00000073472  ..........SG.DK..........TIR.IWDV..RTTK--------...............................
ENSDARP00000056247  ..........SS.DT..........TVK.VWNA..HKGF--------...............................
ENSDARP00000045014  ..........GL.DN..........ICS.TYSL..KTREGNVR----...............................
ENSDARP00000090792  ..........GE.AS..........TLT.IWDL..ASQTPR------...............................
ENSDARP00000019743  ..........GE.AS..........TLT.IWDL..ASQTPR------...............................
ENSDARP00000028733  ..........TH.KG..........FVQ.IWDA..AGGR--------...............................
ENSDARP00000104487  ..........GI.DS..........TIQ.WWNI..PSSNVDPYDTYDpsv............................
ENSDARP00000079959  ..........GL.DG..........TIQ.SWNT..PNPNIDPYDSYEssv............................
ENSDARP00000065646  ..........DM.NK..........HIM.IWDP..ETCK--------...............................
ENSDARP00000005989  ..........LN.NG..........RIK.IWDV..YTGK--------...............................
ENSDARP00000062413  ..........GG.DG..........SLQ.IWDT..ANPQG-------...............................
ENSDARP00000003004  ..........TH.KG..........FVQ.IWDA..TAGK--------...............................
ENSDARP00000024168  ..........NKiDD..........TIR.YLSL..HDNK--------...............................
ENSDARP00000077651  ..........SN.DK..........YVK.VLPF..NPETCNATG---...............................
ENSDARP00000124018  ..........SS.DG..........TVR.VWNV..ERLQTL------...............................
ENSDARP00000068125  ..........SW.DN..........NVY.FYSI..AYGR--------...............................
ENSDARP00000084377  ..........GP.DDcs........ELW.LWNV..QTGEL-------...............................
ENSDARP00000109369  ..........SN.DK..........YVK.VLPF..NADTCNIAG---...............................
ENSDARP00000004327  ..........SL.DQ..........TVM.LWEW..NSERNKVK----...............................
ENSDARP00000112164  ..........SY.DL..........SIR.CWNL..KTGM--------...............................
ENSDARP00000109556  ..........SR.DY..........TLK.LFDY..SKPSAKR-----...............................
ENSDARP00000036145  ..........GP.DDcs........ELW.LWNV..QTGEL-------...............................
ENSDARP00000101521  ..........SR.DK..........TVL.MWDLg.RDTE--------...............................
ENSDARP00000101197  ..........DY.EG..........TVI.LWDG..FTGQ--------...............................
ENSDARP00000065847  ..........SH.DC..........SVR.IWCS..SSLK--------...............................
ENSDARP00000099567  ..........AA.DT..........KVH.VHDV..TAKE--------...............................
ENSDARP00000038520  ..........GT.DR..........NAY.VWTL..KGDAWK------...............................
ENSDARP00000106434  ..........SE.EG..........LIR.LFDI..GGRV--------...............................
ENSDARP00000033992  ..........SG.DQ..........TAR.LWDV..ITGD--------...............................
ENSDARP00000060548  ..........WN.DG..........KIR.VFTP..ESGKL-------...............................
ENSDARP00000105555  ..........GH.DN..........NIC.VFSL..DRPD--------...............................
ENSDARP00000087578  ..........SY.ED..........SVL.LLNP..ALGDRLLCTATDqlissyaepeevkeqpvqwlvsegegheqg.
ENSDARP00000076761  ..........DM.SG..........VIR.VWSV..EKREEVWSAEVGdlewlewhpcapvllagvadgsvwmwklpsg
ENSDARP00000119160  ..........GD.DK..........LVM.VWKR..AAFIGPSTVFGSssklanveqwr....................
ENSDARP00000099166  ..........SG.DQ..........TAH.IWRY..MVQLPLPQPPADisasldddvdfsdkdeadgdadgpnecptir
ENSDARP00000079110  ..........SM.DK..........TVR.LWHI..SRRE--------...............................
ENSDARP00000028109  ..........GD.DK..........TIK.QWNM..EAPGYGVREE--...............................
ENSDARP00000017792  ..........SA.DN..........SCR.LWDC..ETGK--------...............................
ENSDARP00000091471  ..........GS.DG..........VIV.IYDL..ENNSKKPQYTCKaictv..........................
ENSDARP00000015105  ..........SC.DK..........TAK.MWDL..NSNQ--------...............................
ENSDARP00000005640  ..........PN.NH..........EVH.IYKK..SGNQWV------...............................
ENSDARP00000112282  ..........ST.A-..........YVK.VWDIr.DSAKCIRTLTSSgqvsqgdacggs...................
ENSDARP00000010862  ..........GL.DN..........ICS.IYSL..KTREGNVR----...............................
ENSDARP00000112131  ..........SD.DH..........TIC.LWDI..STVPKEGKIVD-...............................
ENSDARP00000117542  ..........SD.DH..........TIC.LWDI..SGAPKEGKIVD-...............................
ENSDARP00000027560  ..........SW.SD..........YIH.VCSV..DGDNETHTA---...............................
ENSDARP00000110861  ..........SL.DA..........HIR.LWDL..ETGK--------...............................
ENSDARP00000102565  ..........SS.DQ..........TIR.CYSL..KTKE--------...............................
ENSDARP00000093657  ..........PN.SS..........DVH.IYQM..NGKEWI------...............................
ENSDARP00000008451  ..........AT.NG..........AVV.TWNL..SRPCRNK-----...............................
ENSDARP00000110420  ..........DR.NG..........TLR.IHDL..ESME--------...............................
ENSDARP00000101565  ..........DV.SG..........KVR.IWDT..TQKEHL------...............................
ENSDARP00000111921  ..........GL.DS..........QLK.THDL..NTD---------...............................
ENSDARP00000018714  ..........SK.DK..........AIH.IMDV..EAGKL-------...............................
ENSDARP00000097750  ..........SG.DG..........IIF.YTHT..EKSQEIN-----...............................
ENSDARP00000105810  ..........SE.DS..........TIRvVWKW..RTG---------...............................
ENSDARP00000065337  ..........SK.DE..........TIQ.LYDM..CKKT--------...............................
ENSDARP00000016280  ..........GL.DN..........TVN.IWDL..KTKR--------...............................
ENSDARP00000071264  ..........SE.GS..........VIK.IWDV..ETGA--------...............................
ENSDARP00000073678  ..........GD.DA..........AIL.LWKL..NDNKEPEQTPTFqeeedaqlnkesws.................
ENSDARP00000070393  ..........AR.DG..........QIR.VAELs.ATQRCK------...............................
ENSDARP00000100903  ..........LA.NGe.........TIR.IYKMv.KKDDGTFNFKAA...............................
ENSDARP00000099551  ..........--.--..........---.----..------------...............................
ENSDARP00000063641  ..........LA.NGe.........TIR.IYKMv.KKDDGTFNFKAA...............................
ENSDARP00000104754  ..........SQ.DC..........LIR.VWRLf.AKTAAEPDLQTDgiikmkenifqvsgeefavt...........
ENSDARP00000014740  ..........ST.S-..........YIK.VWDIr.DSAKCIRTLTSSglvntgdmcaastn.................
ENSDARP00000106749  ..........SY.DK..........SAL.FWRL..EDSV--------...............................
ENSDARP00000003237  ..........SA.DE..........TVI.LWDL..EKGK--------...............................
ENSDARP00000115064  ..........VS.NN..........TVQ.IHTF..PDGE--------...............................
ENSDARP00000071531  ..........SY.DR..........KVI.IWKE..ENSTWD------...............................
ENSDARP00000105980  ..........SR.DN..........PVH.IWDA..FYGDLRASFR--...............................
ENSDARP00000113946  ..........SF.DS..........MVK.LWDL..QAGGA-------...............................
ENSDARP00000079302  ..........GD.DR..........RVL.LWHM..EKAIHSRA----...............................
ENSDARP00000111824  ..........DC.KK..........NIH.VWEPq.EGGTWKI-----...............................
ENSDARP00000008006  ..........SE.NG..........SVT.VFNP..DVILTAGEDA--...............................
ENSDARP00000079585  ..........GL.DAkn........TVC.VWDW..KKGR--------...............................
ENSDARP00000104171  ..........GE.NG..........NII.LYDA..SKIIAGDSEV--...............................
ENSDARP00000052711  ..........GR.DM..........RVC.VWDL..SEGR--------...............................
ENSDARP00000059208  ..........LE.NG..........TVS.EFVL..SEDYNQMT----...............................
ENSDARP00000006309  ..........QD.NGavve......FLI.SEDL..NKMN--------...............................
ENSDARP00000102210  ..........SA.DG..........TIR.SWDI..RRPDSD------...............................
ENSDARP00000124457  ..........TA.AG..........TIL.IYST..LKGD--------...............................
ENSDARP00000010071  ..........SF.DN..........TIA.CWEW..STGA--------...............................
ENSDARP00000092538  ..........LA.DD..........SIH.LWNL..RQKRPA------...............................
ENSDARP00000031340  ..........SL.DG..........TLS.IMTL..SPPPPT------...............................
ENSDARP00000059344  ..........SK.DH..........ALR.LWNI..QTDTLVA-----...............................
ENSDARP00000074880  ..........LY.DG..........CVS.VYDL..RKKSDQPMYN--...............................
ENSDARP00000026454  ..........SE.DC..........TVM.VWQI..PENGLVTSMSE-...............................
ENSDARP00000099918  ..........LA.DY..........SIK.CFDK..DTRQ--------...............................
ENSDARP00000121552  ..........LF.NG..........NVC.VYNL..MAKDDQPIYN--...............................
ENSDARP00000007696  ..........SE.DC..........TVK.IWQI..PDGGLMSPMSE-...............................
ENSDARP00000080844  ..........TY.SG..........QIA.MWDN..RSHRRTPVQR--...............................
ENSDARP00000071301  ..........SE.DC..........SVM.IWEI..PEGGLVTPLRD-...............................
ENSDARP00000079585  ..........GK.DG..........VVE.LWDD..MFERCLKTYAIKraalspsskglllednpsiraitlghghilv
ENSDARP00000106510  ..........AQ.DR..........QVC.LWSS..VDHVLE------...............................
ENSDARP00000037121  ..........TY.SG..........QIV.LWDN..RSHRRTPVQR--...............................
ENSDARP00000124137  ..........DG.EG..........FLS.LWQV..NQTSSNPK----...............................
ENSDARP00000039795  ..........SE.DC..........TVM.VWQI..PENGLTSALSE-...............................
ENSDARP00000079663  ..........SD.NG..........SIQ.LLAV..EANKPPKSPKVQpcqt...........................
ENSDARP00000056762  ..........SS.DG..........KLH.LVS-..KSGR--------...............................
ENSDARP00000024476  ..........SG.VG..........TVK.LYDT..DAKKCL------...............................
ENSDARP00000126101  ..........SG.VG..........TVK.LYDT..DAKKCL------...............................
ENSDARP00000087003  ..........TY.SG..........QIV.LWDN..RSNKRTPVQR--...............................
ENSDARP00000065205  ..........MY.DG..........TIA.IYNV..QTSEQTPITD--...............................
ENSDARP00000110420  ..........ES.GHmp........AVR.VWDV..AERT--------...............................
ENSDARP00000059666  ..........SA.DG..........TVK.LWDF..IDGILIKTFVIGyplyslyvsekhegviflivsmvtdsnnesf
ENSDARP00000101126  ..........SY.GR..........TVA.VLDS..RNLKSA------...............................
ENSDARP00000060548  ..........QV.TFmgfka.....DVI.IWDY..EKKE--------...............................
ENSDARP00000078100  hydgvqaftaTS.DG..........NII.LWDK..QTESVSRQPIVRnaiklvsmqkeaitvltlidsfivtgdvngh
ENSDARP00000078191  ..........TD.DG..........ALR.IWKN..FADQRNPEMVTAwqglsdmlpttrglarrvsiy..........
ENSDARP00000078965  ..........SE.DS..........SVR.IWEI..PDGGLRRSLTE-...............................
ENSDARP00000102373  ..........TN.DK..........TVK.LWKIs.ERDKRPEGYNLKdedgrvrdpatittlrvpvlqpmdlmveasa
ENSDARP00000006117  ..........SY.NG..........QIG.YWDT..RSGSQPV-----...............................
ENSDARP00000111140  ..........GD.DA..........KIR.VWQI..PKGGLQETLTE-...............................
ENSDARP00000094274  ..........ST.DC..........CVK.IWAL..SSGQ--------...............................
ENSDARP00000075344  ..........FS.D-..........KLR.LMTL..LMDDIK------...............................
ENSDARP00000106181  ..........SS.NQ..........RVD.LYTW..RDGSGK------...............................
ENSDARP00000089501  ..........LA.DD..........SIH.LWNL..RQKLPA------...............................
ENSDARP00000102443  ..........TN.DK..........TVK.LWKIs.ERDKRPEGYNLKdedgrirdpstitalrvpvlrpmdlmveat.
ENSDARP00000038921  ..........GD.DA..........KIR.VWQI..PKGGLQETLTE-...............................
ENSDARP00000033554  ..........TN.DK..........TVK.LWKIs.ERDKRPEGYNLKdedgrirdpstitalrvpvlrpmdlmveat.
ENSDARP00000100360  ..........TQ.DSeif.......EVV.VHDR..TKPF--------...............................
ENSDARP00000014182  ..........SE.DA..........TVK.IWEI..PEHGVLKTITV-...............................
ENSDARP00000027152  ..........CA.DD..........TLH.LWSL..RQRLPA------...............................
ENSDARP00000108102  ..........SE.DT..........TAM.VWQI..PDHTPSRPISE-...............................
ENSDARP00000107806  ..........GD.DG..........LVL.IWNV..ETGD--------...............................
ENSDARP00000007602  ..........TN.DK..........TIK.LWKIs.ERDKRPEGYNLKeedgryrdastittlrvpvfrpmdlmveas.
ENSDARP00000021430  ..........DM.NF..........DSY.IWDI..ENPNK-------...............................
ENSDARP00000087525  ..........SE.DC..........TVR.IWQI..PDNGLRRNLTE-...............................
ENSDARP00000054317  ..........DF.DG..........NLN.VWNL..EVPDS-------...............................
ENSDARP00000110907  ..........DG.DG..........ALS.LWQT..STSGNAPK----...............................
ENSDARP00000074797  ..........LY.SG..........EVV.VWDT..SRSQDLILAQ--...............................
ENSDARP00000047739  ..........SD.DT..........TIA.LWDL..RKLNS-------...............................
ENSDARP00000079585  ..........SD.DG..........TIR.FWDL..ADKK--------...............................
ENSDARP00000055337  ..........--.--..........---.----..------------...............................
ENSDARP00000058220  ..........GD.Y-..........-LR.IWRV..NDTETRLECLLN...............................
ENSDARP00000102332  ..........GE.DG..........ACL.LWEWg.GEGK--------...............................
ENSDARP00000003173  ..........SF.DR..........TAA.VWEE..IVGESNDKQRGQshwi...........................
ENSDARP00000064438  ..........SS.SG..........AVS.IFKL..QSDCQALSLAHVwe.............................
ENSDARP00000099721  ..........TN.DK..........TIK.LWKIs.ERDKRAEGYNLKdedgrlrdpfritslrvpvlmpmdlmveas.
ENSDARP00000026825  ..........TN.DK..........TIK.LWKVs.ERDKRPEGYNLKdeegrikdistvtslrvpvlkptdlmvevr.
ENSDARP00000100187  ..........SK.DK..........TVR.LWPLy.NHGDGTREVE--...............................
ENSDARP00000059532  ..........LE.E-..........SIY.IHNI..KDMKLLK-----...............................
ENSDARP00000099725  ..........MR.NK..........LFY.IYDM..MEGRVI------...............................
ENSDARP00000084300  ..........TN.DK..........TVK.LWKVs.ERDKRAEGYNLRdeegrlkdlstittlqvpvlrpmdllveas.
ENSDARP00000124280  ..........SE.DC..........TVK.VWNI..PPSGLKADLML-...............................
ENSDARP00000100360  ..........AE.DG..........TVR.LWDI..SQRK--------...............................
ENSDARP00000110672  ..........ST.DC..........CVK.IWAL..SSGQ--------...............................
ENSDARP00000060454  ..........HS.SG..........CLY.LYNV..EHTCGTTSPHYQllkqgesytvhtgksksarn...........
ENSDARP00000098826  ..........HS.SG..........SMY.LYNV..EHTCGTTAPHYQllkqgesyavhtckskstrn...........
ENSDARP00000091438  ..........SG.DG..........TVS.VQSF..EGLQSQILSRTPd..............................
ENSDARP00000098798  ..........ME.K-..........IVN.IWQV..NGGKVSLELQPHwvsslawpeeeagslwggeprelllvgrmdg
ENSDARP00000091436  ..........DQ.NG..........LII.VWML..YKGSWY------...............................
ENSDARP00000086480  ..........SQ.DG..........HVK.FWKK..KEDEGVE-----...............................
ENSDARP00000099546  ..........GL.DG..........TLR.KWCL..ISGLQLFCITDA...............................
ENSDARP00000061333  ..........QT.DN..........IIF.VYKIg.EEWGDKKV----...............................
ENSDARP00000037790  ..........GG.KKpkyppn....KVM.IWDD..LKKK--------...............................
ENSDARP00000032005  ..........TN.DK..........TIK.LWKIs.ERDKRPEGYNLKeedgryrhpsslttlrvpvfqpmdlmveas.
ENSDARP00000008668  ..........DK.DN..........VVI.IWDV..ESEDTY------...............................
ENSDARP00000103874  ..........GF.ST..........AIC.VWET..GSSKEKAKSLT-...............................
ENSDARP00000043116  ..........SR.DK..........SAK.IWAL..TPDRFGQ-----...............................
ENSDARP00000063737  ..........AE.N-..........HVL.LWDL..QESSAKATIS--...............................
ENSDARP00000106107  ..........LE.E-..........SLY.IHNI..RDMKVLH-----...............................
ENSDARP00000101619  ..........SA.DN..........LLI.IWNV..AEQK--------...............................
ENSDARP00000025827  ..........SR.DT..........TCM.VWQVl.QQGGAPVGLSHK...............................
ENSDARP00000100360  ..........GV.K-..........HIK.FWSL..CGNALTPKRG--...............................
ENSDARP00000003197  ..........SR.DA..........TLL.LWYW..NGKHSSIGESAGtefvt..........................
ENSDARP00000012553  ..........CQ.S-..........CLL.IWHV..DPASLSTRPSSG...............................
ENSDARP00000003663  ..........HA.SG..........HLY.LYNV..EHPCGTTAPQYCllrqgegfsvyscktktprn...........
ENSDARP00000069897  ..........SE.D-..........YVI.VWDIn.RCYRQIKEGGIA...............................
ENSDARP00000018434  ..........AA.DR..........KIR.LWTS..DLQNSC------...............................
ENSDARP00000093342  ..........SR.DA..........TLL.LWYW..SGRHHIIGDNPNnsdypa.........................
ENSDARP00000100360  ..........DD.LG..........YVK.LFKYp.VKGKYA------...............................
ENSDARP00000102548  ..........DA.AG..........KII.VWDV..VSGM--------...............................
ENSDARP00000041156  ..........SR.DA..........TLL.LWYW..SGRHHIIGDNPNnsdypa.........................
ENSDARP00000108156  ..........GV.NPkfsei.....SVL.IWDD..AREVRDPKDK--...............................
ENSDARP00000070070  ..........DK.YG..........HLG.LWRPd.AEWGDD------...............................
ENSDARP00000018924  ..........TY.KP..........RVR.CYDT..YQLSLKFERCLDsdvvtfdilsddysklvflhidryvefhsqh
ENSDARP00000123525  ..........SN.TG..........CVY.RFKPl.LKDK--------...............................
ENSDARP00000109363  ..........--.--..........---.----..------------...............................
ENSDARP00000103752  ..........--.--..........---.----..------------...............................
ENSDARP00000101029  ..........GS.G-..........YLV.LYSS..SEREHHVVRVLG...............................
ENSDARP00000101492  ..........YE.NG..........CVD.VWST..VTGLE-------...............................
ENSDARP00000038543  ..........SR.DT..........TCM.VWQVl.QQGGFSSGLSPR...............................
ENSDARP00000079585  ..........--.--..........---.----..------------...............................
ENSDARP00000104754  ..........GS.DN..........NVI.VWEK..LDGKFR------...............................
ENSDARP00000075344  ..........GP.DW..........TLF.LWMW..EKKK--------...............................
ENSDARP00000083528  ..........VE.SG..........LLK.VWKE..GSTDTV------...............................
ENSDARP00000017678  ..........SK.DC..........TVK.LWDT..EQSDGTISLV--...............................
ENSDARP00000097777  ..........GT.ST..........VVC.VWDVf.ISKDKLKHMR--...............................
ENSDARP00000109722  ..........LD.KHradf......SVL.IWDI..SSKFSPEAVPAEkvrlsgdadsgllvtk...............
ENSDARP00000083772  ..........DS.TG..........SLT.LLSL..GEADLT------...............................
ENSDARP00000065266  ..........--.--..........-LR.VWDP..RTCA--------...............................
ENSDARP00000088806  ..........CL.DG..........EVR.IWDL..HGGS--------...............................
ENSDARP00000109028  ..........GF.SP..........EVR.AWDS..RCCK--------...............................
ENSDARP00000095457  ..........CL.DG..........EVR.IWDL..HGGS--------...............................
ENSDARP00000086448  ..........SR.DG..........SMG.LWEI..SEDVLSQAEKRQnvegvpgyshishralkdip...........
ENSDARP00000117869  ..........DT.GK..........AVT.LLCL..CKEGTQEIWK--...............................
ENSDARP00000035593  ..........LE.DN..........SLH.MWTL..RAHNSMCELLEI...............................
ENSDARP00000086251  ..........DM.EG..........GIF.VWIQ..YEGRWS------...............................
ENSDARP00000054352  ..........LE.E-..........ALY.IHNI..KDMK--------...............................
ENSDARP00000024810  ..........TK.SG..........AIK.IYGA..PGVE--------...............................
ENSDARP00000100292  ..........SK.DS..........FIY.IINP..RSVS--------...............................
ENSDARP00000079585  ..........QI.GQcvtftglap.SIH.VWDA..MSKQ--------...............................
ENSDARP00000009095  ..........SE.DG..........SVY.TASR..HGSRAG------...............................
ENSDARP00000101029  ..........AR.DG..........VIT.VCSP..VTGV--------...............................
ENSDARP00000118167  ..........DT.DG..........GIF.VWIQ..YEGRWS------...............................
ENSDARP00000101029  ..........GT.NS..........LIR.LWSY..SAGV--------...............................
ENSDARP00000050905  ..........GK.RG..........CVK.LIHP..RVNL--------...............................
ENSDARP00000078100  ..........GA.GLvq........RVC.IRNW..TDESEEPA----...............................
ENSDARP00000046545  ..........WE.TG..........ETI.LLSH..PSGEHT------...............................
ENSDARP00000032408  ..........GN.SN..........TLQ.IWDI..GGDDSDVIK---...............................
ENSDARP00000104388  ..........EN.TS..........SIF.VWRR..DSGQ--------...............................
ENSDARP00000101882  ..........--.--..........VVC.VWNI..WEPS--------...............................
ENSDARP00000093519  ..........SH.DG..........QIC.IWDMt.PELEIN------...............................
ENSDARP00000112439  ..........--.--..........---.----..------------...............................
ENSDARP00000071650  ..........GA.DG..........FVR.VWEF..PSLK--------...............................
ENSDARP00000099546  ..........SE.DG..........LII.VWSL..NNLQ--------...............................
ENSDARP00000111616  ..........CM.NG..........QVV.LWDI..SAHVDRLQDTRSggknihpfegksdatpvvryca.........
ENSDARP00000019506  ..........VS.SG..........SVL.VFDVp.SKGSNIT-----...............................
ENSDARP00000076262  ..........ST.DG..........TIK.AWDI..QKGV--------...............................
ENSDARP00000080599  ..........SH.TG..........KVG.VWNA..VTQHWQVQ----...............................
ENSDARP00000084220  ..........DE.AG..........NMF.IWQL..TSHSSKIQDEVIvhirrpedtplnsnrrliwcpfipedndesp
ENSDARP00000080965  ..........SH.TG..........KVG.VWNA..VTKHWQNQDVV-...............................
ENSDARP00000123525  ..........IK.SK..........SLT.IWNV..ERCDNYHLMKPSavnlpgtdgsaiecepnqshllngkltylgp
ENSDARP00000018692  ..........SE.SG..........SLF.IMDT..INAK--------...............................
ENSDARP00000008672  ..........FY.DG..........LVG.LWDL..SSKSTLLRVRCPdggvsly........................
ENSDARP00000094999  ..........TA.SG..........RVA.FFQL..VSPLPGRNKQLR...............................
ENSDARP00000116849  ..........TH.FG..........KVF.LLDI..QGN---------...............................
ENSDARP00000104388  ..........CE.QN..........ASR.VWRL..ATGHKVCNI---...............................
ENSDARP00000072504  ..........--.--..........---.----..------------...............................
ENSDARP00000052786  ..........DM.DG..........QIW.FLT-..RSL---------...............................
ENSDARP00000076812  ..........TA.NG..........YVL.LFDI..IGGLDDKYLYEPvypnkhpaikvtpgykeeqcapaltl.....
ENSDARP00000047833  ..........DS.TG..........TVR.VFDL..MGSELFIIPPAMsfpgdfsyaaagl..................
ENSDARP00000097904  ..........HT.SG..........KVS.LRDL..RTFK--------...............................
ENSDARP00000102548  ..........DV.DG..........NLN.FWDL..KAR---------...............................
ENSDARP00000082368  ..........--.--..........---.----..------------...............................
ENSDARP00000109749  ..........DS.GM..........SVR.TVCV..GEGYFS------...............................
ENSDARP00000110965  ..........--.--..........QVD.IFSL..NRPTPR------...............................
ENSDARP00000095605  ..........TS.QG..........LVV.VWEL..HLERRGRPER--...............................
ENSDARP00000091436  ..........--.-Gaek.......EMN.VVHF..YTPFGE------...............................
ENSDARP00000111846  ..........SA.DQ..........TVK.LWRL..CDVDQDQPSN--...............................
ENSDARP00000090283  ..........--.--..........---.----..------------...............................
ENSDARP00000008223  ..........--.--..........---.----..------------...............................
ENSDARP00000005398  ..........--.--..........LFS.NFNP..DQPG--------...............................
ENSDARP00000020383  ..........DT.SG..........KLY.IYKN..DDCK--------...............................
ENSDARP00000114287  ..........--.--..........---.----..------------...............................
ENSDARP00000101793  ..........--.--..........---.----..------------...............................
ENSDARP00000059751  ..........--.--..........---.----..------------...............................
ENSDARP00000117166  ..........FA.KG..........QIT.MWDL..ANGKLLR-----...............................
ENSDARP00000046545  ..........TS.RG..........RVA.LWHM..LTVSDQKGDSKTqw.............................
ENSDARP00000060999  ..........SE.DF..........DIR.VFK-..-EDE--------...............................
ENSDARP00000084929  ..........LA.DG..........TLA.IFHRs.EDGQWDLSNY--...............................
ENSDARP00000104754  ..........--.--..........---.----..------------...............................
ENSDARP00000111156  ..........--.--..........---.----..------------...............................
ENSDARP00000112085  ..........QI.AGvdkdgrplqpHVR.IWDS..VSLSTQ------...............................
ENSDARP00000100913  ..........LV.SG..........SLV.IYSRt.DDGFWVES----...............................
ENSDARP00000003198  ..........--.--..........---.----..------------...............................
ENSDARP00000027152  ..........GI.SA..........HVI.LYRF..SKHDANTIITSLelrlqcemedvispsdtentpcfsdpsghsp
ENSDARP00000106476  ..........LQ.GH..........SAI.FWDG..DQDQRNYSVVNLakgqv..........................
ENSDARP00000104791  ..........--.--..........---.----..------------...............................
ENSDARP00000109373  ..........SS.DG..........KLN.LWRL..DEQMR-------...............................
ENSDARP00000092538  ..........--.--..........---.----..------------...............................
ENSDARP00000098142  ..........--.--..........---.----..------------...............................
ENSDARP00000044811  ..........CK.NG..........GLY.CIPL..PQQSGKKILINNsspvnkspepmlhvv................
ENSDARP00000024810  ..........GT.AG..........QVI.VMVL..GDEKSDHMIDVAtvdllqdregftwkghdrlppksgsvvfapg
ENSDARP00000075280  ..........DD.FC..........KVH.LFQY..PCPKPKA-----...............................
ENSDARP00000076048  ..........--.--..........---.----..------------...............................
ENSDARP00000089501  ..........--.--..........---.----..------------...............................
ENSDARP00000107630  ..........GY.QQ..........RVS.MLTLs.QEGS--------...............................
ENSDARP00000092069  ..........SS.VG..........PVK.ILPV..NIKAVKGYFTLRqpvvlwqesdqipvhnik.............
ENSDARP00000018100  ..........LV.DN..........TVR.IISL..DPSDCLQPLSMQalpaqpeslcivemggvekqdelgekgtigf
ENSDARP00000108631  ..........LV.DN..........TVR.IISL..DPSDCLQPLSMQalpaqpeslcivemggvekqdelgekgtigf
ENSDARP00000111537  ..........AL.TG..........QVF.LWEC..SAPQDLSGPRDGiiaghwsqiscqentplpstadkeaslhcvf
ENSDARP00000035593  ..........HE.DG..........TVR.FWDA..SGVCLYPMYKLStagvfhtdadpndnmnqgsegewppfrkvgc
ENSDARP00000109913  ..........DD.MGia........QVF.LHHK..ENTYLIKVINETddinqrnicvkfevsrsgafgaavmmshgsv
ENSDARP00000103234  ..........--.--..........---.----..------------...............................
ENSDARP00000026432  ..........HE.KG..........KIT.VLQL..SALLKQADSSKRkltlt..........................
ENSDARP00000078268  ..........--.--..........---.----..-----------Lpgqkisrlelggalgtpqekifvssgsevrg
ENSDARP00000078255  ..........--.--..........---.----..------------...............................
ENSDARP00000102911  ..........TK.RG..........KIC.IWDV..SKL---------...............................
ENSDARP00000032159  ..........--.--..........---.----..------------...............................
ENSDARP00000079570  ..........SG.DS..........TAR.IWNL..I-----------...............................
ENSDARP00000007708  ..........--.--..........---.----..------------...............................


                                                                                                    
                                                                                                    
d1pgua1               ..............................................................................
ENSDARP00000017859  ..............................................................................
ENSDARP00000039257  ..............................................................................
ENSDARP00000042217  ..............................................................................
ENSDARP00000080947  ..............................................................................
ENSDARP00000026057  ..............................................................................
ENSDARP00000116595  ..............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  ..............................................................................
ENSDARP00000088166  ..............................................................................
ENSDARP00000103157  ..............................................................................
ENSDARP00000111963  ..............................................................................
ENSDARP00000018443  ..............................................................................
ENSDARP00000079424  ..............................................................................
ENSDARP00000015825  ..............................................................................
ENSDARP00000024623  ..............................................................................
ENSDARP00000051230  ..............................................................................
ENSDARP00000044330  ..............................................................................
ENSDARP00000079567  ..............................................................................
ENSDARP00000017443  ..............................................................................
ENSDARP00000107302  ..............................................................................
ENSDARP00000005843  ..............................................................................
ENSDARP00000104051  ..............................................................................
ENSDARP00000061000  ..............................................................................
ENSDARP00000017497  ..............................................................................
ENSDARP00000011435  ..............................................................................
ENSDARP00000072190  ..............................................................................
ENSDARP00000037531  ..............................................................................
ENSDARP00000038258  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000060977  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000060431  ..............................................................................
ENSDARP00000027484  ..............................................................................
ENSDARP00000076693  ..............................................................................
ENSDARP00000089117  ..............................................................................
ENSDARP00000079014  ..............................................................................
ENSDARP00000122900  ..............................................................................
ENSDARP00000106094  ..............................................................................
ENSDARP00000105402  ..............................................................................
ENSDARP00000107355  ..............................................................................
ENSDARP00000099894  ..............................................................................
ENSDARP00000114236  ..............................................................................
ENSDARP00000068184  ..............................................................................
ENSDARP00000024391  ..............................................................................
ENSDARP00000096338  ..............................................................................
ENSDARP00000117865  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000109528  ..............................................................................
ENSDARP00000110967  ..............................................................................
ENSDARP00000097371  ..............................................................................
ENSDARP00000068663  ..............................................................................
ENSDARP00000096387  ..............................................................................
ENSDARP00000073472  ..............................................................................
ENSDARP00000056247  ..............................................................................
ENSDARP00000045014  ..............................................................................
ENSDARP00000090792  ..............................................................................
ENSDARP00000019743  ..............................................................................
ENSDARP00000028733  ..............................................................................
ENSDARP00000104487  ..............................................................................
ENSDARP00000079959  ..............................................................................
ENSDARP00000065646  ..............................................................................
ENSDARP00000005989  ..............................................................................
ENSDARP00000062413  ..............................................................................
ENSDARP00000003004  ..............................................................................
ENSDARP00000024168  ..............................................................................
ENSDARP00000077651  ..............................................................................
ENSDARP00000124018  ..............................................................................
ENSDARP00000068125  ..............................................................................
ENSDARP00000084377  ..............................................................................
ENSDARP00000109369  ..............................................................................
ENSDARP00000004327  ..............................................................................
ENSDARP00000112164  ..............................................................................
ENSDARP00000109556  ..............................................................................
ENSDARP00000036145  ..............................................................................
ENSDARP00000101521  ..............................................................................
ENSDARP00000101197  ..............................................................................
ENSDARP00000065847  ..............................................................................
ENSDARP00000099567  ..............................................................................
ENSDARP00000038520  ..............................................................................
ENSDARP00000106434  ..............................................................................
ENSDARP00000033992  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000105555  ..............................................................................
ENSDARP00000087578  ..............................................................................
ENSDARP00000076761  ..............................................................................
ENSDARP00000119160  ..............................................................................
ENSDARP00000099166  v.............................................................................
ENSDARP00000079110  ..............................................................................
ENSDARP00000028109  ..............................................................................
ENSDARP00000017792  ..............................................................................
ENSDARP00000091471  ..............................................................................
ENSDARP00000015105  ..............................................................................
ENSDARP00000005640  ..............................................................................
ENSDARP00000112282  ..............................................................................
ENSDARP00000010862  ..............................................................................
ENSDARP00000112131  ..............................................................................
ENSDARP00000117542  ..............................................................................
ENSDARP00000027560  ..............................................................................
ENSDARP00000110861  ..............................................................................
ENSDARP00000102565  ..............................................................................
ENSDARP00000093657  ..............................................................................
ENSDARP00000008451  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000101565  ..............................................................................
ENSDARP00000111921  ..............................................................................
ENSDARP00000018714  ..............................................................................
ENSDARP00000097750  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000065337  ..............................................................................
ENSDARP00000016280  ..............................................................................
ENSDARP00000071264  ..............................................................................
ENSDARP00000073678  ..............................................................................
ENSDARP00000070393  ..............................................................................
ENSDARP00000100903  ..............................................................................
ENSDARP00000099551  ..............................................................................
ENSDARP00000063641  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000014740  ..............................................................................
ENSDARP00000106749  ..............................................................................
ENSDARP00000003237  ..............................................................................
ENSDARP00000115064  ..............................................................................
ENSDARP00000071531  ..............................................................................
ENSDARP00000105980  ..............................................................................
ENSDARP00000113946  ..............................................................................
ENSDARP00000079302  ..............................................................................
ENSDARP00000111824  ..............................................................................
ENSDARP00000008006  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104171  ..............................................................................
ENSDARP00000052711  ..............................................................................
ENSDARP00000059208  ..............................................................................
ENSDARP00000006309  ..............................................................................
ENSDARP00000102210  ..............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000031340  ..............................................................................
ENSDARP00000059344  ..............................................................................
ENSDARP00000074880  ..............................................................................
ENSDARP00000026454  ..............................................................................
ENSDARP00000099918  ..............................................................................
ENSDARP00000121552  ..............................................................................
ENSDARP00000007696  ..............................................................................
ENSDARP00000080844  ..............................................................................
ENSDARP00000071301  ..............................................................................
ENSDARP00000079585  gtkngeileidksgpm..............................................................
ENSDARP00000106510  ..............................................................................
ENSDARP00000037121  ..............................................................................
ENSDARP00000124137  ..............................................................................
ENSDARP00000039795  ..............................................................................
ENSDARP00000079663  ..............................................................................
ENSDARP00000056762  ..............................................................................
ENSDARP00000024476  ..............................................................................
ENSDARP00000126101  ..............................................................................
ENSDARP00000087003  ..............................................................................
ENSDARP00000065205  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000059666  qlvavhlpksaeqeveakelstvaskispnpsctafgrggefiafsrhlqlnvyffrkqktysfsl............
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000078100  ikfydgnlklinlynefnvdpirsisfskerpsnnsleypkdctldakpfvmrnfvlstthatvvhvntqtnv.....
ENSDARP00000078191  ..............................................................................
ENSDARP00000078965  ..............................................................................
ENSDARP00000102373  ..............................................................................
ENSDARP00000006117  ..............................................................................
ENSDARP00000111140  ..............................................................................
ENSDARP00000094274  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000106181  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000102443  ..............................................................................
ENSDARP00000038921  ..............................................................................
ENSDARP00000033554  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000014182  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000108102  ..............................................................................
ENSDARP00000107806  ..............................................................................
ENSDARP00000007602  ..............................................................................
ENSDARP00000021430  ..............................................................................
ENSDARP00000087525  ..............................................................................
ENSDARP00000054317  ..............................................................................
ENSDARP00000110907  ..............................................................................
ENSDARP00000074797  ..............................................................................
ENSDARP00000047739  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000055337  ..............................................................................
ENSDARP00000058220  ..............................................................................
ENSDARP00000102332  ..............................................................................
ENSDARP00000003173  ..............................................................................
ENSDARP00000064438  ..............................................................................
ENSDARP00000099721  ..............................................................................
ENSDARP00000026825  ..............................................................................
ENSDARP00000100187  ..............................................................................
ENSDARP00000059532  ..............................................................................
ENSDARP00000099725  ..............................................................................
ENSDARP00000084300  ..............................................................................
ENSDARP00000124280  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000110672  ..............................................................................
ENSDARP00000060454  ..............................................................................
ENSDARP00000098826  ..............................................................................
ENSDARP00000091438  ..............................................................................
ENSDARP00000098798  tlgllevlddsdmqrte.............................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000086480  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000061333  ..............................................................................
ENSDARP00000037790  ..............................................................................
ENSDARP00000032005  ..............................................................................
ENSDARP00000008668  ..............................................................................
ENSDARP00000103874  ..............................................................................
ENSDARP00000043116  ..............................................................................
ENSDARP00000063737  ..............................................................................
ENSDARP00000106107  ..............................................................................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000003197  ..............................................................................
ENSDARP00000012553  ..............................................................................
ENSDARP00000003663  ..............................................................................
ENSDARP00000069897  ..............................................................................
ENSDARP00000018434  ..............................................................................
ENSDARP00000093342  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000041156  ..............................................................................
ENSDARP00000108156  ..............................................................................
ENSDARP00000070070  ..............................................................................
ENSDARP00000018924  g.............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000109363  ..............................................................................
ENSDARP00000103752  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000101492  ..............................................................................
ENSDARP00000038543  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000083528  ..............................................................................
ENSDARP00000017678  ..............................................................................
ENSDARP00000097777  ..............................................................................
ENSDARP00000109722  ..............................................................................
ENSDARP00000083772  ..............................................................................
ENSDARP00000065266  ..............................................................................
ENSDARP00000088806  ..............................................................................
ENSDARP00000109028  ..............................................................................
ENSDARP00000095457  ..............................................................................
ENSDARP00000086448  ..............................................................................
ENSDARP00000117869  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000086251  ..............................................................................
ENSDARP00000054352  ..............................................................................
ENSDARP00000024810  ..............................................................................
ENSDARP00000100292  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000009095  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000118167  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000050905  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000032408  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000101882  ..............................................................................
ENSDARP00000093519  ..............................................................................
ENSDARP00000112439  ..............................................................................
ENSDARP00000071650  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000111616  ..............................................................................
ENSDARP00000019506  ..............................................................................
ENSDARP00000076262  ..............................................................................
ENSDARP00000080599  ..............................................................................
ENSDARP00000084220  edacqtlallhedraevwdldilrsnnsswpvdatelke.......................................
ENSDARP00000080965  ..............................................................................
ENSDARP00000123525  qmptsaiagligdqadnfv...........................................................
ENSDARP00000018692  ..............................................................................
ENSDARP00000008672  ..............................................................................
ENSDARP00000094999  ..............................................................................
ENSDARP00000116849  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000072504  ..............................................................................
ENSDARP00000052786  ..............................................................................
ENSDARP00000076812  ..............................................................................
ENSDARP00000047833  ..............................................................................
ENSDARP00000097904  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000082368  ..............................................................................
ENSDARP00000109749  ..............................................................................
ENSDARP00000110965  ..............................................................................
ENSDARP00000095605  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000111846  ..............................................................................
ENSDARP00000090283  ..............................................................................
ENSDARP00000008223  ..............................................................................
ENSDARP00000005398  ..............................................................................
ENSDARP00000020383  ..............................................................................
ENSDARP00000114287  ..............................................................................
ENSDARP00000101793  ..............................................................................
ENSDARP00000059751  ..............................................................................
ENSDARP00000117166  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000060999  ..............................................................................
ENSDARP00000084929  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000111156  ..............................................................................
ENSDARP00000112085  ..............................................................................
ENSDARP00000100913  ..............................................................................
ENSDARP00000003198  ..............................................................................
ENSDARP00000027152  qpqppsprsntpdsvrdsipclkvkdrmirmppgyqaelvvq....................................
ENSDARP00000106476  ..............................................................................
ENSDARP00000104791  ..............................................................................
ENSDARP00000109373  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000098142  ..............................................................................
ENSDARP00000044811  ..............................................................................
ENSDARP00000024810  fq............................................................................
ENSDARP00000075280  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000107630  ..............................................................................
ENSDARP00000092069  ..............................................................................
ENSDARP00000018100  lylniglqngvllrtvldpvtgdlsdtrtrylgsrpvklfrvrmqgqeavlamssrswlsysyqsrfhltplsyetle
ENSDARP00000108631  lylniglqngvllrtvldpvtgdlsdtrtrylgsrpvklfrvrmqgqeavlamssrswlsysyqsrfhltplsyetle
ENSDARP00000111537  vksqavgdvclsafvftaeaqlivtflkiqwdstwdsklgsagfrvdwisksyplnqlq...................
ENSDARP00000035593  fdpysddprl....................................................................
ENSDARP00000109913  wldlyrfpqetwlk................................................................
ENSDARP00000103234  ..............................................................................
ENSDARP00000026432  ..............................................................................
ENSDARP00000078268  ytkkgk........................................................................
ENSDARP00000078255  ..............................................................................
ENSDARP00000102911  ..............................................................................
ENSDARP00000032159  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000007708  ..............................................................................


                                                               110                 120              
                                                                 |                   |              
d1pgua1               ........................................VKSEFQV...LAG.PI......SDIS.WDF........
ENSDARP00000017859  ........................................CLKTLKG...HSN.YV......FCCN.FNP........
ENSDARP00000039257  ........................................CIRTMHG...HDH.NV......SSVA.IMP........
ENSDARP00000042217  ........................................CIRTMHG...HDH.NV......SSVA.IMP........
ENSDARP00000080947  ........................................CIHTLYG...HTS.TV......RCMH.LH-........
ENSDARP00000026057  ........................................ESTVFKA...HTA.SV......RSVH.FSR........
ENSDARP00000116595  ........................................CFYTFRG...HTA.EI......VCLA.FNP........
ENSDARP00000074155  ........................................IGKTLTG...HTK.WI......TWLC.WEPlhlnp...
ENSDARP00000038728  ........................................RVKRLKG...HTS.FV......NSCF.PAR........
ENSDARP00000088166  ........................................PIADIEG...HSM.RV......ARVT.WHP........
ENSDARP00000103157  ........................................PIADIEG...HSM.RV......ARVT.WHP........
ENSDARP00000111963  ........................................VSRELAG...HTG.YL......SCCR.FL-........
ENSDARP00000018443  ........................................VSRELAG...HTG.YL......SCCR.FL-........
ENSDARP00000079424  ........................................VSRELAG...HTG.YL......SCCR.FL-........
ENSDARP00000015825  ........................................CLVGYKG...HNY.PV......WDTQ.FSP........
ENSDARP00000024623  ........................................ILRTLMG...HKA.SI......SSLD.FHP........
ENSDARP00000051230  ........................................VSRELPG...HTG.YL......SCCR.FI-........
ENSDARP00000044330  ........................................LVKTFEV...CDL.PV......RASK.FVA........
ENSDARP00000079567  ........................................LASTLGQ...HKG.PI......FALK.WNK........
ENSDARP00000017443  ........................................VMRELAA...HTG.YL......SCCR.FLS........
ENSDARP00000107302  ........................................VIRHYHG...HLS.AV......YDLD.LHP........
ENSDARP00000005843  ........................................TVKELDA...HTG.YL......SCCR.FI-........
ENSDARP00000104051  ........................................CVLSLEG...HLH.AT......WACS.FHS........
ENSDARP00000061000  ........................................TTRRFVG...HTK.DV......LSVA.FSA........
ENSDARP00000017497  ........................................VLNTLIH...HNE.AV......LHLR.FC-........
ENSDARP00000011435  ........................................KKKSVAM...HTN.YL......SACC.FTN........
ENSDARP00000072190  ........................................KKKSVAM...HTN.YL......SSCS.FTK........
ENSDARP00000037531  ........................................VLNTLIH...HNE.AV......LHLR.FC-........
ENSDARP00000038258  ........................................NTVLYRG...HAY.PV......WDVD.VSP........
ENSDARP00000076048  ........................................AKQQFPF...HSV.APa.....LDVD.WQ-........
ENSDARP00000060977  ........................................VTRKLRG...HAG.KV......NCVQ.FNE........
ENSDARP00000079570  ........................................AKQQFPF...HSA.PA......LDVD.WQ-........
ENSDARP00000060431  ........................................CISRFTN...-RK.VP......YCVK.FNPde......
ENSDARP00000027484  ........................................NVKMFQA...HKE.AI......REAS.FSP........
ENSDARP00000076693  ........................................CLTVLEG...HEN.EV......KCVA.WAP........
ENSDARP00000089117  ........................................CLRRYERa..HSK.GV......TCLS.FSK........
ENSDARP00000079014  ........................................KVNTIRA...HDN.PV......CTLV.SS-........
ENSDARP00000122900  ........................................PLAVLEG...HAA.SI......TSLQ.FSPlcsg....
ENSDARP00000106094  ........................................AVLEHPG...-RS.PV......RVCA.FSP........
ENSDARP00000105402  ........................................AVLEHPG...-RS.PV......RVCA.FSP........
ENSDARP00000107355  ........................................CLFTLLG...HLD.YI......RTTF.FHH........
ENSDARP00000099894  ........................................PVAVLQG...HSG.SI......TSLQ.FSPfvkg....
ENSDARP00000114236  ........................................PVAVLQG...HTA.SI......TSIQ.FSPsalg....
ENSDARP00000068184  ........................................CLNRLERa..HSK.AV......TSVC.FNR........
ENSDARP00000024391  ........................................EVLTLAH...-KH.IV......KSVN.FTQ........
ENSDARP00000096338  ........................................IKAELTS...SAP.AC......YALA.ISP........
ENSDARP00000117865  ........................................IKAELTS...SAP.AC......YALA.ISP........
ENSDARP00000105810  ........................................LIREFEVe..HEE.QI......NHCQ.FTN........
ENSDARP00000109528  ........................................LRHTLTG...HSG.KV......LSAR.FLL........
ENSDARP00000110967  ........................................ESSVLSG...HED.AV......WGLA.FSS........
ENSDARP00000097371  ........................................CVQVVRA...HES.AV......TGLS.LHA........
ENSDARP00000068663  ........................................CVAQGTG...HSN.AV......GSIA.CSRm.......
ENSDARP00000096387  ........................................CMSTLRT...HKD.YV......KALA.YAK........
ENSDARP00000073472  ........................................CMATVST...-KG.EN......INIC.WSP........
ENSDARP00000056247  ........................................CMSTLRT...HKD.YV......KALA.YAK........
ENSDARP00000045014  ........................................VNRELAG...HTG.YL......SCCR.FL-........
ENSDARP00000090792  ........................................IKAELTS...SAP.AC......YALA.ISP........
ENSDARP00000019743  ........................................IKAELTS...SAP.AC......YALA.ISP........
ENSDARP00000028733  ........................................KLTSLEG...HSA.RV......GALA.WN-........
ENSDARP00000104487  ........................................LAGTLLG...HSD.AV......WGLA.YSG........
ENSDARP00000079959  ........................................LRGSLSG...HTD.AV......WGLV.FSS........
ENSDARP00000065646  ........................................HLFKFTG...HRG.AI......SGLA.FRR........
ENSDARP00000005989  ........................................LLLNLMD...HTD.IV......RDLT.FAP........
ENSDARP00000062413  ........................................LLQVLKG...HTQ.EV......YSVD.WSQtr......
ENSDARP00000003004  ........................................KLFALEG...HTA.RV......GALA.WN-........
ENSDARP00000024168  ........................................YIRYFPG...HNK.RV......VALS.MSP........
ENSDARP00000077651  ........................................PDLEFSM...HDG.TI......RDLA.FMEgpec....
ENSDARP00000124018  ........................................AHKTLPH...-PS.FV......YCAK.FHP........
ENSDARP00000068125  ........................................RQDTLMG...HDD.AV......SDIC.WR-........
ENSDARP00000084377  ........................................RTKMSQS...HED.SL......TSVA.WNP........
ENSDARP00000109369  ........................................PDLEFSM...HDG.TI......RDLA.FMEgpes....
ENSDARP00000004327  ........................................ARHCCRG...HAG.SV......DTIA.VDP........
ENSDARP00000112164  ........................................CMMIFHG...HFG.TI......NCLD.LV-........
ENSDARP00000109556  ........................................AFKHVQ-...EAE.ML......RSIS.FHP........
ENSDARP00000036145  ........................................RTKMSQS...HED.SL......TSVA.WNP........
ENSDARP00000101521  ........................................AIQEFSG...HEL.VV......NGVA.VSP........
ENSDARP00000101197  ........................................RSKVYQE...HEK.RC......WSVD.FNLm.......
ENSDARP00000065847  ........................................CTHTLTA...HRR.SV......ETVS.FSP........
ENSDARP00000099567  ........................................TIHMFSD...HTN.RV......KRIA.TAPm.......
ENSDARP00000038520  ........................................PTLVILR...INR.AA......RCVK.WSP........
ENSDARP00000106434  ........................................SLRQFKG...HSK.AV......HATS.FLS........
ENSDARP00000033992  ........................................LLGTFKG...HQC.SL......KSVA.FYK........
ENSDARP00000060548  ........................................KLIIHNA...HSM.AV......TTIA.ATN........
ENSDARP00000105555  ........................................PLFTLKG...HKN.TV......CTLS.AGK........
ENSDARP00000087578  ........................................HRLVLK-...HPK.AV......RQVT.WHA........
ENSDARP00000076761  ........................................ACRTFQS...PGC.QT......TCGR.ILP........
ENSDARP00000119160  ........................................CVTILRN...HTG.DV......MDVA.WSP........
ENSDARP00000099166  ........................................ATTTLKS...HQG.VV......IAAD.WLV........
ENSDARP00000079110  ........................................CLCCFQH...-ID.FV......TAIA.FHPr.......
ENSDARP00000028109  ........................................PINTILG...-KA.VF......TGID.HHQ........
ENSDARP00000017792  ........................................QLALLET...-SS.AV......RTCG.FDF........
ENSDARP00000091471  ........................................GRSSRHV...HKF.SV......ETVQ.WYPh.......
ENSDARP00000015105  ........................................-AIQIAQ...HEG.PI......RTIH.WIKap......
ENSDARP00000005640  ........................................KVHELKE...HNG.HI......TGID.WAP........
ENSDARP00000112282  ........................................AVAIPPG...-EN.QI......NQIA.LNP........
ENSDARP00000010862  ........................................VTRELPG...HTG.YL......SCCR.FL-........
ENSDARP00000112131  ........................................AKTIFTG...HTA.VV......EDVS.WHL........
ENSDARP00000117542  ........................................AKTIFTG...HTA.VV......EDVS.WHL........
ENSDARP00000027560  ........................................LDLNPDE...RRF.CV......FSLA.AST........
ENSDARP00000110861  ........................................QIKSMDA...GPV.DA......WTVA.FSP........
ENSDARP00000102565  ........................................CVEQLSL...-PD.RV......--LC.LHN........
ENSDARP00000093657  ........................................KIHELTE...HSG.RI......TGID.WAP........
ENSDARP00000008451  ........................................QEQLFTE...HKR.TV......NKVC.FHPt.......
ENSDARP00000110420  ........................................EILDVQA...HDS.EI......LCLE.YSKpe......
ENSDARP00000101565  ........................................LKYEYQP...FGG.KI......KDIA.WTE........
ENSDARP00000111921  ........................................QDTIVGT...HDA.PI......RCVE.FCP........
ENSDARP00000018714  ........................................ETRIPKA...HKA.PI......NAML.LI-........
ENSDARP00000097750  ........................................RQCQFTC...HYG.TA......YEIM.TVP........
ENSDARP00000105810  ........................................ECMVLQG...HME.PV......RKFH.LLSss......
ENSDARP00000065337  ........................................EHGALLH...HDG.TI......SCLE.FY-........
ENSDARP00000016280  ........................................LHRTLKD...HKE.EV......TCVS.FNG........
ENSDARP00000071264  ........................................LIFEFGCah.GDS.AI......TCMT.FDT........
ENSDARP00000073678  ........................................VVKTLRG...HIE.DV......YDIS.WTS........
ENSDARP00000070393  ........................................NTKRVAQ...HKG.AA......HKLA.LEP........
ENSDARP00000100903  ........................................PGDFPQK...HKG.VI......INIG.IAE........
ENSDARP00000099551  ........................................LERNFKG...HRD.AI......TSLD.FS-........
ENSDARP00000063641  ........................................PGDFPQK...HKG.VI......INIG.IAE........
ENSDARP00000104754  ........................................LETVLAG...HEN.WV......YGIH.WQPpsvkgdsv
ENSDARP00000014740  ........................................RTVTIPA...GEN.QI......NQIY.LNP........
ENSDARP00000106749  ........................................PKVTLTG...HSR.KV......TAAR.FKY........
ENSDARP00000003237  ........................................PAATLAK...HTD.KV......QTLK.FHPf.......
ENSDARP00000115064  ........................................PDGILTR...FTT.NA......NHVT.FNN........
ENSDARP00000071531  ........................................KMYEYTG...HDS.SV......NSVC.WGPy.......
ENSDARP00000105980  ........................................PYNHLDE...-LT.AA......HSLC.FSP........
ENSDARP00000113946  ........................................ERGLIQC...-KA.AV......LCLS.CE-........
ENSDARP00000079302  ........................................KPMKLKGe..HLS.NI......FCLA.FDS........
ENSDARP00000111824  ........................................DQRPFSS...HSK.SV......EDLQ.WSP........
ENSDARP00000008006  ........................................VIGQSNK...HTG.PV......RALD.FNRf.......
ENSDARP00000079585  ........................................VLATATG...HSD.RI......FDIS.WDPf.......
ENSDARP00000104171  ........................................IILQSEK...HTG.AV......RALD.VNSf.......
ENSDARP00000052711  ........................................SAVTDSL...HTG.SV......GFCQ.CSLlesrl...
ENSDARP00000059208  ........................................PARTYQA...HQG.GV......TVVL.FVL........
ENSDARP00000006309  ........................................HVKTYPA...HQN.RV......SDLL.FSL........
ENSDARP00000102210  ........................................SVQVFRSd..PTH.SY......CSFD.VSC........
ENSDARP00000124457  ........................................LHCTLDGg..HSG.PV......NSVQ.WHP........
ENSDARP00000010071  ........................................KIQQFRG...HTG.AV......FSID.YND........
ENSDARP00000092538  ........................................VLHSLKF...NKE.RI......TFCH.LPF........
ENSDARP00000031340  ........................................VKVTLKG...HAG.PV......TDFA.WSL........
ENSDARP00000059344  ........................................IFGGVEG...HRD.EV......LSAD.FDL........
ENSDARP00000074880  ........................................SIASSGK...HTG.AV......WQVK.WQKddld....
ENSDARP00000026454  ........................................PVVVLEG...HSK.RV......GVVT.WHP........
ENSDARP00000099918  ........................................LVSWMRG...HEG.AV......SSLS.IHS........
ENSDARP00000121552  ........................................SMASSGK...HSG.TV......WQVK.WWEddly....
ENSDARP00000007696  ........................................AVVTLEG...HSK.RV......GILA.WHP........
ENSDARP00000080844  ........................................TPLSATA...HTH.PV......YCVN.VVGtq......
ENSDARP00000071301  ........................................PVVKLEG...HSK.RV......GLVS.WHP........
ENSDARP00000079585  ........................................TLLVQGH...MEG.EV......WGLA.AHP........
ENSDARP00000106510  ........................................WTRLLDE...HGH.C-......--AD.FHP........
ENSDARP00000037121  ........................................TPLSAAA...HTH.PV......YCVN.VVGtq......
ENSDARP00000124137  ........................................PYLSWQC...HSK.SC......GDFA.FIT........
ENSDARP00000039795  ........................................PVVVLEG...HSK.RV......GIVT.WHP........
ENSDARP00000079663  ........................................R--FLDPk..EEG.CV......VDVHhFNS........
ENSDARP00000056762  ........................................IEKSVEA...HRG.AV......LAGR.WNY........
ENSDARP00000024476  ........................................YEMTIDD...VHP.RI......LSLA.CSP........
ENSDARP00000126101  ........................................YEMTIDD...VHP.RI......LSLA.CSP........
ENSDARP00000087003  ........................................TPLSASA...HTH.PV......YCVN.VVGtq......
ENSDARP00000065205  ........................................SSDCANL...HTS.PV......WQLT.WIDhedglaad
ENSDARP00000110420  ........................................QVAELQE...HKY.GV......ACVS.FSP........
ENSDARP00000059666  ........................................KATDKKA...GKN.AF......TCVA.CHP........
ENSDARP00000101126  ........................................VAELADA...GEE.EI......NCVS.VNE........
ENSDARP00000060548  ........................................IYARLLL...HKA.KV......EDLS.FSP........
ENSDARP00000078100  ........................................PKSLLRE...HAE.PL......EAVA.CHP........
ENSDARP00000078191  ........................................LDRSKQG...--G.AG......MVVD.WEQ........
ENSDARP00000078965  ........................................SVLELYG...HSR.RV......GLIE.WHPt.......
ENSDARP00000102373  ........................................RRVFCNA...HAY.HI......NSIS.INS........
ENSDARP00000006117  ........................................QISAIEHs..HKD.PV......YKVI.WLQtk......
ENSDARP00000111140  ........................................PECVLRG...HTE.KI......YSVK.FHP........
ENSDARP00000094274  ........................................CVKSIYT...-FN.AV......TSLC.FIP........
ENSDARP00000075344  ........................................IFKEFTI...--R.NC......RECT.FSH........
ENSDARP00000106181  ........................................SHTSLQG...HTR.VI......SDLD.WSWf.......
ENSDARP00000089501  ........................................VLHSLKF...NRE.RI......TFCH.LPF........
ENSDARP00000102443  ........................................PRRIFANa..HTY.HI......NSIS.VNS........
ENSDARP00000038921  ........................................PECVLRG...HTE.KI......YSVK.FHP........
ENSDARP00000033554  ........................................PRRIFANa..HTY.HI......NSIS.VNS........
ENSDARP00000100360  ........................................LIMQGHC...-EG.EL......WALA.VHP........
ENSDARP00000014182  ........................................PWKELQG...HSR.RV......GLIE.WHP........
ENSDARP00000027152  ........................................ILHSLKF...NRE.RI......TFCH.LPF........
ENSDARP00000108102  ........................................PIVVLEG...HSK.RV......GIIK.WHP........
ENSDARP00000107806  ........................................CLLELRG...HTQ.QI......TAMT.SYTfirggn..
ENSDARP00000007602  ........................................PRRVFANa..HTY.HI......NSIS.VNS........
ENSDARP00000021430  ........................................PEMTLKP...-VC.PL......VCLE.YNP........
ENSDARP00000087525  ........................................ALMILIG...HSR.RV......GLIE.WHPt.......
ENSDARP00000054317  ........................................PVYSVKA...HKE.II......NAID.GVGglgigd..
ENSDARP00000110907  ........................................PYLTLQC...HNK.TA......NDFV.FVG........
ENSDARP00000074797  ........................................TGMSADT...HRE.PV......YQIN.WVPgarr....
ENSDARP00000047739  ........................................KVCSLHG...HAS.WV......KNIE.YDT........
ENSDARP00000079585  ........................................LLNKVSL...-GH.PA......KCTA.YSP........
ENSDARP00000055337  ........................................PILNFTA...HDG.PV......FSLL.ST-........
ENSDARP00000058220  ........................................NNKNSDF...-CA.PL......TSFD.WNEv.......
ENSDARP00000102332  ........................................VGCAFRG...HKSgGV......RALA.VSEgsisc...
ENSDARP00000003173  ........................................KRTTLVD...SRT.SV......TDVK.FAPkh......
ENSDARP00000064438  ........................................RAHRCSC...DNA.PC......TAIV.CR-........
ENSDARP00000099721  ........................................PRRIFANa..HTY.HI......NSIS.VNS........
ENSDARP00000026825  ........................................PRRVFANg..HTY.HV......NSIS.VNS........
ENSDARP00000100187  ........................................PRLTYTE...HRK.SI......FYVG.QLE........
ENSDARP00000059532  ........................................TLLNTPS...NPS.GL......CALS.INH........
ENSDARP00000099725  ........................................PVASVRGl..REQ.RV......SDFQ.VSP........
ENSDARP00000084300  ........................................PRRVFANa..HAY.HI......NSIS.VNS........
ENSDARP00000124280  ........................................PSKDLLA...HSR.RV......SLIE.WHP........
ENSDARP00000100360  ........................................MLNKVNL...-GH.PA......RTVS.YSP........
ENSDARP00000110672  ........................................CVKSIYT...-FN.AV......TSLC.FIP........
ENSDARP00000060454  ........................................PLLRWTV...GEG.AV......NEFA.FSP........
ENSDARP00000098826  ........................................PLLKWTV...GDG.AL......NEFA.FSP........
ENSDARP00000091438  ........................................CGHDHHD...LCY.WY......CCVD.VSV........
ENSDARP00000098798  ........................................LQHCFRK...-DV.AV......MQIA.WYS........
ENSDARP00000091436  ........................................EEMINNR...NKS.VV......RSMS.WNA........
ENSDARP00000086480  ........................................FVKHFRS...HLG.VI......ECIS.VSA........
ENSDARP00000099546  ........................................----VSV...QTH.SP......THIH.MN-........
ENSDARP00000061333  ........................................--ICNKFi..QTS.AV......TSLV.WP-........
ENSDARP00000037790  ........................................TVIEIEF...-ST.EV......KAVK.LR-........
ENSDARP00000032005  ........................................PRRVYANa..HTY.HI......NSIS.VNS........
ENSDARP00000008668  ........................................LQISYDK...ASF.EV......SALM.HPSt.......
ENSDARP00000103874  ........................................LKQALLG...HTD.AV......TCLT.ASS........
ENSDARP00000043116  ........................................CLHTIPT...-YD.RV......WSVA.ISP........
ENSDARP00000063737  ........................................SSATLEGk..GQL.KF......TAGK.WSPhh......
ENSDARP00000106107  ........................................TIRETPP...NPS.GL......CALS.ISN........
ENSDARP00000101619  ........................................AVARLDN...-SI.P-......ASLS.WCWn.......
ENSDARP00000025827  ........................................PVQVLYG...HTD.EV......VSVS.IST........
ENSDARP00000100360  ........................................VFGKTGD...-LQ.TI......LCLA.CA-........
ENSDARP00000003197  ........................................PRAILTG...HDC.EV......TCAS.VCA........
ENSDARP00000012553  ........................................CAQVLSHp..GHS.PI......TSIA.WSP........
ENSDARP00000003663  ........................................PLLRWVV...GEG.GL......NEFA.FSP........
ENSDARP00000069897  ........................................SGRVVGT...LLG.RV......VYLS.LCP........
ENSDARP00000018434  ........................................DVKVMEG...HTS.YI......NHLV.FEPa.......
ENSDARP00000093342  ........................................PRAVLTG...HDH.EV......VCVS.VCA........
ENSDARP00000100360  ........................................KFKRYMA...HST.HV......TNVR.WSH........
ENSDARP00000102548  ........................................AHCEIQE...HSK.PI......QDMD.WLWaqda....
ENSDARP00000041156  ........................................PRAVLTG...HDF.EV......VCVS.VCA........
ENSDARP00000108156  ........................................LVLEFTF...-TK.PV......LAVR.MR-........
ENSDARP00000070070  ........................................GVVCFEP...HSR.AI......TALA.FTS........
ENSDARP00000018924  ........................................HYYKTRI...PKF.G-......RDFS.YHS........
ENSDARP00000123525  ........................................AVKVLDV...LCG.DF......VTVA.PVY........
ENSDARP00000109363  ........................................-------...-SD.SI......LAFA.ISA........
ENSDARP00000103752  ........................................-------...-SD.SI......LAFA.ISA........
ENSDARP00000101029  ........................................NVVMCGV...-NR.SP......DILA.VSS........
ENSDARP00000101492  ........................................PIHQYQH...-LQ.RV......HVLD.LSP........
ENSDARP00000038543  ........................................PIQVLCG...HDQ.EV......TCVA.IST........
ENSDARP00000079585  ........................................----YLG...HDD.DI......LSLT.VHP........
ENSDARP00000104754  ........................................ACAVCSG...HSG.PV......CAVD.AVSls......
ENSDARP00000075344  ........................................VMATVNIs..NNG.PI......NQVS.FNPq.......
ENSDARP00000083528  ........................................---EVNV...-GK.DI......CKMR.QNQs.......
ENSDARP00000017678  ........................................HSCSMRQ...YNW.GY......TQFSqFNA........
ENSDARP00000097777  ........................................LKQTLYG...HTD.TV......TCLV.ASE........
ENSDARP00000109722  ........................................PLYELGQ...-ND.AC......LSLC.WLPr.......
ENSDARP00000083772  ........................................AVCQWKA...HEY.EA......WISA.FSYw.......
ENSDARP00000065266  ........................................KLMKLKG...HTD.NV......KSLL.LNR........
ENSDARP00000088806  ........................................ESWLTES...-NS.AI......ASLA.FHP........
ENSDARP00000109028  ........................................VLHVYRS...AVQ.QT......LDLL.FVN........
ENSDARP00000095457  ........................................ESWFTES...-NV.AI......ASLA.FHP........
ENSDARP00000086448  ........................................KEYTHPY...-NC.KV......RALA.FNN........
ENSDARP00000117869  ........................................YQGRHHS...HYK.PI......QDLL.FGVdlds....
ENSDARP00000035593  ........................................GRFTLSG...PPG.AIpsvtrvTAVL.AHS........
ENSDARP00000086251  ........................................VELVNDR...-GA.QV......SDFT.WSH........
ENSDARP00000054352  ........................................LLKSLLN...-TP.P-......----.-NP........
ENSDARP00000024810  ........................................MTGLHKD...-TA.AV......TQIH.FLC........
ENSDARP00000100292  ........................................CNKQLTE...HRC.EL......TGLA.LEEradk....
ENSDARP00000079585  ........................................TMSVLRCa..HAK.GI......GYVN.FSA........
ENSDARP00000009095  ........................................ISEMFEG...HHG.PI......TGIH.CHTaagpv...
ENSDARP00000101029  ........................................SIRTITD...HRGaSI......NTLQ.CTSkqfkefgl
ENSDARP00000118167  ........................................VELVNDR...-GA.QV......SDFT.WSH........
ENSDARP00000101029  ........................................CQTIIPT...HTH.AL......NLLS.FSH........
ENSDARP00000050905  ........................................AFGEFRV...SRR.AI......SIMR.FNP........
ENSDARP00000078100  ........................................CQVDLSP...KYG.CQ......KQIL.FNPs.......
ENSDARP00000046545  ........................................PLPNNT-...HTA.CI......TVLE.WSS........
ENSDARP00000032408  ........................................MTRVINL...KSP.SA......KGSK.ITPgft.....
ENSDARP00000104388  ........................................CMASLIE...ISG.AI......VKLI.KST........
ENSDARP00000101882  ........................................RPQKILL...YES.EV......KCCC.FSP........
ENSDARP00000093519  ........................................PRALLFG...HTA.SV......TCLS.KASags.....
ENSDARP00000112439  ........................................ASQYVHI...HSK.QI......RGLA.FSQ........
ENSDARP00000071650  ........................................EKLNFRA...HKD.EL......EDID.ISP........
ENSDARP00000099546  ........................................PLHTLSG...HKA.GV......LSLK.LTD........
ENSDARP00000111616  ........................................VSGIENG...HKA.PI......TDIQ.WLPetfevnkl
ENSDARP00000019506  ........................................LSEVLEE...HKE.AI......TDMA.SEC........
ENSDARP00000076262  ........................................NLWTSPV...-QD.PL......QDMT.VDT........
ENSDARP00000080599  ........................................--D----...-VV.PI......TSCD.TA-........
ENSDARP00000084220  ........................................GFITIRG...HAA.RI......SEGA.LSP........
ENSDARP00000080965  ........................................PINSYDT...---.--......----.---........
ENSDARP00000123525  ........................................PLKLIKP...-RL.CP......SAIC.WSI........
ENSDARP00000018692  ........................................VLHRLKS...VKD.SV......TSLY.FHTelqhrc..
ENSDARP00000008672  ........................................PYHCFHA...HDE.NI......RTLS.WCK........
ENSDARP00000094999  ........................................RFDVVGL...HKS.TI......TALA.WSA........
ENSDARP00000116849  ........................................VTQKFEI...SSV.KI......NQIS.LDE........
ENSDARP00000104388  ........................................-LVTLQH...---.--......---A.LIT........
ENSDARP00000072504  ........................................-------...---.--......----.---........
ENSDARP00000052786  ........................................QLSSFQA...YKL.RV......THLY.QLK........
ENSDARP00000076812  ........................................EMKKPVD...LEA.PI......SCLQ.SL-........
ENSDARP00000047833  ........................................M------...---.--......----.FLEytgsaq..
ENSDARP00000097904  ........................................MEHEFDA...FSG.SL......SDFD.IH-........
ENSDARP00000102548  ........................................LSRGVPT...HRG.WV......KKIR.FAPgk......
ENSDARP00000082368  ........................................-------...-NI.QV......GCVE.CSQ........
ENSDARP00000109749  ........................................KTHLSDK...HTH.N-......TDIC.VT-........
ENSDARP00000110965  ........................................PVKSLQM...-GA.QV......RCLE.YVPepspseda
ENSDARP00000095605  ........................................ASVSWEH...RGV.TV......TSLC.WDT........
ENSDARP00000091436  ........................................HLRTLKV...PGK.QM......TAVS.WEG........
ENSDARP00000111846  ........................................AEMTLSP...ADG.RL......ELLL.FHP........
ENSDARP00000090283  ........................................-------...---.--......----.---........
ENSDARP00000008223  ........................................------G...HSS.FV......THLD.WST........
ENSDARP00000005398  ........................................MLCSFKI...STA.WS......CAWC.LNP........
ENSDARP00000020383  ........................................PWITRSC...-VG.ML......TCVG.VGDvcn.....
ENSDARP00000114287  ........................................-------...---.PI......RSAQ.FYY........
ENSDARP00000101793  ........................................-------...---.--......----.---........
ENSDARP00000059751  ........................................-------...---.--......----.---........
ENSDARP00000117166  ........................................---TITDahpPGT.AI......LHVK.FT-........
ENSDARP00000046545  ........................................KLQTPAE...VEG.NI......SQLQ.WGS........
ENSDARP00000060999  ........................................LVTEMAE...-NE.TV......TSLC.HM-........
ENSDARP00000084929  ........................................HLMDLGR...PHH.SI......RCMA.VVH........
ENSDARP00000104754  ........................................-------...HTR.II......WSCD.WSA........
ENSDARP00000111156  ........................................-------...---.--......----.---........
ENSDARP00000112085  ........................................QIIGLGT...FER.GV......GSLA.FS-........
ENSDARP00000100913  ........................................GACVLKL...GVL.PV......KALL.VV-........
ENSDARP00000003198  ........................................-------...---.-V......WSVV.YLS........
ENSDARP00000027152  ........................................LLWVDGE...PPQ.QI......TCLD.LNS........
ENSDARP00000106476  ........................................EVKRMPC...PGT.RL......S---.--Cqmk.....
ENSDARP00000104791  ........................................---KCSG...HSS.FI......THLD.WSV........
ENSDARP00000109373  ........................................PVGALPRa..HGC.A-......--VD.WAA........
ENSDARP00000092538  ........................................-------...---.--......----.---........
ENSDARP00000098142  ........................................CLHAVKL...-KD.SI......LNIV.HV-........
ENSDARP00000044811  ........................................SDDSLVL...KNA.GL......QAFT.IV-........
ENSDARP00000024810  ........................................PVVLVQCl..PPA.AV......TAVT.LHA........
ENSDARP00000075280  ........................................PSYKYEG...HGS.HV......TNVR.FTH........
ENSDARP00000076048  ........................................----LRG...HES.EV......FICA.WNP........
ENSDARP00000089501  ........................................-------...---.--......----.---........
ENSDARP00000107630  ........................................VVKTLPFis.AKQ.NI......QTFA.AVE........
ENSDARP00000092069  ........................................CITLFHP...HQK.CN......CSLV.VAA........
ENSDARP00000018100  yasgfaseqcpegivaistntlrilaleklgavfnqvafpL------...-QY.TP......RKFV.IHP........
ENSDARP00000108631  yasgfaseqcpegivaistntlrilaleklgavfnqvafpL------...-QY.TP......RKFV.IHP........
ENSDARP00000111537  ........................................P------...PCK.PVksrga.LVPA.FSP........
ENSDARP00000035593  ........................................G------...---.--......----.---........
ENSDARP00000109913  ........................................E------...---.--......----.---........
ENSDARP00000103234  ........................................-------...---.--......----.---........
ENSDARP00000026432  ........................................RLASAPV...-PF.TV......LSLT.GNPc.......
ENSDARP00000078268  ........................................QFLTFEAn..LTE.SI......NAMH.VS-........
ENSDARP00000078255  ........................................PLASFPW...KSG.VV......KQLG.WTV........
ENSDARP00000102911  ........................................MKVHLKF...-EV.NP......YDPA.IL-........
ENSDARP00000032159  ........................................-------...--S.GV......LGIE.LGK........
ENSDARP00000079570  ........................................-------...---.--......----.---........
ENSDARP00000007708  ........................................-------...---.--......----.---........


                                      130                                                           
                                        |                                                           
d1pgua1               .........EGRR.....L.CV........................................................
ENSDARP00000017859  .........QSNL.....I.-V........................................................
ENSDARP00000039257  .........NGDH.....I.-V........................................................
ENSDARP00000042217  .........NGDH.....I.-V........................................................
ENSDARP00000080947  .........-EKR.....V.-V........................................................
ENSDARP00000026057  .........DGQR.....L.-V........................................................
ENSDARP00000116595  .........QSTL.....V.-A........................................................
ENSDARP00000074155  .........ECRY.....L.-A........................................................
ENSDARP00000038728  .........RGPQ.....L.AC........................................................
ENSDARP00000088166  .........SGRF.....L.-G........................................................
ENSDARP00000103157  .........SGRF.....L.-G........................................................
ENSDARP00000111963  .........DDNQ.....I.-V........................................................
ENSDARP00000018443  .........DDNQ.....I.-V........................................................
ENSDARP00000079424  .........DDNQ.....I.-V........................................................
ENSDARP00000015825  .........FGYY.....F.-V........................................................
ENSDARP00000024623  .........MGEY.....L.-A........................................................
ENSDARP00000051230  .........DDNQ.....I.-I........................................................
ENSDARP00000044330  .........RKNW.....V.-I........................................................
ENSDARP00000079567  .........KGNF.....I.-L........................................................
ENSDARP00000017443  .........DSEI.....-.-I........................................................
ENSDARP00000107302  .........TIDV.....L.-V........................................................
ENSDARP00000005843  .........SDTE.....I.-V........................................................
ENSDARP00000104051  .........CGDF.....V.-A........................................................
ENSDARP00000061000  .........DNRQ.....I.-V........................................................
ENSDARP00000017497  .........-NGL.....M.-V........................................................
ENSDARP00000011435  .........SDMQ.....I.-L........................................................
ENSDARP00000072190  .........SDMQ.....I.-L........................................................
ENSDARP00000037531  .........-NGL.....M.-V........................................................
ENSDARP00000038258  .........CSLY.....F.-S........................................................
ENSDARP00000076048  .........SNNT.....F.-A........................................................
ENSDARP00000060977  .........EATV.....M.-L........................................................
ENSDARP00000079570  .........NNST.....F.-A........................................................
ENSDARP00000060431  .........DKQN.....L.LV........................................................
ENSDARP00000027484  .........TDNK.....F.-A........................................................
ENSDARP00000076693  .........SGSL.....L.-A........................................................
ENSDARP00000089117  .........DSTQ.....I.-L........................................................
ENSDARP00000079014  .........-HNM.....L.-F........................................................
ENSDARP00000122900  .........NKRF.....L.-S........................................................
ENSDARP00000106094  .........DSSH.....L.-V........................................................
ENSDARP00000105402  .........DSSH.....L.-V........................................................
ENSDARP00000107355  .........EYPW.....I.-L........................................................
ENSDARP00000099894  .........SKRY.....M.-V........................................................
ENSDARP00000114236  .........SSRF.....L.-A........................................................
ENSDARP00000068184  .........DSTQ.....L.-L........................................................
ENSDARP00000024391  .........DSNY.....L.-L........................................................
ENSDARP00000096338  .........DNKV.....C.-F........................................................
ENSDARP00000117865  .........DNKV.....C.-F........................................................
ENSDARP00000105810  .........TGRR.....VlLA........................................................
ENSDARP00000109528  .........DNAR.....I.-V........................................................
ENSDARP00000110967  .........SLQR.....L.-A........................................................
ENSDARP00000097371  .........TGDY.....L.-L........................................................
ENSDARP00000068663  .........KQQF.....V.-V........................................................
ENSDARP00000096387  .........DKEL.....V.-A........................................................
ENSDARP00000073472  .........DGQT.....I.-A........................................................
ENSDARP00000056247  .........DKEL.....V.-A........................................................
ENSDARP00000045014  .........DDNQ.....I.-I........................................................
ENSDARP00000090792  .........DAKV.....C.-F........................................................
ENSDARP00000019743  .........DAKV.....C.-F........................................................
ENSDARP00000028733  .........-GEQ.....L.-S........................................................
ENSDARP00000104487  .........IKNR.....L.-L........................................................
ENSDARP00000079959  .........AHQR.....L.-L........................................................
ENSDARP00000065646  .........GTHT.....L.-Y........................................................
ENSDARP00000005989  .........DGSL.....V.LV........................................................
ENSDARP00000062413  .........AENL.....L.-V........................................................
ENSDARP00000003004  .........-ADQ.....L.-S........................................................
ENSDARP00000024168  .........VDDT.....F.-I........................................................
ENSDARP00000077651  .........GGAI.....L.-I........................................................
ENSDARP00000124018  .........QAQS.....L.VA........................................................
ENSDARP00000068125  .........-DDK.....L.-Y........................................................
ENSDARP00000084377  .........DGKR.....F.-V........................................................
ENSDARP00000109369  .........GGAI.....L.-I........................................................
ENSDARP00000004327  .........TRTK.....F.-C........................................................
ENSDARP00000112164  .........-GDR.....L.-V........................................................
ENSDARP00000109556  .........SGDF.....L.-L........................................................
ENSDARP00000036145  .........DGKR.....F.-V........................................................
ENSDARP00000101521  .........DGSK.....L.-C........................................................
ENSDARP00000101197  .........DPKL.....L.-A........................................................
ENSDARP00000065847  .........DGQW.....L.-L........................................................
ENSDARP00000099567  .........WPNT.....F.-W........................................................
ENSDARP00000038520  .........KENK.....F.-A........................................................
ENSDARP00000106434  .........DGFR.....V.-L........................................................
ENSDARP00000033992  .........QEKA.....V.-F........................................................
ENSDARP00000060548  .........DCKR.....I.-V........................................................
ENSDARP00000105555  .........FGTI.....-.-L........................................................
ENSDARP00000087578  .........KGDY.....L.-A........................................................
ENSDARP00000076761  .........DGKR.....A.-I........................................................
ENSDARP00000119160  .........HDVW.....L.-A........................................................
ENSDARP00000099166  .........GGKQ.....V.-V........................................................
ENSDARP00000079110  .........DDRY.....F.-L........................................................
ENSDARP00000028109  .........REGT.....F.-V........................................................
ENSDARP00000017792  .........SGNI.....I.MF........................................................
ENSDARP00000091471  .........DTGM.....F.-V........................................................
ENSDARP00000015105  .........NYSC.....I.-M........................................................
ENSDARP00000005640  .........KSDR.....I.-V........................................................
ENSDARP00000112282  .........SGTF.....L.-Y........................................................
ENSDARP00000010862  .........DDSQ.....I.-V........................................................
ENSDARP00000112131  .........LHES.....L.FG........................................................
ENSDARP00000117542  .........LHES.....L.FG........................................................
ENSDARP00000027560  .........DGKE.....I.-L........................................................
ENSDARP00000110861  .........DSKY.....I.-A........................................................
ENSDARP00000102565  .........RWKI.....L.-Y........................................................
ENSDARP00000093657  .........ESNR.....I.-V........................................................
ENSDARP00000008451  .........EVNM.....L.-L........................................................
ENSDARP00000110420  .........TGLK.....L.LA........................................................
ENSDARP00000101565  .........DSKR.....L.AV........................................................
ENSDARP00000111921  .........EVNV.....L.-V........................................................
ENSDARP00000018714  .........DENI.....F.-A........................................................
ENSDARP00000097750  .........NDPY.....T.FL........................................................
ENSDARP00000105810  .........SSPR.....L.-F........................................................
ENSDARP00000065337  .........GTSH.....L.-L........................................................
ENSDARP00000016280  .........GDSY.....I.-A........................................................
ENSDARP00000071264  .........SGRR.....L.-M........................................................
ENSDARP00000073678  .........DGNF.....M.-A........................................................
ENSDARP00000070393  .........DSPC.....S.FL........................................................
ENSDARP00000100903  .........TGKF.....I.-M........................................................
ENSDARP00000099551  .........PGKQ.....I.-A........................................................
ENSDARP00000063641  .........TGKF.....I.-M........................................................
ENSDARP00000104754  ........eQSLK.....L.-L........................................................
ENSDARP00000014740  .........SGTV.....L.-Y........................................................
ENSDARP00000106749  .........SQRQ.....V.-V........................................................
ENSDARP00000003237  .........EAQT.....L.-I........................................................
ENSDARP00000115064  .........SGSR.....V.-A........................................................
ENSDARP00000071531  .........DFGL.....I.LA........................................................
ENSDARP00000105980  .........DGSQ.....-.-L........................................................
ENSDARP00000113946  .........-RDT.....V.-L........................................................
ENSDARP00000079302  .........TNKR.....V.-F........................................................
ENSDARP00000111824  .........TEAT.....V.FA........................................................
ENSDARP00000008006  .........QSNL.....I.-A........................................................
ENSDARP00000079585  .........LPHR.....L.-V........................................................
ENSDARP00000104171  .........QSNL.....V.-A........................................................
ENSDARP00000052711  .........GSTL.....L.-A........................................................
ENSDARP00000059208  .........EMEW.....V.-L........................................................
ENSDARP00000006309  .........ESQW.....L.-V........................................................
ENSDARP00000102210  .........TDRV.....L.-C........................................................
ENSDARP00000124457  .........EDSV.....L.-Y........................................................
ENSDARP00000010071  .........ELDT.....L.-V........................................................
ENSDARP00000092538  .........QSKW.....L.-Y........................................................
ENSDARP00000031340  .........SNDI.....I.-V........................................................
ENSDARP00000059344  .........LGEK.....I.-M........................................................
ENSDARP00000074880  .........SNHN.....F.-F........................................................
ENSDARP00000026454  .........TARN.....V.LL........................................................
ENSDARP00000099918  .........SGSF.....A.-I........................................................
ENSDARP00000121552  .........GNHT.....F.-F........................................................
ENSDARP00000007696  .........SALN.....I.LL........................................................
ENSDARP00000080844  .........NANN.....L.-I........................................................
ENSDARP00000071301  .........TAHN.....V.LM........................................................
ENSDARP00000079585  .........LLPI.....C.-A........................................................
ENSDARP00000106510  .........SGSV.....V.-A........................................................
ENSDARP00000037121  .........NANN.....L.-I........................................................
ENSDARP00000124137  .........SSSL.....I.-A........................................................
ENSDARP00000039795  .........TARN.....V.LL........................................................
ENSDARP00000079663  .........GAQT.....V.LA........................................................
ENSDARP00000056762  .........DGTA.....L.-I........................................................
ENSDARP00000024476  .........SGTS.....F.-Vcsaaahsgavmeseprg.......................................
ENSDARP00000126101  .........SGTS.....F.-Vcsaaahsgavmeseprg.......................................
ENSDARP00000087003  .........NAHN.....L.-I........................................................
ENSDARP00000065205  .........KGEI.....L.-V........................................................
ENSDARP00000110420  .........NSKY.....I.-V........................................................
ENSDARP00000059666  .........TDDC.....I.-A........................................................
ENSDARP00000101126  .........AGGA.....L.-A........................................................
ENSDARP00000060548  .........NDKY.....L.-V........................................................
ENSDARP00000078100  .........KQPL.....V.-A........................................................
ENSDARP00000078191  .........ETGL.....L.-M........................................................
ENSDARP00000078965  .........TSGI.....L.-F........................................................
ENSDARP00000102373  .........DGQT.....F.-M........................................................
ENSDARP00000006117  .........IGTE.....A.-F........................................................
ENSDARP00000111140  .........HAIG.....L.LV........................................................
ENSDARP00000094274  .........EGEG.....F.IV........................................................
ENSDARP00000075344  .........GGHL.....F.-A........................................................
ENSDARP00000106181  .........EPEF.....L.-V........................................................
ENSDARP00000089501  .........QSKW.....L.-Y........................................................
ENSDARP00000102443  .........DYET.....-.-Y........................................................
ENSDARP00000038921  .........HAIG.....L.LV........................................................
ENSDARP00000033554  .........DYET.....-.-Y........................................................
ENSDARP00000100360  .........TKPL.....A.-M........................................................
ENSDARP00000014182  .........TANN.....I.IF........................................................
ENSDARP00000027152  .........QSKW.....L.-Y........................................................
ENSDARP00000108102  .........TARN.....I.LL........................................................
ENSDARP00000107806  .........THTA.....L.-I........................................................
ENSDARP00000007602  .........DNET.....Y.-L........................................................
ENSDARP00000021430  .........KDSH.....I.-L........................................................
ENSDARP00000087525  .........CSGI.....L.-F........................................................
ENSDARP00000054317  .........GAPE.....I.-V........................................................
ENSDARP00000110907  .........SSSL.....I.-A........................................................
ENSDARP00000074797  .........GEFS.....V.-L........................................................
ENSDARP00000047739  .........HTRL.....L.-V........................................................
ENSDARP00000079585  .........NGEM.....V.-S........................................................
ENSDARP00000055337  .........-ESH.....L.-L........................................................
ENSDARP00000058220  .........DPNL.....L.-G........................................................
ENSDARP00000102332  .........RAGW.....V.-A........................................................
ENSDARP00000003173  .........MGLM.....L.-T........................................................
ENSDARP00000064438  .........-SPE.....I.-V........................................................
ENSDARP00000099721  .........DYET.....Y.-L........................................................
ENSDARP00000026825  .........DGET.....Y.-L........................................................
ENSDARP00000100187  .........ALQE.....V.-V........................................................
ENSDARP00000059532  .........SNSF.....L.AY........................................................
ENSDARP00000099725  .........DGKF.....L.-L........................................................
ENSDARP00000084300  .........DCET.....Y.-L........................................................
ENSDARP00000124280  .........TARD.....L.LL........................................................
ENSDARP00000100360  .........EGDM.....V.-A........................................................
ENSDARP00000110672  .........EGEC.....V.SL........................................................
ENSDARP00000060454  .........DGKF.....L.-A........................................................
ENSDARP00000098826  .........DGKF.....L.-A........................................................
ENSDARP00000091438  .........SRQM.....L.-A........................................................
ENSDARP00000098798  .........EDRP.....F.-A........................................................
ENSDARP00000091436  .........DGLK.....I.-C........................................................
ENSDARP00000086480  .........EGAL.....L.-C........................................................
ENSDARP00000099546  .........EERK.....I.-I........................................................
ENSDARP00000061333  .........-SEH.....A.II........................................................
ENSDARP00000037790  .........-RDR.....I.VV........................................................
ENSDARP00000032005  .........DNET.....Y.-L........................................................
ENSDARP00000008668  .........YLNK.....I.-L........................................................
ENSDARP00000103874  .........AYHI.....V.-V........................................................
ENSDARP00000043116  .........SLGT.....F.-V........................................................
ENSDARP00000063737  .........NCTQ.....L.-A........................................................
ENSDARP00000106107  .........DNCY.....L.AY........................................................
ENSDARP00000101619  .........AGDS.....V.-A........................................................
ENSDARP00000025827  .........ELDM.....A.-V........................................................
ENSDARP00000100360  .........-RDE.....I.TY........................................................
ENSDARP00000003197  .........ELGL.....V.-I........................................................
ENSDARP00000012553  .........TGSL.....L.-V........................................................
ENSDARP00000003663  .........DGVH.....V.-A........................................................
ENSDARP00000069897  .........MSAK.....V.-A........................................................
ENSDARP00000018434  .........EGKQ.....I.-A........................................................
ENSDARP00000093342  .........ELGL.....V.-I........................................................
ENSDARP00000100360  .........DDSL.....L.-A........................................................
ENSDARP00000102548  .........SRDL.....L.-L........................................................
ENSDARP00000041156  .........ELGI.....I.-I........................................................
ENSDARP00000108156  .........-HDK.....I.-I........................................................
ENSDARP00000070070  .........QPCN.....L.-I........................................................
ENSDARP00000018924  .........PSCD.....L.-Y........................................................
ENSDARP00000123525  .........TDRS.....I.CL........................................................
ENSDARP00000109363  .........SGKH.....V.-A........................................................
ENSDARP00000103752  .........SGKH.....V.-A........................................................
ENSDARP00000101029  .........DSRR.....L.AL........................................................
ENSDARP00000101492  .........DGPA.....L.-Asasgpdvrvdapdeqgywrsqslvqlpkpvdgvlvvpgkrdiplvtawagesvyll
ENSDARP00000038543  .........ELDM.....A.-I........................................................
ENSDARP00000079585  .........LKDY.....V.-A........................................................
ENSDARP00000104754  .........SSHL.....L.VA........................................................
ENSDARP00000075344  .........DNSK.....I.CV........................................................
ENSDARP00000083528  .........QRHH.....V.-A........................................................
ENSDARP00000017678  .........DDTL.....L.LV........................................................
ENSDARP00000097777  .........AHSM.....I.-I........................................................
ENSDARP00000109722  .........DHQK.....L.-L........................................................
ENSDARP00000083772  .........DTQT.....V.-Y........................................................
ENSDARP00000065266  .........DGTQ.....C.-L........................................................
ENSDARP00000088806  .........TAQL.....L.-L........................................................
ENSDARP00000109028  .........AGRE.....F.-V........................................................
ENSDARP00000095457  .........TAQL.....L.-L........................................................
ENSDARP00000086448  .........SHKE.....L.-G........................................................
ENSDARP00000117869  .........NQPR.....L.-L........................................................
ENSDARP00000035593  .........SGEL.....L.-L........................................................
ENSDARP00000086251  .........DGTQ.....A.-L........................................................
ENSDARP00000054352  .........KGKH.....L.-M........................................................
ENSDARP00000024810  .........GQGR.....I.-L........................................................
ENSDARP00000100292  .........FSQT.....V.AY........................................................
ENSDARP00000079585  .........TGKL.....L.-L........................................................
ENSDARP00000009095  .........DFSH.....L.FL........................................................
ENSDARP00000101029  .........DGNE.....L.WL........................................................
ENSDARP00000118167  .........DGTQ.....A.-L........................................................
ENSDARP00000101029  .........SGGV.....L.-C........................................................
ENSDARP00000050905  .........RKPT.....F.LF........................................................
ENSDARP00000078100  .........DSTQ.....L.-V........................................................
ENSDARP00000046545  .........NGSR.....L.-V........................................................
ENSDARP00000032408  .........DSPT.....V.-L........................................................
ENSDARP00000104388  .........HHNL.....L.-L........................................................
ENSDARP00000101882  .........GKVT.....L.VF........................................................
ENSDARP00000093519  .........EKQY.....L.-V........................................................
ENSDARP00000112439  .........QQDG.....L.LL........................................................
ENSDARP00000071650  .........DKKH.....I.-V........................................................
ENSDARP00000099546  .........KTNN.....C.-L........................................................
ENSDARP00000111616  gtpvenqsrTSVQ.....L.-V........................................................
ENSDARP00000019506  .........SGNMecigdL.-V........................................................
ENSDARP00000076262  .........VQSV.....I.-I........................................................
ENSDARP00000080599  .........-GSF.....L.-L........................................................
ENSDARP00000084220  .........DGTV.....L.-A........................................................
ENSDARP00000080965  .........AGSF.....L.-I........................................................
ENSDARP00000123525  .........SSDL.....-.-Y........................................................
ENSDARP00000018692  .........LKSY.....L.-L........................................................
ENSDARP00000008672  .........ASSH.....L.LV........................................................
ENSDARP00000094999  .........NGMK.....L.-F........................................................
ENSDARP00000116849  .........SGDH.....V.-G........................................................
ENSDARP00000104388  .........TANT.....F.-L........................................................
ENSDARP00000072504  .........----.....-.--........................................................
ENSDARP00000052786  .........QHNI.....L.-V........................................................
ENSDARP00000076812  .........-AED.....L.-L........................................................
ENSDARP00000047833  .........WSAE.....L.-L........................................................
ENSDARP00000097904  .........-GNL.....L.-A........................................................
ENSDARP00000102548  .........GNQK.....L.-L........................................................
ENSDARP00000082368  .........QLGR.....-.-I........................................................
ENSDARP00000109749  .........----.....-.-V........................................................
ENSDARP00000110965  etslhssteVGNT.....I.-C........................................................
ENSDARP00000095605  .........VALR.....V.-F........................................................
ENSDARP00000091436  .........GGLR.....I.GL........................................................
ENSDARP00000111846  .........AASA.....L.LA........................................................
ENSDARP00000090283  .........----.....-.--........................................................
ENSDARP00000008223  .........DSQF.....I.-V........................................................
ENSDARP00000005398  .........QADK.....T.-F........................................................
ENSDARP00000020383  .........KGRN.....V.VV........................................................
ENSDARP00000114287  .........LDKF.....L.LL........................................................
ENSDARP00000101793  .........----.....-.--........................................................
ENSDARP00000059751  .........----.....-.--........................................................
ENSDARP00000117166  .........DHPA.....L.-A........................................................
ENSDARP00000046545  .........SAHL.....L.-A........................................................
ENSDARP00000060999  .........HGSR.....F.-G........................................................
ENSDARP00000084929  .........DKVW.....C.--........................................................
ENSDARP00000104754  .........DNKY.....F.-V........................................................
ENSDARP00000111156  .........----.....-.--........................................................
ENSDARP00000112085  .........----.....-.--........................................................
ENSDARP00000100913  .........-SEH.....-.-I........................................................
ENSDARP00000003198  .........DGTI.....-.-I........................................................
ENSDARP00000027152  .........AYGL.....L.-A........................................................
ENSDARP00000106476  .........MENT.....L.-W........................................................
ENSDARP00000104791  .........DSQY.....L.-V........................................................
ENSDARP00000109373  .........DSLT.....L.--........................................................
ENSDARP00000092538  .........----.....-.--........................................................
ENSDARP00000098142  .........-KGR.....V.-L........................................................
ENSDARP00000044811  .........-KKI.....L.-V........................................................
ENSDARP00000024810  .........EWNL.....I.-A........................................................
ENSDARP00000075280  .........NDSH.....L.-L........................................................
ENSDARP00000076048  .........VSDL.....L.-A........................................................
ENSDARP00000089501  .........----.....-.--........................................................
ENSDARP00000107630  .........GEKE.....A.LI........................................................
ENSDARP00000092069  .........RGPY.....I.-F........................................................
ENSDARP00000018100  .........ETNN.....L.-I........................................................
ENSDARP00000108631  .........ETNN.....L.-I........................................................
ENSDARP00000111537  .........DGQL.....L.-A........................................................
ENSDARP00000035593  .........----.....-.--........................................................
ENSDARP00000109913  .........----.....-.--........................................................
ENSDARP00000103234  .........----.....-.--........................................................
ENSDARP00000026432  .........NEDY.....L.-A........................................................
ENSDARP00000078268  .........-GAD.....L.FV........................................................
ENSDARP00000078255  .........SDDL.....-.-L........................................................
ENSDARP00000102911  .........-RQL.....I.-L........................................................
ENSDARP00000032159  .........DVDH.....I.-I........................................................
ENSDARP00000079570  .........----.....-.--........................................................
ENSDARP00000007708  .........----.....-.--........................................................


                                                                        140                         
                                                                          |                         
d1pgua1               ....................................VG........E.GRDNF.....G...................
ENSDARP00000017859  ....................................SG........-.SFDES.....V...................
ENSDARP00000039257  ....................................SA........-.SRDKT.....M...................
ENSDARP00000042217  ....................................SA........-.SRDKT.....I...................
ENSDARP00000080947  ....................................SG........-.SRDAT.....L...................
ENSDARP00000026057  ....................................TA........-.SDDKS.....V...................
ENSDARP00000116595  ....................................TG........-.SMDTT.....A...................
ENSDARP00000074155  ....................................ST........-.SKDCT.....I...................
ENSDARP00000038728  ....................................TG........-.SDDGT.....V...................
ENSDARP00000088166  ....................................TT........-.CYDHS.....W...................
ENSDARP00000103157  ....................................TT........-.CYDHS.....W...................
ENSDARP00000111963  ....................................TS........-.SGDTT.....C...................
ENSDARP00000018443  ....................................TS........-.SGDTT.....C...................
ENSDARP00000079424  ....................................TS........-.SGDTT.....C...................
ENSDARP00000015825  ....................................SG........-.GHDRV.....A...................
ENSDARP00000024623  ....................................SG........-.SVDSN.....I...................
ENSDARP00000051230  ....................................TS........-.SGDTT.....C...................
ENSDARP00000044330  ....................................TG........-.ADDMQ.....I...................
ENSDARP00000079567  ....................................SA........-.GVDKT.....T...................
ENSDARP00000017443  ....................................TS........-.SGDCT.....C...................
ENSDARP00000107302  ....................................TC........-.SRDAT.....A...................
ENSDARP00000005843  ....................................TS........-.SGDTT.....C...................
ENSDARP00000104051  ....................................SC........-.SMDNT.....V...................
ENSDARP00000061000  ....................................SG........-.SRDKT.....I...................
ENSDARP00000017497  ....................................TC........-.SKDRS.....I...................
ENSDARP00000011435  ....................................TS........-.SGDGT.....C...................
ENSDARP00000072190  ....................................TS........-.SGDGT.....C...................
ENSDARP00000037531  ....................................TC........-.SKDRS.....I...................
ENSDARP00000038258  ....................................TA........-.SHDRT.....A...................
ENSDARP00000076048  ....................................SC........-.STDMC.....I...................
ENSDARP00000060977  ....................................SG........-.SIDGT.....V...................
ENSDARP00000079570  ....................................SC........-.STDMC.....I...................
ENSDARP00000060431  ....................................AG........-.MSDKK.....I...................
ENSDARP00000027484  ....................................TC........-.SDDGT.....V...................
ENSDARP00000076693  ....................................TC........-.SRDKS.....V...................
ENSDARP00000089117  ....................................SA........-.SFDQT.....I...................
ENSDARP00000079014  ....................................SG........-.SLKA-.....I...................
ENSDARP00000122900  ....................................ST........-.GADGT.....I...................
ENSDARP00000106094  ....................................SG........-.GSDGS.....I...................
ENSDARP00000105402  ....................................SG........-.GSDGS.....I...................
ENSDARP00000107355  ....................................SA........-.SDDQT.....I...................
ENSDARP00000099894  ....................................ST........-.GTDAT.....V...................
ENSDARP00000114236  ....................................TT........-.GADGM.....V...................
ENSDARP00000068184  ....................................SS........-.SFDQT.....I...................
ENSDARP00000024391  ....................................TG........-.GNDKV.....L...................
ENSDARP00000096338  ....................................SC........-.CSDGN.....I...................
ENSDARP00000117865  ....................................SC........-.CSDGN.....I...................
ENSDARP00000105810  ....................................TC........-.SNDKFtn...T...................
ENSDARP00000109528  ....................................SG........-.SYDRT.....L...................
ENSDARP00000110967  ....................................SC........-.SADGT.....V...................
ENSDARP00000097371  ....................................SS........-.SEDQY.....W...................
ENSDARP00000068663  ....................................SG........-.SQDCT.....V...................
ENSDARP00000096387  ....................................SA........-.GLDRQ.....I...................
ENSDARP00000073472  ....................................VG........-.NKDDV.....V...................
ENSDARP00000056247  ....................................SA........-.GLDRQ.....I...................
ENSDARP00000045014  ....................................TS........-.SGDTT.....C...................
ENSDARP00000090792  ....................................SC........-.CSDGN.....I...................
ENSDARP00000019743  ....................................SC........-.CSDGN.....I...................
ENSDARP00000028733  ....................................SG........-.SRDRV.....I...................
ENSDARP00000104487  ....................................SC........-.SADGT.....I...................
ENSDARP00000079959  ....................................SC........-.SADGT.....V...................
ENSDARP00000065646  ....................................SA........-.SHDRS.....I...................
ENSDARP00000005989  ....................................SA........-.SRDKT.....L...................
ENSDARP00000062413  ....................................SG........-.SWDHT.....A...................
ENSDARP00000003004  ....................................SG........-.SRDRM.....I...................
ENSDARP00000024168  ....................................SG........-.SLDKT.....I...................
ENSDARP00000077651  ....................................SA........G.AGDCN.....I...................
ENSDARP00000124018  ....................................TG........-.GYDGV.....L...................
ENSDARP00000068125  ....................................TA........-.SWDST.....V...................
ENSDARP00000084377  ....................................TG........-.GQRGQ.....F...................
ENSDARP00000109369  ....................................SA........G.AGDCN.....I...................
ENSDARP00000004327  ....................................SG........-.SWDKM.....L...................
ENSDARP00000112164  ....................................SG........-.AKDCR.....V...................
ENSDARP00000109556  ....................................VG........-.TQHPT.....L...................
ENSDARP00000036145  ....................................TG........-.GQRGQ.....F...................
ENSDARP00000101521  ....................................TG........-.SRDNS.....M...................
ENSDARP00000101197  ....................................SG........-.SDDAK.....V...................
ENSDARP00000065847  ....................................SG........-.GWDNR.....A...................
ENSDARP00000099567  ....................................SA........-.AEDGL.....I...................
ENSDARP00000038520  ....................................VG........-.SGSRL.....I...................
ENSDARP00000106434  ....................................SG........-.SDDLT.....C...................
ENSDARP00000033992  ....................................ST........G.GRDGN.....I...................
ENSDARP00000060548  ....................................SG........-.GGEGQ.....V...................
ENSDARP00000105555  ....................................SG........-.SWDTT.....A...................
ENSDARP00000087578  ....................................CV........-.LPDSSssvq.V...................
ENSDARP00000076761  ....................................VG........-.YEDGS.....L...................
ENSDARP00000119160  ....................................SC........-.SVDNT.....I...................
ENSDARP00000099166  ....................................TA........-.SWDRA.....A...................
ENSDARP00000079110  ....................................SG........-.SLDGK.....L...................
ENSDARP00000028109  ....................................TC........-.--GQT.....V...................
ENSDARP00000017792  ....................................STdkq.....M.GYQCF.....L...................
ENSDARP00000091471  ....................................SS........-.SFDKT.....M...................
ENSDARP00000015105  ....................................TG........-.SWDKT.....L...................
ENSDARP00000005640  ....................................TC........-.GADRN.....A...................
ENSDARP00000112282  ....................................AA........-.SGNT-.....V...................
ENSDARP00000010862  ....................................TS........-.SGDTT.....C...................
ENSDARP00000112131  ....................................SV........-.ADDQK.....L...................
ENSDARP00000117542  ....................................SV........-.ADDQK.....L...................
ENSDARP00000027560  ....................................GG........-.ANDGC.....L...................
ENSDARP00000110861  ....................................TG........-.SHLGK.....V...................
ENSDARP00000102565  ....................................IG........-.LANGS.....V...................
ENSDARP00000093657  ....................................TC........-.ASDRN.....A...................
ENSDARP00000008451  ....................................SG........-.SQDGF.....M...................
ENSDARP00000110420  ....................................TA........-.SRDRL.....I...................
ENSDARP00000101565  ....................................VG........E.GREKF.....G...................
ENSDARP00000111921  ....................................TG........-.SWDQS.....V...................
ENSDARP00000018714  ....................................TG........-.DDEGT.....L...................
ENSDARP00000097750  ....................................SC........-.GEDGT.....V...................
ENSDARP00000105810  ....................................SW........-.SFDGT.....V...................
ENSDARP00000065337  ....................................SG........-.GQDGL.....I...................
ENSDARP00000016280  ....................................SG........-.STSGD.....I...................
ENSDARP00000071264  ....................................TG........-.GRDGL.....I...................
ENSDARP00000073678  ....................................SG........-.SVDNT.....A...................
ENSDARP00000070393  ....................................SA........-.GEDAV.....V...................
ENSDARP00000100903  ....................................SA........-.SVDTT.....I...................
ENSDARP00000099551  ....................................SG........-.SVDAC.....V...................
ENSDARP00000063641  ....................................SA........-.SVDTT.....I...................
ENSDARP00000104754  ....................................SA........-.SMDKT.....M...................
ENSDARP00000014740  ....................................AA........-.AGNS-.....V...................
ENSDARP00000106749  ....................................TG........-.SADRT.....V...................
ENSDARP00000003237  ....................................SG........-.SFDKS.....V...................
ENSDARP00000115064  ....................................AG........-.SSDFL.....V...................
ENSDARP00000071531  ....................................CG........-.SSDGA.....I...................
ENSDARP00000105980  ....................................YC........-.GFDKI.....V...................
ENSDARP00000113946  ....................................AG........-.SHDQR.....L...................
ENSDARP00000079302  ....................................SG........-.GNDEQ.....V...................
ENSDARP00000111824  ....................................SC........-.SVDQS.....I...................
ENSDARP00000008006  ....................................SG........-.ANDSE.....I...................
ENSDARP00000079585  ....................................SC........-.GVKH-.....I...................
ENSDARP00000104171  ....................................SG........-.GNESE.....I...................
ENSDARP00000052711  ....................................HP........-.TQHMEe....V...................
ENSDARP00000059208  ....................................ST........-.GQDKS.....F...................
ENSDARP00000006309  ....................................ST........-.GHDKS.....I...................
ENSDARP00000102210  ....................................AGteq.....V.EEDSF.....L...................
ENSDARP00000124457  ....................................SG........-.SDDTH.....I...................
ENSDARP00000010071  ....................................SG........-.SADFT.....V...................
ENSDARP00000092538  ....................................IG........-.SERGN.....I...................
ENSDARP00000031340  ....................................ST........-.SKDGT.....L...................
ENSDARP00000059344  ....................................SC........-.GMDHS.....L...................
ENSDARP00000074880  ....................................SV........-.STDGR.....V...................
ENSDARP00000026454  ....................................SA........-.GCDNM.....I...................
ENSDARP00000099918  ....................................ST........-.SSDT-.....A...................
ENSDARP00000121552  ....................................SV........-.SADGR.....V...................
ENSDARP00000007696  ....................................TA........-.GCDNV.....L...................
ENSDARP00000080844  ....................................TV........-.STDGK.....M...................
ENSDARP00000071301  ....................................SA........-.GCDNV.....V...................
ENSDARP00000079585  ....................................TV........-.SDDKT.....L...................
ENSDARP00000106510  ....................................IG........-.THSGK.....W...................
ENSDARP00000037121  ....................................TV........-.STDGR.....M...................
ENSDARP00000124137  ....................................TAg.......Q.SNDGRn....V...................
ENSDARP00000039795  ....................................SA........-.GCDNL.....I...................
ENSDARP00000079663  ....................................YA........-.TVNGF.....L...................
ENSDARP00000056762  ....................................TA........-.GEDGQ.....L...................
ENSDARP00000024476  ....................................SA........-.PVSGQ.....L...................
ENSDARP00000126101  ....................................SA........-.PVSGQ.....L...................
ENSDARP00000087003  ....................................SI........-.STDGK.....M...................
ENSDARP00000065205  ....................................SV........-.SSDGR.....I...................
ENSDARP00000110420  ....................................SV........-.GYQHDmi...V...................
ENSDARP00000059666  ....................................SG........-.HEDGK.....I...................
ENSDARP00000101126  ....................................AA........-.DDSGA.....V...................
ENSDARP00000060548  ....................................SLg.......G.QDDAS.....I...................
ENSDARP00000078100  ....................................MG........-.SHSGT.....I...................
ENSDARP00000078191  ....................................TS........-.GDVRV.....I...................
ENSDARP00000078965  ....................................SA........-.GYDYK.....I...................
ENSDARP00000102373  ....................................ST........-.DDLR-.....I...................
ENSDARP00000006117  ....................................SA........-.STDGQ.....V...................
ENSDARP00000111140  ....................................SS........-.SYDLT.....V...................
ENSDARP00000094274  ....................................TG........-.SDAGK.....L...................
ENSDARP00000075344  ....................................AV........-.-NGNV.....I...................
ENSDARP00000106181  ....................................TS........-.SVDTY.....I...................
ENSDARP00000089501  ....................................VG........-.TERGN.....I...................
ENSDARP00000102443  ....................................MS........-.TDDLR.....I...................
ENSDARP00000038921  ....................................SS........-.SYDLT.....V...................
ENSDARP00000033554  ....................................MS........-.TDDLR.....I...................
ENSDARP00000100360  ....................................TG........-.SDDRS.....V...................
ENSDARP00000014182  ....................................ST........-.GYDYQ.....V...................
ENSDARP00000027152  ....................................VG........-.TERGN.....T...................
ENSDARP00000108102  ....................................TA........-.GSDNL.....I...................
ENSDARP00000107806  ....................................TA........-.SSDRT.....L...................
ENSDARP00000007602  ....................................SA........-.DDLR-.....I...................
ENSDARP00000021430  ....................................IG........G.SYNGQ.....I...................
ENSDARP00000087525  ....................................SA........-.GYDCK.....I...................
ENSDARP00000054317  ....................................TG........-.SRDGT.....V...................
ENSDARP00000110907  ....................................TAgl......S.TDNRN.....V...................
ENSDARP00000074797  ....................................SA........-.GSGGR.....V...................
ENSDARP00000047739  ....................................TS........-.GFDGN.....V...................
ENSDARP00000079585  ....................................IG........-.MENGE.....F...................
ENSDARP00000055337  ....................................SA........-.GNGE-.....I...................
ENSDARP00000058220  ....................................TS........-.SIDTT.....C...................
ENSDARP00000102332  ....................................TG........-.GADGG.....V...................
ENSDARP00000003173  ....................................TC........-.SADGV.....V...................
ENSDARP00000064438  ....................................SV........-.GEDGR.....V...................
ENSDARP00000099721  ....................................SA........-.DDLR-.....I...................
ENSDARP00000026825  ....................................SA........-.DDLR-.....I...................
ENSDARP00000100187  ....................................SC........-.--DGT.....V...................
ENSDARP00000059532  ....................................PG........S.DTIGE.....I...................
ENSDARP00000099725  ....................................LS........-.GSSGY.....L...................
ENSDARP00000084300  ....................................SA........-.DDLR-.....I...................
ENSDARP00000124280  ....................................SS........-.AYDCK.....V...................
ENSDARP00000100360  ....................................IG........-.MKNGE.....F...................
ENSDARP00000110672  ....................................LI........-.SDAGK.....L...................
ENSDARP00000060454  ....................................CA........-.GQDGF.....L...................
ENSDARP00000098826  ....................................VV........-.SQDGF.....L...................
ENSDARP00000091438  ....................................TG........-.DSTGR.....L...................
ENSDARP00000098798  ....................................VG........-.YADGK.....L...................
ENSDARP00000091436  ....................................IV........-.YEDGA.....V...................
ENSDARP00000086480  ....................................SV........-.GDDQA.....M...................
ENSDARP00000099546  ....................................IT........-.NPSSQ.....V...................
ENSDARP00000061333  ....................................FG........-.LAEGK.....V...................
ENSDARP00000037790  ....................................VL........-.--DSM.....I...................
ENSDARP00000032005  ....................................SA........-.DDLR-.....V...................
ENSDARP00000008668  ....................................FG........-.SSQGS.....L...................
ENSDARP00000103874  ....................................SG........-.SRDRT.....C...................
ENSDARP00000043116  ....................................TG........-.TACCEnfap.L...................
ENSDARP00000063737  ....................................TA........-.NDTA-.....I...................
ENSDARP00000106107  ....................................PG........S.ATIGE.....V...................
ENSDARP00000101619  ....................................FV........-.SHRGP.....L...................
ENSDARP00000025827  ....................................SG........-.SRDGT.....V...................
ENSDARP00000100360  ....................................SG........-.ALNGD.....I...................
ENSDARP00000003197  ....................................SG........-.CREGP.....C...................
ENSDARP00000012553  ....................................SA........S.PVDTA.....M...................
ENSDARP00000003663  ....................................CV........-.GQDGC.....L...................
ENSDARP00000069897  ....................................AC........-.SGSR-.....V...................
ENSDARP00000018434  ....................................SV........-.SDDHT.....C...................
ENSDARP00000093342  ....................................SG........-.AKEGP.....C...................
ENSDARP00000100360  ....................................SV........G.GSDTC.....L...................
ENSDARP00000102548  ....................................AV........-.HPPNY.....I...................
ENSDARP00000041156  ....................................SG........-.AKEGP.....C...................
ENSDARP00000108156  ....................................II........-.LKNR-.....I...................
ENSDARP00000070070  ....................................TA........-.SYDGS.....A...................
ENSDARP00000018924  ....................................FV........-.GASSE.....V...................
ENSDARP00000123525  ....................................SV........-.REAGV.....V...................
ENSDARP00000109363  ....................................LT........-.DDHKR.....L...................
ENSDARP00000103752  ....................................LT........-.DDHKR.....L...................
ENSDARP00000101029  ....................................IG........-.PTEYI.....V...................
ENSDARP00000101492  nsrpeeeqeprvlhsvyghpvtcvdtspsraamgikSCgwgm....N.DGGNK.....I...................
ENSDARP00000038543  ....................................SG........-.SKDGT.....V...................
ENSDARP00000079585  ....................................SGq.......V.GRDPA.....I...................
ENSDARP00000104754  ....................................SA........-.SSDST.....V...................
ENSDARP00000075344  ....................................SG........-.--KGV.....F...................
ENSDARP00000083528  ....................................TG........-.GKENP.....L...................
ENSDARP00000017678  ....................................SGvylgph..H.SSAGE.....I...................
ENSDARP00000097777  ....................................SG........-.SLDQT.....C...................
ENSDARP00000109722  ....................................LA........-.GMHRN.....L...................
ENSDARP00000083772  ....................................SG........-.GDDSK.....L...................
ENSDARP00000065266  ....................................SG........-.SSDGT.....I...................
ENSDARP00000088806  ....................................IA........-.TNNE-.....V...................
ENSDARP00000109028  ....................................SStdavsr..D.SADRT.....L...................
ENSDARP00000095457  ....................................IA........-.TNNE-.....L...................
ENSDARP00000086448  ....................................AV........-.SLDGY.....F...................
ENSDARP00000117869  ....................................SL........-.GMDRR.....L...................
ENSDARP00000035593  ....................................LG........-.TEGGH.....V...................
ENSDARP00000086251  ....................................IA........-.YRDGF.....V...................
ENSDARP00000054352  ....................................SIrsrslpg.S.FTAGE.....I...................
ENSDARP00000024810  ....................................SL........-.LDDNT.....I...................
ENSDARP00000100292  ....................................SC........-.SEDCN.....V...................
ENSDARP00000079585  ....................................SV........-.GVDPEht...I...................
ENSDARP00000009095  ....................................TA........-.SFDWT.....V...................
ENSDARP00000101029  ....................................AV........-.SADRR.....V...................
ENSDARP00000118167  ....................................IS........-.YRDGF.....V...................
ENSDARP00000101029  ....................................GV........-.GKDSHnktt.V...................
ENSDARP00000050905  ....................................TG........-.TYDKK.....I...................
ENSDARP00000078100  ....................................SN........-.SSSQ-.....V...................
ENSDARP00000046545  ....................................TG........-.DQAGV.....M...................
ENSDARP00000032408  ....................................HG........-.SCISD.....I...................
ENSDARP00000104388  ....................................SV........-.ASSGV.....L...................
ENSDARP00000101882  ....................................AG........-.TAVGS.....V...................
ENSDARP00000093519  ....................................SA........-.SESGE.....M...................
ENSDARP00000112439  ....................................SA........-.ALDNT.....I...................
ENSDARP00000071650  ....................................TV........-.GRDFE.....C...................
ENSDARP00000099546  ....................................ST........-.GLDGT.....L...................
ENSDARP00000111616  ....................................TC........-.APDCC.....V...................
ENSDARP00000019506  ....................................SA........-.DDSGL.....L...................
ENSDARP00000076262  ....................................TS........-.DSKGT.....I...................
ENSDARP00000080599  ....................................LG........-.CNNGS.....I...................
ENSDARP00000084220  ....................................TA........-.SHDGY.....V...................
ENSDARP00000080965  ....................................LG........-.CNNGS.....I...................
ENSDARP00000123525  ....................................VG........-.CKEGF.....L...................
ENSDARP00000018692  ....................................VG........-.TADGT.....L...................
ENSDARP00000008672  ....................................TV........-.GDDRM.....A...................
ENSDARP00000094999  ....................................SG........-.DDKGK.....V...................
ENSDARP00000116849  ....................................IC........-.SEDGK.....V...................
ENSDARP00000104388  ....................................VG........-.ANKNK.....L...................
ENSDARP00000072504  ....................................--........-.-----.....-...................
ENSDARP00000052786  ....................................SV........-.GQDEPginplV...................
ENSDARP00000076812  ....................................VA........-.TADGF.....L...................
ENSDARP00000047833  ....................................VI........-.TYSGQ.....L...................
ENSDARP00000097904  ....................................ACgfssrglnGlSCDRF.....L...................
ENSDARP00000102548  ....................................VM........-.YTDG-.....A...................
ENSDARP00000082368  ....................................AA........-.SYGNT.....V...................
ENSDARP00000109749  ....................................CL........-.LQDGR.....L...................
ENSDARP00000110965  ....................................VG........-.LDDGS.....I...................
ENSDARP00000095605  ....................................AG........-.DMGGK.....V...................
ENSDARP00000091436  ....................................AV........-.--DSY.....Iyfanirpdykwgycsntvv
ENSDARP00000111846  ....................................VA........-.SAGG-.....V...................
ENSDARP00000090283  ....................................--........-.-----.....-...................
ENSDARP00000008223  ....................................TN........-.SGDYE.....I...................
ENSDARP00000005398  ....................................ST........-.GLSRR.....V...................
ENSDARP00000020383  ....................................AV........-.GAEGW.....F...................
ENSDARP00000114287  ....................................AS........-.GSNLM.....L...................
ENSDARP00000101793  ....................................--........-.DSHGQ.....V...................
ENSDARP00000059751  ....................................--........-.-----.....I...................
ENSDARP00000117166  ....................................VC........N.DSGGS.....V...................
ENSDARP00000046545  ....................................VC........-.SSSSV.....V...................
ENSDARP00000060999  ....................................YA........-.LANGT.....V...................
ENSDARP00000084929  ....................................--........-.GNKNK.....I...................
ENSDARP00000104754  ....................................TS........-.SRDKK.....V...................
ENSDARP00000111156  ....................................IG........-.TKEHI.....A...................
ENSDARP00000112085  ....................................--........-.-----.....-...................
ENSDARP00000100913  ....................................WA........-.SSGGQ.....I...................
ENSDARP00000003198  ....................................SG........-.DSVGM.....V...................
ENSDARP00000027152  ....................................LG........-.NCNG-.....L...................
ENSDARP00000106476  ....................................TA........-.TEEQE.....V...................
ENSDARP00000104791  ....................................SN........-.SGDYE.....I...................
ENSDARP00000109373  ....................................--........-.CLDDT.....V...................
ENSDARP00000092538  ....................................--........-.-----.....-...................
ENSDARP00000098142  ....................................VA........-.LADGT.....L...................
ENSDARP00000044811  ....................................TL........-.SLDKS.....V...................
ENSDARP00000024810  ....................................FG........-.TSHG-.....F...................
ENSDARP00000075280  ....................................SL........G.GKDTC.....I...................
ENSDARP00000076048  ....................................SG........-.SGDST.....A...................
ENSDARP00000089501  ....................................--........-.-----.....-...................
ENSDARP00000107630  ....................................GL........-.TECKT.....L...................
ENSDARP00000092069  ....................................WC........-.-----.....L...................
ENSDARP00000018100  ....................................--........-.-----.....Lietdhnayteatkaqrkqq
ENSDARP00000108631  ....................................--........-.-----.....Lietdhnayteatkaqrkqq
ENSDARP00000111537  ....................................VV........-.LNQK-.....-...................
ENSDARP00000035593  ....................................--........-.-----.....-...................
ENSDARP00000109913  ....................................--........-.-----.....-...................
ENSDARP00000103234  ....................................--........-.-----.....-...................
ENSDARP00000026432  ....................................VC........G.LKDCH.....V...................
ENSDARP00000078268  ....................................CA........-.-----.....S...................
ENSDARP00000078255  ....................................CV........-.QEDGT.....V...................
ENSDARP00000102911  ....................................SG........-.SEQQN.....L...................
ENSDARP00000032159  ....................................VT........-.HSSRA.....V...................
ENSDARP00000079570  ....................................--........-.-----.....-...................
ENSDARP00000007708  ....................................--........-.--DND.....I...................


                                                                                                    
                                                                                                    
d1pgua1               ..............................................................................
ENSDARP00000017859  ..............................................................................
ENSDARP00000039257  ..............................................................................
ENSDARP00000042217  ..............................................................................
ENSDARP00000080947  ..............................................................................
ENSDARP00000026057  ..............................................................................
ENSDARP00000116595  ..............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  ..............................................................................
ENSDARP00000088166  ..............................................................................
ENSDARP00000103157  ..............................................................................
ENSDARP00000111963  ..............................................................................
ENSDARP00000018443  ..............................................................................
ENSDARP00000079424  ..............................................................................
ENSDARP00000015825  ..............................................................................
ENSDARP00000024623  ..............................................................................
ENSDARP00000051230  ..............................................................................
ENSDARP00000044330  ..............................................................................
ENSDARP00000079567  ..............................................................................
ENSDARP00000017443  ..............................................................................
ENSDARP00000107302  ..............................................................................
ENSDARP00000005843  ..............................................................................
ENSDARP00000104051  ..............................................................................
ENSDARP00000061000  ..............................................................................
ENSDARP00000017497  ..............................................................................
ENSDARP00000011435  ..............................................................................
ENSDARP00000072190  ..............................................................................
ENSDARP00000037531  ..............................................................................
ENSDARP00000038258  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000060977  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000060431  ..............................................................................
ENSDARP00000027484  ..............................................................................
ENSDARP00000076693  ..............................................................................
ENSDARP00000089117  ..............................................................................
ENSDARP00000079014  ..............................................................................
ENSDARP00000122900  ..............................................................................
ENSDARP00000106094  ..............................................................................
ENSDARP00000105402  ..............................................................................
ENSDARP00000107355  ..............................................................................
ENSDARP00000099894  ..............................................................................
ENSDARP00000114236  ..............................................................................
ENSDARP00000068184  ..............................................................................
ENSDARP00000024391  ..............................................................................
ENSDARP00000096338  ..............................................................................
ENSDARP00000117865  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000109528  ..............................................................................
ENSDARP00000110967  ..............................................................................
ENSDARP00000097371  ..............................................................................
ENSDARP00000068663  ..............................................................................
ENSDARP00000096387  ..............................................................................
ENSDARP00000073472  ..............................................................................
ENSDARP00000056247  ..............................................................................
ENSDARP00000045014  ..............................................................................
ENSDARP00000090792  ..............................................................................
ENSDARP00000019743  ..............................................................................
ENSDARP00000028733  ..............................................................................
ENSDARP00000104487  ..............................................................................
ENSDARP00000079959  ..............................................................................
ENSDARP00000065646  ..............................................................................
ENSDARP00000005989  ..............................................................................
ENSDARP00000062413  ..............................................................................
ENSDARP00000003004  ..............................................................................
ENSDARP00000024168  ..............................................................................
ENSDARP00000077651  ..............................................................................
ENSDARP00000124018  ..............................................................................
ENSDARP00000068125  ..............................................................................
ENSDARP00000084377  ..............................................................................
ENSDARP00000109369  ..............................................................................
ENSDARP00000004327  ..............................................................................
ENSDARP00000112164  ..............................................................................
ENSDARP00000109556  ..............................................................................
ENSDARP00000036145  ..............................................................................
ENSDARP00000101521  ..............................................................................
ENSDARP00000101197  ..............................................................................
ENSDARP00000065847  ..............................................................................
ENSDARP00000099567  ..............................................................................
ENSDARP00000038520  ..............................................................................
ENSDARP00000106434  ..............................................................................
ENSDARP00000033992  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000105555  ..............................................................................
ENSDARP00000087578  ..............................................................................
ENSDARP00000076761  ..............................................................................
ENSDARP00000119160  ..............................................................................
ENSDARP00000099166  ..............................................................................
ENSDARP00000079110  ..............................................................................
ENSDARP00000028109  ..............................................................................
ENSDARP00000017792  ..............................................................................
ENSDARP00000091471  ..............................................................................
ENSDARP00000015105  ..............................................................................
ENSDARP00000005640  ..............................................................................
ENSDARP00000112282  ..............................................................................
ENSDARP00000010862  ..............................................................................
ENSDARP00000112131  ..............................................................................
ENSDARP00000117542  ..............................................................................
ENSDARP00000027560  ..............................................................................
ENSDARP00000110861  ..............................................................................
ENSDARP00000102565  ..............................................................................
ENSDARP00000093657  ..............................................................................
ENSDARP00000008451  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000101565  ..............................................................................
ENSDARP00000111921  ..............................................................................
ENSDARP00000018714  ..............................................................................
ENSDARP00000097750  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000065337  ..............................................................................
ENSDARP00000016280  ..............................................................................
ENSDARP00000071264  ..............................................................................
ENSDARP00000073678  ..............................................................................
ENSDARP00000070393  ..............................................................................
ENSDARP00000100903  ..............................................................................
ENSDARP00000099551  ..............................................................................
ENSDARP00000063641  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000014740  ..............................................................................
ENSDARP00000106749  ..............................................................................
ENSDARP00000003237  ..............................................................................
ENSDARP00000115064  ..............................................................................
ENSDARP00000071531  ..............................................................................
ENSDARP00000105980  ..............................................................................
ENSDARP00000113946  ..............................................................................
ENSDARP00000079302  ..............................................................................
ENSDARP00000111824  ..............................................................................
ENSDARP00000008006  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104171  ..............................................................................
ENSDARP00000052711  ..............................................................................
ENSDARP00000059208  ..............................................................................
ENSDARP00000006309  ..............................................................................
ENSDARP00000102210  ..............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000031340  ..............................................................................
ENSDARP00000059344  ..............................................................................
ENSDARP00000074880  ..............................................................................
ENSDARP00000026454  ..............................................................................
ENSDARP00000099918  ..............................................................................
ENSDARP00000121552  ..............................................................................
ENSDARP00000007696  ..............................................................................
ENSDARP00000080844  ..............................................................................
ENSDARP00000071301  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000106510  ..............................................................................
ENSDARP00000037121  ..............................................................................
ENSDARP00000124137  ..............................................................................
ENSDARP00000039795  ..............................................................................
ENSDARP00000079663  ..............................................................................
ENSDARP00000056762  ..............................................................................
ENSDARP00000024476  ..............................................................................
ENSDARP00000126101  ..............................................................................
ENSDARP00000087003  ..............................................................................
ENSDARP00000065205  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000059666  ..............................................................................
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000078191  ..............................................................................
ENSDARP00000078965  ..............................................................................
ENSDARP00000102373  ..............................................................................
ENSDARP00000006117  ..............................................................................
ENSDARP00000111140  ..............................................................................
ENSDARP00000094274  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000106181  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000102443  ..............................................................................
ENSDARP00000038921  ..............................................................................
ENSDARP00000033554  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000014182  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000108102  ..............................................................................
ENSDARP00000107806  ..............................................................................
ENSDARP00000007602  ..............................................................................
ENSDARP00000021430  ..............................................................................
ENSDARP00000087525  ..............................................................................
ENSDARP00000054317  ..............................................................................
ENSDARP00000110907  ..............................................................................
ENSDARP00000074797  ..............................................................................
ENSDARP00000047739  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000055337  ..............................................................................
ENSDARP00000058220  ..............................................................................
ENSDARP00000102332  ..............................................................................
ENSDARP00000003173  ..............................................................................
ENSDARP00000064438  ..............................................................................
ENSDARP00000099721  ..............................................................................
ENSDARP00000026825  ..............................................................................
ENSDARP00000100187  ..............................................................................
ENSDARP00000059532  ..............................................................................
ENSDARP00000099725  ..............................................................................
ENSDARP00000084300  ..............................................................................
ENSDARP00000124280  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000110672  ..............................................................................
ENSDARP00000060454  ..............................................................................
ENSDARP00000098826  ..............................................................................
ENSDARP00000091438  ..............................................................................
ENSDARP00000098798  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000086480  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000061333  ..............................................................................
ENSDARP00000037790  ..............................................................................
ENSDARP00000032005  ..............................................................................
ENSDARP00000008668  ..............................................................................
ENSDARP00000103874  ..............................................................................
ENSDARP00000043116  ..............................................................................
ENSDARP00000063737  ..............................................................................
ENSDARP00000106107  ..............................................................................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000003197  ..............................................................................
ENSDARP00000012553  ..............................................................................
ENSDARP00000003663  ..............................................................................
ENSDARP00000069897  ..............................................................................
ENSDARP00000018434  ..............................................................................
ENSDARP00000093342  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000041156  ..............................................................................
ENSDARP00000108156  ..............................................................................
ENSDARP00000070070  ..............................................................................
ENSDARP00000018924  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000109363  ..............................................................................
ENSDARP00000103752  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000101492  ..............................................................................
ENSDARP00000038543  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000083528  ..............................................................................
ENSDARP00000017678  ..............................................................................
ENSDARP00000097777  ..............................................................................
ENSDARP00000109722  ..............................................................................
ENSDARP00000083772  ..............................................................................
ENSDARP00000065266  ..............................................................................
ENSDARP00000088806  ..............................................................................
ENSDARP00000109028  ..............................................................................
ENSDARP00000095457  ..............................................................................
ENSDARP00000086448  ..............................................................................
ENSDARP00000117869  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000086251  ..............................................................................
ENSDARP00000054352  ..............................................................................
ENSDARP00000024810  ..............................................................................
ENSDARP00000100292  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000009095  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000118167  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000050905  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000032408  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000101882  ..............................................................................
ENSDARP00000093519  ..............................................................................
ENSDARP00000112439  ..............................................................................
ENSDARP00000071650  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000111616  ..............................................................................
ENSDARP00000019506  ..............................................................................
ENSDARP00000076262  ..............................................................................
ENSDARP00000080599  ..............................................................................
ENSDARP00000084220  ..............................................................................
ENSDARP00000080965  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000018692  ..............................................................................
ENSDARP00000008672  ..............................................................................
ENSDARP00000094999  ..............................................................................
ENSDARP00000116849  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000072504  ..............................................................................
ENSDARP00000052786  ..............................................................................
ENSDARP00000076812  ..............................................................................
ENSDARP00000047833  ..............................................................................
ENSDARP00000097904  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000082368  ..............................................................................
ENSDARP00000109749  ..............................................................................
ENSDARP00000110965  ..............................................................................
ENSDARP00000095605  ..............................................................................
ENSDARP00000091436  yaytrpdrleysvvfwdtknnerfvkyvkslmsittcgdfcilatkaddthpqedteaeagsamafnelsnqntskdr
ENSDARP00000111846  ..............................................................................
ENSDARP00000090283  ..............................................................................
ENSDARP00000008223  ..............................................................................
ENSDARP00000005398  ..............................................................................
ENSDARP00000020383  ..............................................................................
ENSDARP00000114287  ..............................................................................
ENSDARP00000101793  ..............................................................................
ENSDARP00000059751  ..............................................................................
ENSDARP00000117166  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000060999  ..............................................................................
ENSDARP00000084929  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000111156  ..............................................................................
ENSDARP00000112085  ..............................................................................
ENSDARP00000100913  ..............................................................................
ENSDARP00000003198  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000106476  ..............................................................................
ENSDARP00000104791  ..............................................................................
ENSDARP00000109373  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000098142  ..............................................................................
ENSDARP00000044811  ..............................................................................
ENSDARP00000024810  ..............................................................................
ENSDARP00000075280  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000107630  ..............................................................................
ENSDARP00000092069  ..............................................................................
ENSDARP00000018100  maeemveaagederelaaemaaaflnenlpeaifgapkagsgqwaslvrlinpiqgntldlvqleqneaafsvaicrf
ENSDARP00000108631  maeemveaagederelaaemaaaflnenlpeaifgapkagsgqwaslvrlinpiqgntldlvqleqneaafsvaicrf
ENSDARP00000111537  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000109913  ..............................................................................
ENSDARP00000103234  ..............................................................................
ENSDARP00000026432  ..............................................................................
ENSDARP00000078268  ..............................................................................
ENSDARP00000078255  ..............................................................................
ENSDARP00000102911  ..............................................................................
ENSDARP00000032159  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000007708  ..............................................................................


                                                                                                    
                                                                                                    
d1pgua1               .........................................................................VFI..
ENSDARP00000017859  .........................................................................RIW..
ENSDARP00000039257  .........................................................................KMW..
ENSDARP00000042217  .........................................................................KMW..
ENSDARP00000080947  .........................................................................RVW..
ENSDARP00000026057  .........................................................................KVW..
ENSDARP00000116595  .........................................................................KLW..
ENSDARP00000074155  .........................................................................RIW..
ENSDARP00000038728  .........................................................................KLW..
ENSDARP00000088166  .........................................................................RLW..
ENSDARP00000103157  .........................................................................RLW..
ENSDARP00000111963  .........................................................................ALW..
ENSDARP00000018443  .........................................................................ALW..
ENSDARP00000079424  .........................................................................ALW..
ENSDARP00000015825  .........................................................................RLW..
ENSDARP00000024623  .........................................................................KLW..
ENSDARP00000051230  .........................................................................ALW..
ENSDARP00000044330  .........................................................................RVF..
ENSDARP00000079567  .........................................................................IIW..
ENSDARP00000017443  .........................................................................VLW..
ENSDARP00000107302  .........................................................................RVW..
ENSDARP00000005843  .........................................................................ALW..
ENSDARP00000104051  .........................................................................KVW..
ENSDARP00000061000  .........................................................................KLW..
ENSDARP00000017497  .........................................................................AVW..
ENSDARP00000011435  .........................................................................ALW..
ENSDARP00000072190  .........................................................................ALW..
ENSDARP00000037531  .........................................................................AVW..
ENSDARP00000038258  .........................................................................RLW..
ENSDARP00000076048  .........................................................................HVC..
ENSDARP00000060977  .........................................................................RCW..
ENSDARP00000079570  .........................................................................HVC..
ENSDARP00000060431  .........................................................................VQW..
ENSDARP00000027484  .........................................................................RIW..
ENSDARP00000076693  .........................................................................WIW..
ENSDARP00000089117  .........................................................................RIH..
ENSDARP00000079014  .........................................................................KVW..
ENSDARP00000122900  .........................................................................CFW..
ENSDARP00000106094  .........................................................................ALW..
ENSDARP00000105402  .........................................................................ALW..
ENSDARP00000107355  .........................................................................RIW..
ENSDARP00000099894  .........................................................................CFW..
ENSDARP00000114236  .........................................................................CFW..
ENSDARP00000068184  .........................................................................RIH..
ENSDARP00000024391  .........................................................................RIY..
ENSDARP00000096338  .........................................................................VVW..
ENSDARP00000117865  .........................................................................VVW..
ENSDARP00000105810  .........................................................................KLW..
ENSDARP00000109528  .........................................................................KLW..
ENSDARP00000110967  .........................................................................RIW..
ENSDARP00000097371  .........................................................................AFS..
ENSDARP00000068663  .........................................................................KVW..
ENSDARP00000096387  .........................................................................FLW..
ENSDARP00000073472  .........................................................................TFI..
ENSDARP00000056247  .........................................................................FLW..
ENSDARP00000045014  .........................................................................ALW..
ENSDARP00000090792  .........................................................................AVW..
ENSDARP00000019743  .........................................................................AVW..
ENSDARP00000028733  .........................................................................LQR..
ENSDARP00000104487  .........................................................................KLW..
ENSDARP00000079959  .........................................................................RLW..
ENSDARP00000065646  .........................................................................KVW..
ENSDARP00000005989  .........................................................................RVW..
ENSDARP00000062413  .........................................................................KVW..
ENSDARP00000003004  .........................................................................LQR..
ENSDARP00000024168  .........................................................................RLW..
ENSDARP00000077651  .........................................................................YTT..
ENSDARP00000124018  .........................................................................RVW..
ENSDARP00000068125  .........................................................................KVW..
ENSDARP00000084377  .........................................................................YQC..
ENSDARP00000109369  .........................................................................YTT..
ENSDARP00000004327  .........................................................................KIW..
ENSDARP00000112164  .........................................................................KVW..
ENSDARP00000109556  .........................................................................RLY..
ENSDARP00000036145  .........................................................................YQC..
ENSDARP00000101521  .........................................................................CLW..
ENSDARP00000101197  .........................................................................KLW..
ENSDARP00000065847  .........................................................................LIW..
ENSDARP00000099567  .........................................................................RQY..
ENSDARP00000038520  .........................................................................SVC..
ENSDARP00000106434  .........................................................................RVW..
ENSDARP00000033992  .........................................................................MIW..
ENSDARP00000060548  .........................................................................RVW..
ENSDARP00000105555  .........................................................................KVW..
ENSDARP00000087578  .........................................................................LIH..
ENSDARP00000076761  .........................................................................RLW..
ENSDARP00000119160  .........................................................................VIW..
ENSDARP00000099166  .........................................................................NLY..
ENSDARP00000079110  .........................................................................RLW..
ENSDARP00000028109  .........................................................................DIW..
ENSDARP00000017792  .........................................................................NYY..
ENSDARP00000091471  .........................................................................KVW..
ENSDARP00000015105  .........................................................................KFW..
ENSDARP00000005640  .........................................................................YVW..
ENSDARP00000112282  .........................................................................RMW..
ENSDARP00000010862  .........................................................................ALW..
ENSDARP00000112131  .........................................................................MIW..
ENSDARP00000117542  .........................................................................MIW..
ENSDARP00000027560  .........................................................................YVF..
ENSDARP00000110861  .........................................................................NIF..
ENSDARP00000102565  .........................................................................ITL..
ENSDARP00000093657  .........................................................................YVW..
ENSDARP00000008451  .........................................................................KCF..
ENSDARP00000110420  .........................................................................HIL..
ENSDARP00000101565  .........................................................................AVF..
ENSDARP00000111921  .........................................................................RLW..
ENSDARP00000018714  .........................................................................KVW..
ENSDARP00000097750  .........................................................................RWF..
ENSDARP00000105810  .........................................................................KVW..
ENSDARP00000065337  .........................................................................CVW..
ENSDARP00000016280  .........................................................................ILH..
ENSDARP00000071264  .........................................................................KLW..
ENSDARP00000073678  .........................................................................IMW..
ENSDARP00000070393  .........................................................................FGI..
ENSDARP00000100903  .........................................................................VIW..
ENSDARP00000099551  .........................................................................MVW..
ENSDARP00000063641  .........................................................................VIW..
ENSDARP00000104754  .........................................................................ILW..
ENSDARP00000014740  .........................................................................RVW..
ENSDARP00000106749  .........................................................................KIW..
ENSDARP00000003237  .........................................................................ILY..
ENSDARP00000115064  .........................................................................KMV..
ENSDARP00000071531  .........................................................................SVL..
ENSDARP00000105980  .........................................................................RVF..
ENSDARP00000113946  .........................................................................SIY..
ENSDARP00000079302  .........................................................................ILH..
ENSDARP00000111824  .........................................................................RIW..
ENSDARP00000008006  .........................................................................YIW..
ENSDARP00000079585  .........................................................................KFWal
ENSDARP00000104171  .........................................................................YIW..
ENSDARP00000052711  .........................................................................SVV..
ENSDARP00000059208  .........................................................................TWH..
ENSDARP00000006309  .........................................................................SWM..
ENSDARP00000102210  .........................................................................VFW..
ENSDARP00000124457  .........................................................................AEW..
ENSDARP00000010071  .........................................................................KVW..
ENSDARP00000092538  .........................................................................HIV..
ENSDARP00000031340  .........................................................................RIW..
ENSDARP00000059344  .........................................................................KLW..
ENSDARP00000074880  .........................................................................VSW..
ENSDARP00000026454  .........................................................................IIW..
ENSDARP00000099918  .........................................................................QLW..
ENSDARP00000121552  .........................................................................VSW..
ENSDARP00000007696  .........................................................................CVW..
ENSDARP00000080844  .........................................................................CSW..
ENSDARP00000071301  .........................................................................ILW..
ENSDARP00000079585  .........................................................................RIW..
ENSDARP00000106510  .........................................................................YVL..
ENSDARP00000037121  .........................................................................CSW..
ENSDARP00000124137  .........................................................................CLW..
ENSDARP00000039795  .........................................................................IIW..
ENSDARP00000079663  .........................................................................VGW..
ENSDARP00000056762  .........................................................................KIW..
ENSDARP00000024476  .........................................................................LLW..
ENSDARP00000126101  .........................................................................LLW..
ENSDARP00000087003  .........................................................................CSW..
ENSDARP00000065205  .........................................................................SKWih
ENSDARP00000110420  .........................................................................NVW..
ENSDARP00000059666  .........................................................................RLW..
ENSDARP00000101126  .........................................................................RII..
ENSDARP00000060548  .........................................................................VVW..
ENSDARP00000078100  .........................................................................KVW..
ENSDARP00000078191  .........................................................................RIW..
ENSDARP00000078965  .........................................................................LIW..
ENSDARP00000102373  .........................................................................NLW..
ENSDARP00000006117  .........................................................................LFW..
ENSDARP00000111140  .........................................................................RLW..
ENSDARP00000094274  .........................................................................QVW..
ENSDARP00000075344  .........................................................................NIY..
ENSDARP00000106181  .........................................................................YIW..
ENSDARP00000089501  .........................................................................HIV..
ENSDARP00000102443  .........................................................................NLW..
ENSDARP00000038921  .........................................................................RLW..
ENSDARP00000033554  .........................................................................NLW..
ENSDARP00000100360  .........................................................................RIW..
ENSDARP00000014182  .........................................................................MVW..
ENSDARP00000027152  .........................................................................HIV..
ENSDARP00000108102  .........................................................................IIW..
ENSDARP00000107806  .........................................................................SLW..
ENSDARP00000007602  .........................................................................NLW..
ENSDARP00000021430  .........................................................................AYW..
ENSDARP00000087525  .........................................................................LMW..
ENSDARP00000054317  .........................................................................KVW..
ENSDARP00000110907  .........................................................................CLW..
ENSDARP00000074797  .........................................................................LLW..
ENSDARP00000047739  .........................................................................ITW..
ENSDARP00000079585  .........................................................................IVL..
ENSDARP00000055337  .........................................................................SAW..
ENSDARP00000058220  .........................................................................TIW..
ENSDARP00000102332  .........................................................................RLW..
ENSDARP00000003173  .........................................................................RIY..
ENSDARP00000064438  .........................................................................ILY..
ENSDARP00000099721  .........................................................................NLW..
ENSDARP00000026825  .........................................................................NMW..
ENSDARP00000100187  .........................................................................HLW..
ENSDARP00000059532  .........................................................................IVY..
ENSDARP00000099725  .........................................................................HLM..
ENSDARP00000084300  .........................................................................NLW..
ENSDARP00000124280  .........................................................................FMW..
ENSDARP00000100360  .........................................................................IIL..
ENSDARP00000110672  .........................................................................QVW..
ENSDARP00000060454  .........................................................................RVF..
ENSDARP00000098826  .........................................................................RVF..
ENSDARP00000091438  .........................................................................LLL..
ENSDARP00000098798  .........................................................................LIG..
ENSDARP00000091436  .........................................................................IVG..
ENSDARP00000086480  .........................................................................KVF..
ENSDARP00000099546  .........................................................................KAW..
ENSDARP00000061333  .........................................................................RQA..
ENSDARP00000037790  .........................................................................KVF..
ENSDARP00000032005  .........................................................................NLW..
ENSDARP00000008668  .........................................................................QLW..
ENSDARP00000103874  .........................................................................IIW..
ENSDARP00000043116  .........................................................................RIW..
ENSDARP00000063737  .........................................................................RGW..
ENSDARP00000106107  .........................................................................QVF..
ENSDARP00000101619  .........................................................................YIW..
ENSDARP00000025827  .........................................................................IIH..
ENSDARP00000100360  .........................................................................YVW..
ENSDARP00000003197  .........................................................................LVH..
ENSDARP00000012553  .........................................................................MVW..
ENSDARP00000003663  .........................................................................RVF..
ENSDARP00000069897  .........................................................................VLL..
ENSDARP00000018434  .........................................................................RVW..
ENSDARP00000093342  .........................................................................LVH..
ENSDARP00000100360  .........................................................................MIW..
ENSDARP00000102548  .........................................................................VLW..
ENSDARP00000041156  .........................................................................LVH..
ENSDARP00000108156  .........................................................................YVY..
ENSDARP00000070070  .........................................................................RSM..
ENSDARP00000018924  .........................................................................FRL..
ENSDARP00000123525  .........................................................................QLW..
ENSDARP00000109363  .........................................................................VLF..
ENSDARP00000103752  .........................................................................VLF..
ENSDARP00000101029  .........................................................................TIM..
ENSDARP00000101492  .........................................................................QVY..
ENSDARP00000038543  .........................................................................IVH..
ENSDARP00000079585  .........................................................................HVW..
ENSDARP00000104754  .........................................................................KLW..
ENSDARP00000075344  .........................................................................KIF..
ENSDARP00000083528  .........................................................................KVW..
ENSDARP00000017678  .........................................................................AVF..
ENSDARP00000097777  .........................................................................ILW..
ENSDARP00000109722  .........................................................................AIF..
ENSDARP00000083772  .........................................................................KGW..
ENSDARP00000065266  .........................................................................RLW..
ENSDARP00000088806  .........................................................................HLW..
ENSDARP00000109028  .........................................................................IVW..
ENSDARP00000095457  .........................................................................HFW..
ENSDARP00000086448  .........................................................................HLW..
ENSDARP00000117869  .........................................................................VEY..
ENSDARP00000035593  .........................................................................FVV..
ENSDARP00000086251  .........................................................................LVG..
ENSDARP00000054352  .........................................................................TLY..
ENSDARP00000024810  .........................................................................HLW..
ENSDARP00000100292  .........................................................................IVW..
ENSDARP00000079585  .........................................................................TVW..
ENSDARP00000009095  .........................................................................KLW..
ENSDARP00000101029  .........................................................................SIW..
ENSDARP00000118167  .........................................................................LVG..
ENSDARP00000101029  .........................................................................VLW..
ENSDARP00000050905  .........................................................................FLW..
ENSDARP00000078100  .........................................................................LFY..
ENSDARP00000046545  .........................................................................AVW..
ENSDARP00000032408  .........................................................................QLT..
ENSDARP00000104388  .........................................................................SVW..
ENSDARP00000101882  .........................................................................IVW..
ENSDARP00000093519  .........................................................................CLW..
ENSDARP00000112439  .........................................................................KLT..
ENSDARP00000071650  .........................................................................SVWsg
ENSDARP00000099546  .........................................................................RKW..
ENSDARP00000111616  .........................................................................LFW..
ENSDARP00000019506  .........................................................................CVW..
ENSDARP00000076262  .........................................................................KTW..
ENSDARP00000080599  .........................................................................YYI..
ENSDARP00000084220  .........................................................................KFW..
ENSDARP00000080965  .........................................................................YYI..
ENSDARP00000123525  .........................................................................LCV..
ENSDARP00000018692  .........................................................................VIY..
ENSDARP00000008672  .........................................................................KMW..
ENSDARP00000094999  .........................................................................VYS..
ENSDARP00000116849  .........................................................................QVF..
ENSDARP00000104388  .........................................................................LAV..
ENSDARP00000072504  .........................................................................---..
ENSDARP00000052786  .........................................................................KVW..
ENSDARP00000076812  .........................................................................HML..
ENSDARP00000047833  .........................................................................KSY..
ENSDARP00000097904  .........................................................................MVY..
ENSDARP00000102548  .........................................................................EVW..
ENSDARP00000082368  .........................................................................CIF..
ENSDARP00000109749  .........................................................................LLW..
ENSDARP00000110965  .........................................................................LVY..
ENSDARP00000095605  .........................................................................SCV..
ENSDARP00000091436  skrrkyvlvlcnsigtpqdskyididplfvtmtkthviaasreafyiwqyrvakkltaleinqvtktrkegreRVY..
ENSDARP00000111846  .........................................................................QLW..
ENSDARP00000090283  .........................................................................---..
ENSDARP00000008223  .........................................................................LYW..
ENSDARP00000005398  .........................................................................IVT..
ENSDARP00000020383  .........................................................................HLF..
ENSDARP00000114287  .........................................................................YLY..
ENSDARP00000101793  .........................................................................EIF..
ENSDARP00000059751  .........................................................................HII..
ENSDARP00000117166  .........................................................................FEL..
ENSDARP00000046545  .........................................................................ILSeh
ENSDARP00000060999  .........................................................................GVY..
ENSDARP00000084929  .........................................................................HVI..
ENSDARP00000104754  .........................................................................IIWgh
ENSDARP00000111156  .........................................................................HIY..
ENSDARP00000112085  .........................................................................---..
ENSDARP00000100913  .........................................................................FII..
ENSDARP00000003198  .........................................................................KMW..
ENSDARP00000027152  .........................................................................AVV..
ENSDARP00000106476  .........................................................................LIY..
ENSDARP00000104791  .........................................................................LYWip
ENSDARP00000109373  .........................................................................LVL..
ENSDARP00000092538  .........................................................................---..
ENSDARP00000098142  .........................................................................AIF..
ENSDARP00000044811  .........................................................................WSF..
ENSDARP00000024810  .........................................................................GLF..
ENSDARP00000075280  .........................................................................LQW..
ENSDARP00000076048  .........................................................................RIW..
ENSDARP00000089501  .........................................................................---..
ENSDARP00000107630  .........................................................................LIW..
ENSDARP00000092069  .........................................................................LLI..
ENSDARP00000018100  ............................................lnggddwyvlvgvardmilnprsvgggyiYTY..
ENSDARP00000108631  ............................................lnggddwyvlvgvardmilnprsvgggyiYTY..
ENSDARP00000111537  .........................................................................---..
ENSDARP00000035593  .........................................................................---..
ENSDARP00000109913  .........................................................................---..
ENSDARP00000103234  .........................................................................-VY..
ENSDARP00000026432  .........................................................................LTF..
ENSDARP00000078268  .........................................................................YIY..
ENSDARP00000078255  .........................................................................LVY..
ENSDARP00000102911  .........................................................................TGT..
ENSDARP00000032159  .........................................................................TVY..
ENSDARP00000079570  .........................................................................---..
ENSDARP00000007708  .........................................................................FMW..


                                                                                         150        
                                                                                           |        
d1pgua1               .......................................SWD.........................SGNSLGEV...
ENSDARP00000017859  .......................................DVK.........................TGKCLKTL...
ENSDARP00000039257  .......................................EVA.........................TGYCVKTF...
ENSDARP00000042217  .......................................EVA.........................TGYCVKTF...
ENSDARP00000080947  .......................................DIE.........................TGQCLHVL...
ENSDARP00000026057  .......................................GVE.........................RKKFLYSL...
ENSDARP00000116595  .......................................DVE.........................SGEEVSTL...
ENSDARP00000074155  .......................................DTV.........................LGHYDKIL...
ENSDARP00000038728  .......................................DIR.........................KKASVHTF...
ENSDARP00000088166  .......................................DLE.........................VQEEILHQ...
ENSDARP00000103157  .......................................DLE.........................VQEEILHQ...
ENSDARP00000111963  .......................................DIE.........................TGQQTTTF...
ENSDARP00000018443  .......................................DIE.........................TGQQTTTF...
ENSDARP00000079424  .......................................DIE.........................TGQQTTTF...
ENSDARP00000015825  .......................................ATD.........................HYQPLRIF...
ENSDARP00000024623  .......................................DVR.........................RKGCVFRY...
ENSDARP00000051230  .......................................DIE.........................TGQQTTLF...
ENSDARP00000044330  .......................................NYN.........................TLERVHMF...
ENSDARP00000079567  .......................................DAH.........................TGEAKQQF...
ENSDARP00000017443  .......................................DIE.........................TGSQKTVF...
ENSDARP00000107302  .......................................DIR.........................TKANVHTL...
ENSDARP00000005843  .......................................DLE.........................TGKQKTVF...
ENSDARP00000104051  .......................................DLN.........................SERCRCTL...
ENSDARP00000061000  .......................................NT-.........................LGVCKYTI...
ENSDARP00000017497  .......................................DMAspt......................DISLRRVL...
ENSDARP00000011435  .......................................DVE.........................SGQMLQSF...
ENSDARP00000072190  .......................................DVE.........................SGQLLQSF...
ENSDARP00000037531  .......................................DMAsat......................DISLRRVL...
ENSDARP00000038258  .......................................SFA.........................RTYPLRLY...
ENSDARP00000076048  .......................................KLG.........................QDRPIKTF...
ENSDARP00000060977  .......................................DTRsr.......................RMEPIQIL...
ENSDARP00000079570  .......................................RLG.........................SERPLKTF...
ENSDARP00000060431  .......................................DIR.........................SGEVVQEY...
ENSDARP00000027484  .......................................DFL.........................RCHEERIL...
ENSDARP00000076693  .......................................EVDeed......................EYECLSVV...
ENSDARP00000089117  .......................................GLK.........................SGKCLKEF...
ENSDARP00000079014  .......................................DIVgt.......................ELKLKKEL...
ENSDARP00000122900  .......................................QWDartlkf...................GQRPSKFI...
ENSDARP00000106094  .......................................DFT.........................SRTLRRTG...
ENSDARP00000105402  .......................................DFT.........................SRTLRRTG...
ENSDARP00000107355  .......................................NWQ.........................SRTCVCVL...
ENSDARP00000099894  .......................................QWDvnnnefs..................DRQHKFTE...
ENSDARP00000114236  .......................................QWN.........................SFSMKFVD...
ENSDARP00000068184  .......................................GLK.........................SGKCLKEF...
ENSDARP00000024391  .......................................DLS.........................KPEAEPQE...
ENSDARP00000096338  .......................................DLH.........................NQTLVRQF...
ENSDARP00000117865  .......................................DLH.........................NQTLVRQF...
ENSDARP00000105810  .......................................NPN.........................KKTSQNTM...
ENSDARP00000109528  .......................................DLR.........................SKVCSMKT...
ENSDARP00000110967  .......................................DPHn........................SSPCVSVF...
ENSDARP00000097371  .......................................DIQ.........................TGRVLTKV...
ENSDARP00000068663  .......................................DLPettgaegvm................MMKARSTE...
ENSDARP00000096387  .......................................DVNtltaltasn................NTVTTSSL...
ENSDARP00000073472  .......................................DAK.........................THRPRAEE...
ENSDARP00000056247  .......................................DVNtltaltasn................NTVTTSSL...
ENSDARP00000045014  .......................................DIE.........................TGQQTTSF...
ENSDARP00000090792  .......................................DLH.........................NQTLVRQF...
ENSDARP00000019743  .......................................DLH.........................NQTLVRQF...
ENSDARP00000028733  .......................................DVRt........................PPPVERRL...
ENSDARP00000104487  .......................................DPQe........................KIPCLSTF...
ENSDARP00000079959  .......................................SAAd........................TEPAIACF...
ENSDARP00000065646  .......................................SVD.........................ENAYVETL...
ENSDARP00000005989  .......................................DLKd........................DGNMVKVL...
ENSDARP00000062413  .......................................DPV.........................QCQLVNSL...
ENSDARP00000003004  .......................................DIRtp.......................PLQSERRL...
ENSDARP00000024168  .......................................DLR.........................SPNCQGLM...
ENSDARP00000077651  .......................................DCQ.........................RGQGLHAL...
ENSDARP00000124018  .......................................NVDvqdv.....................NGQLLQEF...
ENSDARP00000068125  .......................................ECVaadissnkrt...............QFDPLAEF...
ENSDARP00000084377  .......................................DL-.........................DGNLLDSW...
ENSDARP00000109369  .......................................DCQ.........................RGQGLHAL...
ENSDARP00000004327  .......................................SAVpteeedeieepnrprkkqkteqmglTRTPLMTL...
ENSDARP00000112164  .......................................NLQ.........................TGKCVENL...
ENSDARP00000109556  .......................................DVN.........................TFQCFVSC...
ENSDARP00000036145  .......................................DL-.........................DGNLLESW...
ENSDARP00000101521  .......................................DIE.........................SGECLQRN...
ENSDARP00000101197  .......................................STN.........................LDNSVASI...
ENSDARP00000065847  .......................................SIQ.........................SGALLEEL...
ENSDARP00000099567  .......................................DLRessk.....................RSDVLIDL...
ENSDARP00000038520  .......................................YFEqdn......................DWWVCKHI...
ENSDARP00000106434  .......................................DVA.........................SAVELSSI...
ENSDARP00000033992  .......................................DTRcskkdgfyrqvkqisgahmkpe...R------Ftpq
ENSDARP00000060548  .......................................EIFqd.......................SYRLIETM...
ENSDARP00000105555  .......................................--L.........................GEKCMMTL...
ENSDARP00000087578  .......................................QVS.........................KRRTQNPF...
ENSDARP00000076761  .......................................DLK.........................QGTAIYVI...
ENSDARP00000119160  .......................................NARk........................FPEIVMTL...
ENSDARP00000099166  .......................................DVE.........................TSELVHTL...
ENSDARP00000079110  .......................................NIPdk.......................KVALWNEV...
ENSDARP00000028109  .......................................DEQ.........................RSSPVLSF...
ENSDARP00000017792  .......................................DLRdpqqie...................DNQPYISV...
ENSDARP00000091471  .......................................DAE.........................TLKPADEF...
ENSDARP00000015105  .......................................DTR.........................SPNPMMSL...
ENSDARP00000005640  .......................................SQK.........................DGVWKPTL...
ENSDARP00000112282  .......................................DLR.........................RFVSTGKL...
ENSDARP00000010862  .......................................DIE.........................TGQQTTTF...
ENSDARP00000112131  .......................................DTRsnn......................TSKPSHAV...
ENSDARP00000117542  .......................................DTRsnn......................TSKPSHSV...
ENSDARP00000027560  .......................................DRE.........................QNKRTLKI...
ENSDARP00000110861  .......................................GVE.........................SGKKEHSL...
ENSDARP00000102565  .......................................SLR.........................NNKQLDVF...
ENSDARP00000093657  .......................................TLK.........................DGVWKPTL...
ENSDARP00000008451  .......................................DLR.........................KKESVSTF...
ENSDARP00000110420  .......................................DADk........................EYSLLQTL...
ENSDARP00000101565  .......................................LWD.........................TGSSVGEIvgh
ENSDARP00000111921  .......................................DPR.........................TPCNAGTF...
ENSDARP00000018714  .......................................DMR.........................KGTSFMDL...
ENSDARP00000097750  .......................................DLRmktsctke.................DCKDDILI...
ENSDARP00000105810  .......................................DLT.........................RGQMLQDL...
ENSDARP00000065337  .......................................STK.........................KWECLKTI...
ENSDARP00000016280  .......................................SIT.........................TNLSSKPF...
ENSDARP00000071264  .......................................NFN.........................NGQCVKILsre
ENSDARP00000073678  .......................................DVN.........................KGQKMCIF...
ENSDARP00000070393  .......................................DLRldrp.....................ANKLVVVK...
ENSDARP00000100903  .......................................DL-.........................KGEVLATI...
ENSDARP00000099551  .......................................NMK.........................PQSRAYRF...
ENSDARP00000063641  .......................................DL-.........................KGEVLATI...
ENSDARP00000104754  .......................................GPEedsgmwv..................EMVRVGEV...
ENSDARP00000014740  .......................................DLR.........................RFVCTGKL...
ENSDARP00000106749  .......................................DLQ.........................RAACIQTI...
ENSDARP00000003237  .......................................DCR.........................SPDDSHRI...
ENSDARP00000115064  .......................................EVA.........................DSSQQKTL...
ENSDARP00000071531  .......................................TCSgdg......................HWDIKKIN...
ENSDARP00000105980  .......................................HTDrpgrdc...................EQRPTMVK...
ENSDARP00000113946  .......................................DTRa........................ANPLVKSL...
ENSDARP00000079302  .......................................DVE.........................RGETLNVF...
ENSDARP00000111824  .......................................DIRap.......................PNSMLSAN...
ENSDARP00000008006  .......................................DLN.........................NFSNPMTP...
ENSDARP00000079585  cgnaltpkrgifgktgdlqtilclatakeevtysgalngDIYvwk......................GLNLTRTI...
ENSDARP00000104171  .......................................DLN.........................NFSSPMTP...
ENSDARP00000052711  .......................................EMS.........................SWTQVCSL...
ENSDARP00000059208  .......................................CSE.........................SGQQLGTY...
ENSDARP00000006309  .......................................STQ.........................SGSMLGRH...
ENSDARP00000102210  .......................................DARmvq......................DRGPLGVY...
ENSDARP00000124457  .......................................DLK.........................TGKVCCKW...
ENSDARP00000010071  .......................................SLS.........................AGTCVNTL...
ENSDARP00000092538  .......................................NVEsftlsgytimw..............NKAIELSS...
ENSDARP00000031340  .......................................NTE.........................DGRCIREV...
ENSDARP00000059344  .......................................RLD.........................SERLQRAIrgs
ENSDARP00000074880  .......................................TLV.........................KHEIVFTD...
ENSDARP00000026454  .......................................NVG.........................TGESMITL...
ENSDARP00000099918  .......................................SLD.........................TFQRKRKL...
ENSDARP00000121552  .......................................TLG.........................KYELFSTN...
ENSDARP00000007696  .......................................DVG.........................TGELVYQL...
ENSDARP00000080844  .......................................SLDmlsqpqe..................SMELIYNK...
ENSDARP00000071301  .......................................NVA.........................RGEAVVRI...
ENSDARP00000079585  .......................................ELSa........................NHRMVAVR...
ENSDARP00000106510  .......................................DAE.........................TRDLIAIH...
ENSDARP00000037121  .......................................SLDmlsqpqe..................SMELVYNK...
ENSDARP00000124137  .......................................DTLiap......................SNSMIHSF...
ENSDARP00000039795  .......................................NVG.........................TGEALINL...
ENSDARP00000079663  .......................................DLR.........................SNSNAWTL...
ENSDARP00000056762  .......................................SK-.........................SGMLRSTL...
ENSDARP00000024476  .......................................DTKtv.......................KQQLQFAL...
ENSDARP00000126101  .......................................DTKtv.......................KQQLQFAL...
ENSDARP00000087003  .......................................SLDmlstpqd..................SLELVFKQ...
ENSDARP00000065205  ...........................yksmecvdlmklKIH.........................DLQWKRHI...
ENSDARP00000110420  .......................................AWK.........................KNVVVAAN...
ENSDARP00000059666  .......................................RNF.........................NHKKEYTY...
ENSDARP00000101126  .......................................DLQ.........................QEKVVRTL...
ENSDARP00000060548  .......................................NIE.........................SKEAICGS...
ENSDARP00000078100  .......................................DYQ.........................HKEAVCSR...
ENSDARP00000078191  .......................................DTE.........................REIKVQDI...
ENSDARP00000078965  .......................................NLE.........................IGEPVKMI...
ENSDARP00000102373  .......................................NLEvtdssfnmv................DMKPVNME...
ENSDARP00000006117  .......................................DIRnmseptkqlil..............DPAKSKNL...
ENSDARP00000111140  .......................................SLE.........................TGEQVKQL...
ENSDARP00000094274  .......................................SWS.........................SLENWLSV...
ENSDARP00000075344  .......................................STI.........................TFEEILNL...
ENSDARP00000106181  .......................................DTSd........................TRRPTVTL...
ENSDARP00000089501  .......................................NVEsftlsgyvimw..............NKAIELSS...
ENSDARP00000102443  .......................................NLEitnrsfniv................DIKPANME...
ENSDARP00000038921  .......................................SLE.........................TGEQVKQL...
ENSDARP00000033554  .......................................NLEitnrsfniv................DIKPANME...
ENSDARP00000100360  .......................................SLV.........................DHALIARC...
ENSDARP00000014182  .......................................KLDvpeqv....................IKNPVRSI...
ENSDARP00000027152  .......................................NIEsfilsgyvimw..............NKAIELST...
ENSDARP00000108102  .......................................NVG.........................TGEALITM...
ENSDARP00000107806  .......................................DPD.........................SGNRVQNI...
ENSDARP00000007602  .......................................HLEitdrsfniv................DIKPANME...
ENSDARP00000021430  .......................................DTR.........................KGSQPVEM...
ENSDARP00000087525  .......................................NLE.........................EGVAVKMI...
ENSDARP00000054317  .......................................DSRq........................KDTPVVNM...
ENSDARP00000110907  .......................................DTLvtp......................AYSLVHGF...
ENSDARP00000074797  .......................................TIDgseaklllssgyalvrqqmpq....SGAASKTR...
ENSDARP00000047739  .......................................DTNrfte.....................DGCPHKKF...
ENSDARP00000079585  .......................................LVN.........................SLTVWGKK...
ENSDARP00000055337  .......................................SWAelikkstkaaw..............TRKPNYET...
ENSDARP00000058220  .......................................GLEtgqvlgrvnlv..............SGHVKTQL...
ENSDARP00000102332  .......................................RVA.........................EGKKISEEtqe
ENSDARP00000003173  .......................................EAPdvmnls...................QWSLQHEI...
ENSDARP00000064438  .......................................KAD.........................QAEVTRVI...
ENSDARP00000099721  .......................................HLEitdrsfniv................DIKPANME...
ENSDARP00000026825  .......................................HLDitdrsfniv................DIKPANME...
ENSDARP00000100187  .......................................DQF.........................TGKNIRCN...
ENSDARP00000059532  .......................................DAN.........................NLSTVTMI...
ENSDARP00000099725  .......................................TTK.........................TREVVRSM...
ENSDARP00000084300  .......................................HLSitdrsfniv................DLKPENME...
ENSDARP00000124280  .......................................RLDs........................SDVPVIVI...
ENSDARP00000100360  .......................................LVT.........................SLKIWGKK...
ENSDARP00000110672  .......................................SWS.........................SLENWLSV...
ENSDARP00000060454  .......................................CFD.........................SAELHGTM...
ENSDARP00000098826  .......................................NFD.........................AVELHGTM...
ENSDARP00000091438  .......................................GL-.........................DGHEIFKE...
ENSDARP00000098798  .......................................FKEpl.......................ENGSVVVI...
ENSDARP00000091436  .......................................SV-.........................DGNRIWGK...
ENSDARP00000086480  .......................................DVV.........................NFDMINML...
ENSDARP00000099546  .......................................DLD.........................TAEPLFELtav
ENSDARP00000061333  .......................................NTK.........................TSKSSTIY...
ENSDARP00000037790  .......................................TFTh........................NPHQLHVF...
ENSDARP00000032005  .......................................HLDytdrsfniv................DIKPANME...
ENSDARP00000008668  .......................................NIK.........................SNKLLFTF...
ENSDARP00000103874  .......................................DLN.........................KLSFVTQL...
ENSDARP00000043116  .......................................DTE.........................RCHLVSCL...
ENSDARP00000063737  .......................................DLR.........................SMSQIYCI...
ENSDARP00000106107  .......................................DTV.........................NLRAANMI...
ENSDARP00000101619  .......................................TVSgpd......................SGVTVHKE...
ENSDARP00000025827  .......................................TVR.........................RGQYMRSL...
ENSDARP00000100360  .......................................KG-.........................-INLIRTV...
ENSDARP00000003197  .......................................SM-.........................NGDLLRTL...
ENSDARP00000012553  .......................................DVA.........................AESCVPLR...
ENSDARP00000003663  .......................................HFD.........................SMELQGVM...
ENSDARP00000069897  .......................................NAE.........................REEVLGVL...
ENSDARP00000018434  .......................................DL-.........................DGNETTSF...
ENSDARP00000093342  .......................................TI-.........................TGDLLRAL...
ENSDARP00000100360  .......................................NHE.........................TESCREARqcd
ENSDARP00000102548  .......................................NGD.........................TGTKLWKK...
ENSDARP00000041156  .......................................TI-.........................TGDLLRAL...
ENSDARP00000108156  .......................................SFPd........................NPVKLFEF...
ENSDARP00000070070  .......................................DLE.........................KAVFDEVY...
ENSDARP00000018924  .......................................NLE.........................QGRFLNSL...
ENSDARP00000123525  .......................................TLD.........................DGLCMGSI...
ENSDARP00000109363  .......................................CTEp........................SWKCISTR...
ENSDARP00000103752  .......................................CTEp........................SWKCISTR...
ENSDARP00000101029  .......................................EARslnellrv.................DVSIVDVE...
ENSDARP00000101492  .......................................GLE.........................SGQCELTM...
ENSDARP00000038543  .......................................SVR.........................RGQYLWTL...
ENSDARP00000079585  .......................................DIQ.........................TLKCLSLL...
ENSDARP00000104754  .......................................TYSsd.......................AAECLQTV...
ENSDARP00000075344  .......................................HYAge.......................TLKQTNAF...
ENSDARP00000083528  .......................................DLEk........................PDKPIFTA...
ENSDARP00000017678  .......................................SLD.........................NYTLLSRVrnk
ENSDARP00000097777  .......................................DLE.........................DLSYITQL...
ENSDARP00000109722  .......................................DL-.........................RNTSQKTF...
ENSDARP00000083772  .......................................DLR.........................MGCSSPTF...
ENSDARP00000065266  .......................................SLG.........................QQRCIATY...
ENSDARP00000088806  .......................................DWS.........................RKEPFTVV...
ENSDARP00000109028  .......................................DFQt........................NAKLSNQI...
ENSDARP00000095457  .......................................DWS.........................RPEPFAVV...
ENSDARP00000086448  .......................................KAEdnl......................SKELSTKL...
ENSDARP00000117869  .......................................DLQs........................SGENELLI...
ENSDARP00000035593  .......................................EVPgfreleennisvedv..........QNRVPEDY...
ENSDARP00000086251  .......................................SVS.........................GQRHWSSE...
ENSDARP00000054352  .......................................DAL.........................SLSPVGVI...
ENSDARP00000024810  .......................................EIV.........................QRENRSHLlev
ENSDARP00000100292  .......................................DVS.........................SLQVRRQF...
ENSDARP00000079585  .......................................RWQ.........................EGSRVCSK...
ENSDARP00000009095  .......................................SNK.........................NNKPLYSF...
ENSDARP00000101029  .......................................AADwtdnkcelldwl.............TFPAPSPR...
ENSDARP00000118167  .......................................SVS.........................GQRHWSSE...
ENSDARP00000101029  .......................................NTRhvt......................DGSVVPVL...
ENSDARP00000050905  .......................................DIGgldqdy...................NFKISKLL...
ENSDARP00000078100  .......................................NWAqerghleysa...............PEITDKTF...
ENSDARP00000046545  .......................................KVDargkl....................QGSPLIKH...
ENSDARP00000032408  .......................................EIA.........................TGRVLHTV...
ENSDARP00000104388  .......................................DID.........................IITAMSNI...
ENSDARP00000101882  .......................................DLRehsgshsnle...............IGKEVWTLryp
ENSDARP00000093519  .......................................DVN.........................DGRCIEFT...
ENSDARP00000112439  .......................................SLM.........................TNTVVQAY...
ENSDARP00000071650  ..................dqlavglcwhenmpqitektyR--.........................--------...
ENSDARP00000099546  .......................................CLI.........................SGLQLFCI...
ENSDARP00000111616  .......................................DLRaprvmvh..................S------Ltdi
ENSDARP00000019506  .......................................KSGe........................DFQLLNKI...
ENSDARP00000076262  .......................................KGA.........................TGEEQACF...
ENSDARP00000080599  .......................................DMQkfplrmkd.................NDLLVTEL...
ENSDARP00000084220  .......................................QIYiegqd....................QPRCLHEW...
ENSDARP00000080965  .......................................DVQkfplrmkd.................NDLLVTEL...
ENSDARP00000123525  .......................................NPE.........................TLHVSVLY...
ENSDARP00000018692  .......................................EDSalkve....................NGGPVKTL...
ENSDARP00000008672  .......................................DVRk........................THTPLLAV...
ENSDARP00000094999  .......................................AVDldqg.....................VCNPVVLF...
ENSDARP00000116849  .......................................GLY.........................TREGFHEN...
ENSDARP00000104388  .......................................SLW.........................SGSVSKKF...
ENSDARP00000072504  .......................................---.........................--------...
ENSDARP00000052786  .......................................NLDkrdsg....................SPLCTRIF...
ENSDARP00000076812  .......................................HWDsvsngrravnlctipf.........SLDLQSSR...
ENSDARP00000047833  .......................................LVSvgtnqgf..................QENHTFSF...
ENSDARP00000097904  .......................................DLR.........................MMRAVTPL...
ENSDARP00000102548  .......................................DTK.........................EVQMVSSI...
ENSDARP00000082368  .......................................EPIssnpnkrhkqlny............QWQKTGQF...
ENSDARP00000109749  .......................................DQR.........................KDKPGVRM...
ENSDARP00000110965  .......................................GSMds.......................AAQCLVTL...
ENSDARP00000095605  .......................................RAGssklg....................K-------...
ENSDARP00000091436  .......................................HIDdspsgtsdg................TLNFAKAF...
ENSDARP00000111846  .......................................DI-.........................--------...
ENSDARP00000090283  .......................................---.........................--------...
ENSDARP00000008223  .......................................EAS.........................SGKHITNNdiv
ENSDARP00000005398  .......................................DAV.........................TGRRATYL...
ENSDARP00000020383  .......................................DISsaaaksdsssqqdgstgdeq.....KPSYTQHI...
ENSDARP00000114287  .......................................HLDntkddikrykqrs............KFKLTGKF...
ENSDARP00000101793  .......................................SLNrp.......................TPRSVKSF...
ENSDARP00000059751  .......................................DTD.........................HPWDVYSI...
ENSDARP00000117166  .......................................SFRrvmgmr...................TCESRCLF...
ENSDARP00000046545  ...................vmcshysqqmaavqltptqlSLA.........................NFTSASKY...
ENSDARP00000060999  .......................................DRT.........................ARYWRIKS...
ENSDARP00000084929  .......................................QPK.........................SMQIEKSF...
ENSDARP00000104754  ............................agsgvavgegeDAR.........................VTSCSSVL...
ENSDARP00000111156  .......................................DIQ.........................TGQKVLTL...
ENSDARP00000112085  .......................................---.........................--------...
ENSDARP00000100913  .......................................STQ.........................TNTVERQF...
ENSDARP00000003198  .......................................RDD.........................TGTLIKSH...
ENSDARP00000027152  .......................................DYL.........................QKTILLCMstl
ENSDARP00000106476  .......................................SLK.........................EMCPLNQP...
ENSDARP00000104791  ..........................svckqvvsvettrD--.........................-------Iewa
ENSDARP00000109373  .......................................QMGyclqvrevh................SGKVLYVE...
ENSDARP00000092538  .......................................---.........................--------...
ENSDARP00000098142  .......................................HRGldsqw....................DLTNYHLL...
ENSDARP00000044811  .......................................NLYeep......................GSKPFCKL...
ENSDARP00000024810  .......................................DYH.........................RRSPVLARctl
ENSDARP00000075280  .......................................RM-.........................--------...
ENSDARP00000076048  .......................................NLS.........................--------...
ENSDARP00000089501  .......................................---.........................-----YPL...
ENSDARP00000107630  .......................................SMK.........................SGQLLQTI...
ENSDARP00000092069  .......................................SKA.........................GLNVHNSH...
ENSDARP00000018100  .......................................RIV.........................GGGDKLEF...
ENSDARP00000108631  .......................................RIV.........................GGGDKLEF...
ENSDARP00000111537  .......................................---.........................--------...
ENSDARP00000035593  .......................................---.........................--------...
ENSDARP00000109913  .......................................---.........................-------Leak
ENSDARP00000103234  .......................................ELTrg.......................RLQRLSSI...
ENSDARP00000026432  .......................................SSTgsv......................SDHLVLHP...
ENSDARP00000078268  .......................................NHY.........................CDCKDQDY...
ENSDARP00000078255  .......................................DLLggfkrhfsmgnev............SQSQVLET...
ENSDARP00000102911  .......................................ELR.........................RPTLSWLEeat
ENSDARP00000032159  .......................................KVS.........................DQKPTGSW...
ENSDARP00000079570  .......................................---.........................--------...
ENSDARP00000007708  .......................................NYE.........................DGSDVAYF...


                                                                                                    
                                                                                                    
d1pgua1               ..............................................................................
ENSDARP00000017859  ..............................................................................
ENSDARP00000039257  ..............................................................................
ENSDARP00000042217  ..............................................................................
ENSDARP00000080947  ..............................................................................
ENSDARP00000026057  ..............................................................................
ENSDARP00000116595  ..............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  ..............................................................................
ENSDARP00000088166  ..............................................................................
ENSDARP00000103157  ..............................................................................
ENSDARP00000111963  ..............................................................................
ENSDARP00000018443  ..............................................................................
ENSDARP00000079424  ..............................................................................
ENSDARP00000015825  ..............................................................................
ENSDARP00000024623  ..............................................................................
ENSDARP00000051230  ..............................................................................
ENSDARP00000044330  ..............................................................................
ENSDARP00000079567  ..............................................................................
ENSDARP00000017443  ..............................................................................
ENSDARP00000107302  ..............................................................................
ENSDARP00000005843  ..............................................................................
ENSDARP00000104051  ..............................................................................
ENSDARP00000061000  ..............................................................................
ENSDARP00000017497  ..............................................................................
ENSDARP00000011435  ..............................................................................
ENSDARP00000072190  ..............................................................................
ENSDARP00000037531  ..............................................................................
ENSDARP00000038258  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000060977  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000060431  ..............................................................................
ENSDARP00000027484  ..............................................................................
ENSDARP00000076693  ..............................................................................
ENSDARP00000089117  ..............................................................................
ENSDARP00000079014  ..............................................................................
ENSDARP00000122900  ..............................................................................
ENSDARP00000106094  ..............................................................................
ENSDARP00000105402  ..............................................................................
ENSDARP00000107355  ..............................................................................
ENSDARP00000099894  ..............................................................................
ENSDARP00000114236  ..............................................................................
ENSDARP00000068184  ..............................................................................
ENSDARP00000024391  ..............................................................................
ENSDARP00000096338  ..............................................................................
ENSDARP00000117865  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000109528  ..............................................................................
ENSDARP00000110967  ..............................................................................
ENSDARP00000097371  ..............................................................................
ENSDARP00000068663  ..............................................................................
ENSDARP00000096387  ..............................................................................
ENSDARP00000073472  ..............................................................................
ENSDARP00000056247  ..............................................................................
ENSDARP00000045014  ..............................................................................
ENSDARP00000090792  ..............................................................................
ENSDARP00000019743  ..............................................................................
ENSDARP00000028733  ..............................................................................
ENSDARP00000104487  ..............................................................................
ENSDARP00000079959  ..............................................................................
ENSDARP00000065646  ..............................................................................
ENSDARP00000005989  ..............................................................................
ENSDARP00000062413  ..............................................................................
ENSDARP00000003004  ..............................................................................
ENSDARP00000024168  ..............................................................................
ENSDARP00000077651  ..............................................................................
ENSDARP00000124018  ..............................................................................
ENSDARP00000068125  ..............................................................................
ENSDARP00000084377  ..............................................................................
ENSDARP00000109369  ..............................................................................
ENSDARP00000004327  ..............................................................................
ENSDARP00000112164  ..............................................................................
ENSDARP00000109556  ..............................................................................
ENSDARP00000036145  ..............................................................................
ENSDARP00000101521  ..............................................................................
ENSDARP00000101197  ..............................................................................
ENSDARP00000065847  ..............................................................................
ENSDARP00000099567  ..............................................................................
ENSDARP00000038520  ..............................................................................
ENSDARP00000106434  ..............................................................................
ENSDARP00000033992  tkkrrgma......................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000105555  ..............................................................................
ENSDARP00000087578  ..............................................................................
ENSDARP00000076761  ..............................................................................
ENSDARP00000119160  ..............................................................................
ENSDARP00000099166  ..............................................................................
ENSDARP00000079110  ..............................................................................
ENSDARP00000028109  ..............................................................................
ENSDARP00000017792  ..............................................................................
ENSDARP00000091471  ..............................................................................
ENSDARP00000015105  ..............................................................................
ENSDARP00000005640  ..............................................................................
ENSDARP00000112282  ..............................................................................
ENSDARP00000010862  ..............................................................................
ENSDARP00000112131  ..............................................................................
ENSDARP00000117542  ..............................................................................
ENSDARP00000027560  ..............................................................................
ENSDARP00000110861  ..............................................................................
ENSDARP00000102565  ..............................................................................
ENSDARP00000093657  ..............................................................................
ENSDARP00000008451  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000101565  skiinsvdikqtrpyrlvtgsddncttflegppfkfkctmtvsrhvcvfvskgsslystfsttepmllrrhqntekys
ENSDARP00000111921  ..............................................................................
ENSDARP00000018714  ..............................................................................
ENSDARP00000097750  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000065337  ..............................................................................
ENSDARP00000016280  ..............................................................................
ENSDARP00000071264  gkcpeicdcsyltlhgntfvisvgwsrridiylsvtrafvhfrkrptpswqddmr.......................
ENSDARP00000073678  ..............................................................................
ENSDARP00000070393  ..............................................................................
ENSDARP00000100903  ..............................................................................
ENSDARP00000099551  ..............................................................................
ENSDARP00000063641  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000014740  ..............................................................................
ENSDARP00000106749  ..............................................................................
ENSDARP00000003237  ..............................................................................
ENSDARP00000115064  ..............................................................................
ENSDARP00000071531  ..............................................................................
ENSDARP00000105980  ..............................................................................
ENSDARP00000113946  ..............................................................................
ENSDARP00000079302  ..............................................................................
ENSDARP00000111824  ..............................................................................
ENSDARP00000008006  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104171  ..............................................................................
ENSDARP00000052711  ..............................................................................
ENSDARP00000059208  ..............................................................................
ENSDARP00000006309  ..............................................................................
ENSDARP00000102210  ..............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000031340  ..............................................................................
ENSDARP00000059344  yeynpsktnrpfvsqkihfpdfstr.....................................................
ENSDARP00000074880  ..............................................................................
ENSDARP00000026454  ..............................................................................
ENSDARP00000099918  ..............................................................................
ENSDARP00000121552  ..............................................................................
ENSDARP00000007696  ..............................................................................
ENSDARP00000080844  ..............................................................................
ENSDARP00000071301  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000106510  ..............................................................................
ENSDARP00000037121  ..............................................................................
ENSDARP00000124137  ..............................................................................
ENSDARP00000039795  ..............................................................................
ENSDARP00000079663  ..............................................................................
ENSDARP00000056762  ..............................................................................
ENSDARP00000024476  ..............................................................................
ENSDARP00000126101  ..............................................................................
ENSDARP00000087003  ..............................................................................
ENSDARP00000065205  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000059666  ..............................................................................
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000078191  ..............................................................................
ENSDARP00000078965  ..............................................................................
ENSDARP00000102373  ..............................................................................
ENSDARP00000006117  ..............................................................................
ENSDARP00000111140  ..............................................................................
ENSDARP00000094274  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000106181  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000102443  ..............................................................................
ENSDARP00000038921  ..............................................................................
ENSDARP00000033554  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000014182  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000108102  ..............................................................................
ENSDARP00000107806  ..............................................................................
ENSDARP00000007602  ..............................................................................
ENSDARP00000021430  ..............................................................................
ENSDARP00000087525  ..............................................................................
ENSDARP00000054317  ..............................................................................
ENSDARP00000110907  ..............................................................................
ENSDARP00000074797  ..............................................................................
ENSDARP00000047739  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000055337  ..............................................................................
ENSDARP00000058220  ..............................................................................
ENSDARP00000102332  etqldlgfrghgcpkvvrlvgegesnailvctdqgevclsqgdiwdviwqggsefqsycvmevasiqvqnsdcivqvc
ENSDARP00000003173  ..............................................................................
ENSDARP00000064438  ..............................................................................
ENSDARP00000099721  ..............................................................................
ENSDARP00000026825  ..............................................................................
ENSDARP00000100187  ..............................................................................
ENSDARP00000059532  ..............................................................................
ENSDARP00000099725  ..............................................................................
ENSDARP00000084300  ..............................................................................
ENSDARP00000124280  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000110672  ..............................................................................
ENSDARP00000060454  ..............................................................................
ENSDARP00000098826  ..............................................................................
ENSDARP00000091438  ..............................................................................
ENSDARP00000098798  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000086480  ..............................................................................
ENSDARP00000099546  igsvlgivedeiacicrhhnitccltltkhskiliafgesrlhsvctlpffrkvqakciisvlfkgfvfvcvqvwshe
ENSDARP00000061333  ..............................................................................
ENSDARP00000037790  ..............................................................................
ENSDARP00000032005  ..............................................................................
ENSDARP00000008668  ..............................................................................
ENSDARP00000103874  ..............................................................................
ENSDARP00000043116  ..............................................................................
ENSDARP00000063737  ..............................................................................
ENSDARP00000106107  ..............................................................................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000003197  ..............................................................................
ENSDARP00000012553  ..............................................................................
ENSDARP00000003663  ..............................................................................
ENSDARP00000069897  ..............................................................................
ENSDARP00000018434  ..............................................................................
ENSDARP00000093342  ..............................................................................
ENSDARP00000100360  seesdieseddggydsdvtreneivyvikalstnmrpmtgvkphlqqkeptvdesdgflemcrppvsrappmpeklqt
ENSDARP00000102548  ..............................................................................
ENSDARP00000041156  ..............................................................................
ENSDARP00000108156  ..............................................................................
ENSDARP00000070070  ..............................................................................
ENSDARP00000018924  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000109363  ..............................................................................
ENSDARP00000103752  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000101492  ..............................................................................
ENSDARP00000038543  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000083528  ..............................................................................
ENSDARP00000017678  pydvfgcwlnethlisgnlhwignmtscsvlwlnnafqgiesenvnvvkrlfkiqninastirtvmvahcrrhdspdl
ENSDARP00000097777  ..............................................................................
ENSDARP00000109722  ..............................................................................
ENSDARP00000083772  ..............................................................................
ENSDARP00000065266  ..............................................................................
ENSDARP00000088806  ..............................................................................
ENSDARP00000109028  ..............................................................................
ENSDARP00000095457  ..............................................................................
ENSDARP00000086448  ..............................................................................
ENSDARP00000117869  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000086251  ..............................................................................
ENSDARP00000054352  ..............................................................................
ENSDARP00000024810  hsfnl.........................................................................
ENSDARP00000100292  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000009095  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000118167  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000050905  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000032408  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000101882  tfstdavlsgvghlspvvsiepviasadmsststltadievnlecmglsfqlgsldengvltlwvvielpkgndsgsq
ENSDARP00000093519  ..............................................................................
ENSDARP00000112439  ..............................................................................
ENSDARP00000071650  ..............................................................................
ENSDARP00000099546  ..............................................................................
ENSDARP00000111616  kqkqeekplenphgvpntfthlnltwkpfirvslpkisssgeysplrfsmrentvdyntgnklkchksdksvsgadsr
ENSDARP00000019506  ..............................................................................
ENSDARP00000076262  ..............................................................................
ENSDARP00000080599  ..............................................................................
ENSDARP00000084220  ..............................................................................
ENSDARP00000080965  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000018692  ..............................................................................
ENSDARP00000008672  ..............................................................................
ENSDARP00000094999  ..............................................................................
ENSDARP00000116849  ..............................................................................
ENSDARP00000104388  ..............................................................................
ENSDARP00000072504  ..............................................................................
ENSDARP00000052786  ..............................................................................
ENSDARP00000076812  ..............................................................................
ENSDARP00000047833  ..............................................................................
ENSDARP00000097904  ..............................................................................
ENSDARP00000102548  ..............................................................................
ENSDARP00000082368  ..............................................................................
ENSDARP00000109749  ..............................................................................
ENSDARP00000110965  ..............................................................................
ENSDARP00000095605  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000111846  ..............................................................................
ENSDARP00000090283  ..............................................................................
ENSDARP00000008223  rnlewatstcvlgfsvfgiwp.........................................................
ENSDARP00000005398  ..............................................................................
ENSDARP00000020383  ..............................................................................
ENSDARP00000114287  ..............................................................................
ENSDARP00000101793  ..............................................................................
ENSDARP00000059751  ..............................................................................
ENSDARP00000117166  ..............................................................................
ENSDARP00000046545  ..............................................................................
ENSDARP00000060999  ..............................................................................
ENSDARP00000084929  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000111156  ..............................................................................
ENSDARP00000112085  ..............................................................................
ENSDARP00000100913  ..............................................................................
ENSDARP00000003198  ..............................................................................
ENSDARP00000027152  elygsadpfqrltrsprknrqstsgltelsdnqvsldlersksptsdhvnghctsptsqpcpsgrarvpggpegprla
ENSDARP00000106476  ..............................................................................
ENSDARP00000104791  tftctlgfhvfglw................................................................
ENSDARP00000109373  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000098142  ..............................................................................
ENSDARP00000044811  ..............................................................................
ENSDARP00000024810  hpndslamegplsrvkslkkslrqsfrrirksrvsgkkrvvvnsptskvqeanahladhdaevtpvqrrieprsad..
ENSDARP00000075280  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000107630  ..............................................................................
ENSDARP00000092069  ..............................................................................
ENSDARP00000018100  ..............................................................................
ENSDARP00000108631  ..............................................................................
ENSDARP00000111537  ..............................................................................
ENSDARP00000035593  ..............................................................................
ENSDARP00000109913  qatqsprateaklspvvllmkikppeipagtslkspfevlqkteegtmigsgqnhlissqqwesqdlafrkmyakyin
ENSDARP00000103234  ..............................................................................
ENSDARP00000026432  ..............................................................................
ENSDARP00000078268  ..............................................................................
ENSDARP00000078255  ..............................................................................
ENSDARP00000102911  ccsdlpklegdsddqiedsdseehsrsesvtgplgqketmevslgvtalsvlqqpeklqwevvasvledtvkdleelg
ENSDARP00000032159  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000007708  ..............................................................................


                                                                                                    
                                                                                                    
d1pgua1               ..............................................................................
ENSDARP00000017859  ..............................................................................
ENSDARP00000039257  ..............................................................................
ENSDARP00000042217  ..............................................................................
ENSDARP00000080947  ..............................................................................
ENSDARP00000026057  ..............................................................................
ENSDARP00000116595  ..............................................................................
ENSDARP00000074155  ..............................................................................
ENSDARP00000038728  ..............................................................................
ENSDARP00000088166  ..............................................................................
ENSDARP00000103157  ..............................................................................
ENSDARP00000111963  ..............................................................................
ENSDARP00000018443  ..............................................................................
ENSDARP00000079424  ..............................................................................
ENSDARP00000015825  ..............................................................................
ENSDARP00000024623  ..............................................................................
ENSDARP00000051230  ..............................................................................
ENSDARP00000044330  ..............................................................................
ENSDARP00000079567  ..............................................................................
ENSDARP00000017443  ..............................................................................
ENSDARP00000107302  ..............................................................................
ENSDARP00000005843  ..............................................................................
ENSDARP00000104051  ..............................................................................
ENSDARP00000061000  ..............................................................................
ENSDARP00000017497  ..............................................................................
ENSDARP00000011435  ..............................................................................
ENSDARP00000072190  ..............................................................................
ENSDARP00000037531  ..............................................................................
ENSDARP00000038258  ..............................................................................
ENSDARP00000076048  ..............................................................................
ENSDARP00000060977  ..............................................................................
ENSDARP00000079570  ..............................................................................
ENSDARP00000060431  ..............................................................................
ENSDARP00000027484  ..............................................................................
ENSDARP00000076693  ..............................................................................
ENSDARP00000089117  ..............................................................................
ENSDARP00000079014  ..............................................................................
ENSDARP00000122900  ..............................................................................
ENSDARP00000106094  ..............................................................................
ENSDARP00000105402  ..............................................................................
ENSDARP00000107355  ..............................................................................
ENSDARP00000099894  ..............................................................................
ENSDARP00000114236  ..............................................................................
ENSDARP00000068184  ..............................................................................
ENSDARP00000024391  ..............................................................................
ENSDARP00000096338  ..............................................................................
ENSDARP00000117865  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000109528  ..............................................................................
ENSDARP00000110967  ..............................................................................
ENSDARP00000097371  ..............................................................................
ENSDARP00000068663  ..............................................................................
ENSDARP00000096387  ..............................................................................
ENSDARP00000073472  ..............................................................................
ENSDARP00000056247  ..............................................................................
ENSDARP00000045014  ..............................................................................
ENSDARP00000090792  ..............................................................................
ENSDARP00000019743  ..............................................................................
ENSDARP00000028733  ..............................................................................
ENSDARP00000104487  ..............................................................................
ENSDARP00000079959  ..............................................................................
ENSDARP00000065646  ..............................................................................
ENSDARP00000005989  ..............................................................................
ENSDARP00000062413  ..............................................................................
ENSDARP00000003004  ..............................................................................
ENSDARP00000024168  ..............................................................................
ENSDARP00000077651  ..............................................................................
ENSDARP00000124018  ..............................................................................
ENSDARP00000068125  ..............................................................................
ENSDARP00000084377  ..............................................................................
ENSDARP00000109369  ..............................................................................
ENSDARP00000004327  ..............................................................................
ENSDARP00000112164  ..............................................................................
ENSDARP00000109556  ..............................................................................
ENSDARP00000036145  ..............................................................................
ENSDARP00000101521  ..............................................................................
ENSDARP00000101197  ..............................................................................
ENSDARP00000065847  ..............................................................................
ENSDARP00000099567  ..............................................................................
ENSDARP00000038520  ..............................................................................
ENSDARP00000106434  ..............................................................................
ENSDARP00000033992  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000105555  ..............................................................................
ENSDARP00000087578  ..............................................................................
ENSDARP00000076761  ..............................................................................
ENSDARP00000119160  ..............................................................................
ENSDARP00000099166  ..............................................................................
ENSDARP00000079110  ..............................................................................
ENSDARP00000028109  ..............................................................................
ENSDARP00000017792  ..............................................................................
ENSDARP00000091471  ..............................................................................
ENSDARP00000015105  ..............................................................................
ENSDARP00000005640  ..............................................................................
ENSDARP00000112282  ..............................................................................
ENSDARP00000010862  ..............................................................................
ENSDARP00000112131  ..............................................................................
ENSDARP00000117542  ..............................................................................
ENSDARP00000027560  ..............................................................................
ENSDARP00000110861  ..............................................................................
ENSDARP00000102565  ..............................................................................
ENSDARP00000093657  ..............................................................................
ENSDARP00000008451  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000101565  nlgge.........................................................................
ENSDARP00000111921  ..............................................................................
ENSDARP00000018714  ..............................................................................
ENSDARP00000097750  ..............................................................................
ENSDARP00000105810  ..............................................................................
ENSDARP00000065337  ..............................................................................
ENSDARP00000016280  ..............................................................................
ENSDARP00000071264  ..............................................................................
ENSDARP00000073678  ..............................................................................
ENSDARP00000070393  ..............................................................................
ENSDARP00000100903  ..............................................................................
ENSDARP00000099551  ..............................................................................
ENSDARP00000063641  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000014740  ..............................................................................
ENSDARP00000106749  ..............................................................................
ENSDARP00000003237  ..............................................................................
ENSDARP00000115064  ..............................................................................
ENSDARP00000071531  ..............................................................................
ENSDARP00000105980  ..............................................................................
ENSDARP00000113946  ..............................................................................
ENSDARP00000079302  ..............................................................................
ENSDARP00000111824  ..............................................................................
ENSDARP00000008006  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104171  ..............................................................................
ENSDARP00000052711  ..............................................................................
ENSDARP00000059208  ..............................................................................
ENSDARP00000006309  ..............................................................................
ENSDARP00000102210  ..............................................................................
ENSDARP00000124457  ..............................................................................
ENSDARP00000010071  ..............................................................................
ENSDARP00000092538  ..............................................................................
ENSDARP00000031340  ..............................................................................
ENSDARP00000059344  ..............................................................................
ENSDARP00000074880  ..............................................................................
ENSDARP00000026454  ..............................................................................
ENSDARP00000099918  ..............................................................................
ENSDARP00000121552  ..............................................................................
ENSDARP00000007696  ..............................................................................
ENSDARP00000080844  ..............................................................................
ENSDARP00000071301  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000106510  ..............................................................................
ENSDARP00000037121  ..............................................................................
ENSDARP00000124137  ..............................................................................
ENSDARP00000039795  ..............................................................................
ENSDARP00000079663  ..............................................................................
ENSDARP00000056762  ..............................................................................
ENSDARP00000024476  ..............................................................................
ENSDARP00000126101  ..............................................................................
ENSDARP00000087003  ..............................................................................
ENSDARP00000065205  ..............................................................................
ENSDARP00000110420  ..............................................................................
ENSDARP00000059666  ..............................................................................
ENSDARP00000101126  ..............................................................................
ENSDARP00000060548  ..............................................................................
ENSDARP00000078100  ..............................................................................
ENSDARP00000078191  ..............................................................................
ENSDARP00000078965  ..............................................................................
ENSDARP00000102373  ..............................................................................
ENSDARP00000006117  ..............................................................................
ENSDARP00000111140  ..............................................................................
ENSDARP00000094274  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000106181  ..............................................................................
ENSDARP00000089501  ..............................................................................
ENSDARP00000102443  ..............................................................................
ENSDARP00000038921  ..............................................................................
ENSDARP00000033554  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000014182  ..............................................................................
ENSDARP00000027152  ..............................................................................
ENSDARP00000108102  ..............................................................................
ENSDARP00000107806  ..............................................................................
ENSDARP00000007602  ..............................................................................
ENSDARP00000021430  ..............................................................................
ENSDARP00000087525  ..............................................................................
ENSDARP00000054317  ..............................................................................
ENSDARP00000110907  ..............................................................................
ENSDARP00000074797  ..............................................................................
ENSDARP00000047739  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000055337  ..............................................................................
ENSDARP00000058220  ..............................................................................
ENSDARP00000102332  avgnlnggvqvflvgqpgvgvflragegkvhsvlwvkglfgesgnvcllasgseglvyrwtinvtedksglhikeeal
ENSDARP00000003173  ..............................................................................
ENSDARP00000064438  ..............................................................................
ENSDARP00000099721  ..............................................................................
ENSDARP00000026825  ..............................................................................
ENSDARP00000100187  ..............................................................................
ENSDARP00000059532  ..............................................................................
ENSDARP00000099725  ..............................................................................
ENSDARP00000084300  ..............................................................................
ENSDARP00000124280  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000110672  ..............................................................................
ENSDARP00000060454  ..............................................................................
ENSDARP00000098826  ..............................................................................
ENSDARP00000091438  ..............................................................................
ENSDARP00000098798  ..............................................................................
ENSDARP00000091436  ..............................................................................
ENSDARP00000086480  ..............................................................................
ENSDARP00000099546  mesvidlpspalflrtsedeklllaegcdrtlcvflvtltsmhkvldl..............................
ENSDARP00000061333  ..............................................................................
ENSDARP00000037790  ..............................................................................
ENSDARP00000032005  ..............................................................................
ENSDARP00000008668  ..............................................................................
ENSDARP00000103874  ..............................................................................
ENSDARP00000043116  ..............................................................................
ENSDARP00000063737  ..............................................................................
ENSDARP00000106107  ..............................................................................
ENSDARP00000101619  ..............................................................................
ENSDARP00000025827  ..............................................................................
ENSDARP00000100360  ..............................................................................
ENSDARP00000003197  ..............................................................................
ENSDARP00000012553  ..............................................................................
ENSDARP00000003663  ..............................................................................
ENSDARP00000069897  ..............................................................................
ENSDARP00000018434  ..............................................................................
ENSDARP00000093342  ..............................................................................
ENSDARP00000100360  nnvgkkkrpiedlvlelvfgyrgndcrnnvhylnegadiiyhtasigvvlnlttacqsfyl.................
ENSDARP00000102548  ..............................................................................
ENSDARP00000041156  ..............................................................................
ENSDARP00000108156  ..............................................................................
ENSDARP00000070070  ..............................................................................
ENSDARP00000018924  ..............................................................................
ENSDARP00000123525  ..............................................................................
ENSDARP00000109363  ..............................................................................
ENSDARP00000103752  ..............................................................................
ENSDARP00000101029  ..............................................................................
ENSDARP00000101492  ..............................................................................
ENSDARP00000038543  ..............................................................................
ENSDARP00000079585  ..............................................................................
ENSDARP00000104754  ..............................................................................
ENSDARP00000075344  ..............................................................................
ENSDARP00000083528  .........................................................................