SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Pectin lyase-like alignments in PDB chains (SCOP 1.75)

These alignments are sequences aligned to the 0045962 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                10            20         30        40        50           60        
                                 |             |          |         |         |            |        
d1bhea_  ............sds---RTVSEPKTPSSCTTL....KADSS.TATSTIQKALNNCDQGKAVRLSAGSTSVFL.SGPLSL..PSGVSLLID
1czfA  ........cstitln------------------....-----.------------------------------.------..-N---IEVP
1bheA  ...............------------------....-----.--TSTIQKALNNCDQGKAVRLSAGSTSVFL.SGPLSL..PSGVSLLID
1hg8A  .....vptgkqldls------------------....-----.------------------------------.------..---------
1ia5A  ...........vavp------------------....-----.------------------------------.------..---------
1k5cA  .....csavtlngft------------------....-----.--------------------VPAG------.-NTLVLnpDKGATVTMA
1nhcA  .............ie------------------....-----.--------------------VPAG------.------..---------
1rmgA  qlsgsvgpltsastk---------GATKTCNILsygaVADNStDVGPAITSAWAACKSGGLVYIPSG---NYAlNTWVTLtgGSATAIQLD


         70        80        90       100       110          120       130       140       150      
          |         |         |         |         |            |         |         |         |      
d1bhea_  KGVTLRAVNNAKSFENAPSSCGVVDKNGKGCDAFITAVSTTNSGIYGP...GTIDGQGGVKLQDKKVSWWELAADAKVKKLKQNTPR.LIQ
1czfA  AGTTLDLTGLTSGTKVIFEGTTTFQYE--EWAGPLISMSGEHITVTGAsg.HLINCDGARWWDGK-------------GTSGKKKPK.FFY
1bheA  KGVTLRAVNNAKSFENAPSSCGVVDKNGKGCDAFITAVSTTNSGIYGP...GTIDGQGGVKLQDKKVSWWELAADAKVKKLKQNTPR.LIQ
1hg8A  --------SLQNDSTVTFKGTTTFATTA-DNDFNPIVISGSNITITGAsg.HVIDGNGQAYWDGKGS-----------NSNSNQKPDhFIV
1ia5A  SGTTLDLTKLNDGTHVIFSGETTFGYK--EWSGPLISVSGSDLTITGAsg.HSINGDGSRWW------------DGEGGNGGKTKPK.FFA
1k5cA  GDITFAKT---------------------TLDGPLFTIDGTGINFVGAd..HIFDGNGALYWDGKG------------TNNGTHKPHpFLK
1nhcA  --ETLDLSDAADGSTITFEGTTSFGYK--EWKGPLIRFGGKDLTVTMAdg.AVIDGDGSRWWDSKG------------TNGGKTKPK.FMY
1rmgA  G--IIYRTGT-------------------ASGNMIAVTDTTDFELFSStskGAVQGFGYVY-----------------HAEGTYGAR.ILR


            160       170       180        190                   200       210       220       230  
              |         |         |          |                     |         |         |         |  
d1bhea_  INK.SKNFTLYNVSLINSPNFHVVFSD.GDGFTAWKTTIKTPST............ARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYK
1czfA  AHG.LDSSSITGLNIKNTPLMAFSVQA.-NDITFTDVTINNADGdtqg........GHNTDAFDVGNSVGVNIIKPWVHNQDDCLAVNSG-
1bheA  INK.SKNFTLYNVSLINSPNFHVVFSD.GDGFTAWKTTIKTPST............ARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYK
1hg8A  VQKtTGNSKITNLNIQNWPVHCFDITG.SSQLTISGLILDNRAGdkpnaksgslpaAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSG-
1ia5A  AHS.LTNSVISGLKIVNSPVQVFSVAG.SDYLTLKDITIDNSDGddng........GHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSG-
1k5cA  IKG.S--GTYKKFEVLNSPAQAISVGPtDAHLTLDGITVDDFAGdtknl.......GHNTDGFDVS-ANNVTIQNCIVKNQDDCIAINDG-
1nhcA  IHD.VEDSTFKGINIKNTPVQAISVQA.-TNVHLNDFTIDNSDGddng........GHNTDGFDISESTGVYISGATVKNQDDCIAINSG-
1rmgA  LTD.VTHFSVHDIILVDAPAFHFTMDT.CSDGEVYNMAIRGGNE............GGL-DGIDVWGS-NIWVHDVEVTNKDECVTVKSP-


              240       250         260           270       280        290       300        310     
                |         |           |             |         |          |         |          |     
d1bhea_  GRAETRNISILHNDFGTGHGMSIGSE..TMG....VYNVTVDDLKMNGTTNGLRIKSDKSA.AGVVNGVRYSNVVMKNV.AKPIVIDTVYE
1czfA  -----ENIWFTGGTCIGGHGLSIGSV..GDRsnnvVKNVTIEHSTVSNSENAVRIKTISGA.TGSVSEITYSNIVMSGIsDYGVVIQQDYE
1bheA  GRAETRNISILHNDFGTGHGMSIGSE..TMG....VYNVTVDDLKMNGTTNGLRIKSDKSA.AGVVNGVRYSNVVMKNV.AKPIVIDTVYE
1hg8A  -----TNIVVSNMYCSGGHGLSIGSV..GGKsdnvVDGVQFLSSQVVNSQNGCRIKSNSGA.TGTINNVTYQNIALTNIsTYGVDVQQDYL
1ia5A  -----ENIYFSGGYCSGGHGLSIGSV..GGRsdntVKNVTFVDSTIINSDNGVRIKTNIDT.TGSVSDVTYKDITLTSIaKYGIVVQQNYG
1k5cA  -----NNIRFENNQCSGGHGISIGSIatGKH....VSNVVIKGNTVTRSMYGVRIKAQRTAtSASVSGVTYDANTISGIaKYGVLISQSYP
1nhcA  -----ESISFTGGTCSGGHGLSIGSV..GGRddntVKNVTISDSTVSNSANGVRIKTIYKE.TGDVSEITYSNIQLSGItDYGIVIEQDYE
1rmgA  ----ANNILVESIYCNWSGGCAMGSL..GADtd..VTDIVYRNVYTWSSNQMYMIKSN-GG.SGTVSNVLLENFIGHGN.AYSLDIDGYWS


               320       330            340       350       360           370                       
                 |         |              |         |         |             |                       
d1bhea_  K....KEGSNVPDWSDITFKDVTSE.....TKGVVVLNGENAKKPIEVTMKNVKLTSDST....WQIKNVNV--kk...............
1czfA  DgkptGKPTNGVTIQDVKLESVTGSvds..GATEIYLLCGSGS-CSDWTWDDVKVTGGKKs...TACKN-----.................
1bheA  K....KEGSNVPDWSDITFKDVTSE.....TKGVVVLNGENAKKPIEVTMKNVKLTSDST....WQIKNV----.................
1hg8A  NggptGKPTNGVKISNIKFIKVTGTvas..SAQDWFILCGDGS-CSGFTFSGNAITGGGKt...SSC-------n................
1ia5A  Dts..STPTTGVPITDFVLDNVHGSvvs..SGTNILISCGSGS-CSDWTWTDVSVSGGKTs...SKCTNVP---.................
1k5cA  Ddv..GNPGTGAPFSDVNFTGGATTikv..NNAATRVTVECGNCSGNWNWSQLTVTGGK-....----------a................
1nhcA  NgsptGTPSTGIPITDVTVDGVTGTled..DATQVYILCGDGS-CSDWTWSGVDLSGGKTs...DKCENVP---.................
1rmgA  Smt..AVAGDGVQLNNITVKNWKGTeangaTRPPIRVVCSDTAPCTDLTLEDIAIWTESGsselYLCRSAY---gsgyclkdssshtsytt


                                                           
                                                           
d1bhea_  ..................................................
1czfA  ..................................................
1bheA  ..................................................
1hg8A  ..................................................
1ia5A  ..................................................
1k5cA  ..................................................
1nhcA  ..................................................
1rmgA  tstvtaapsgysattmaadlatafgltasipiptiptsfypgltpysala


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045962 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Adineta vaga
NoYes   Proterospongia sp. ATCC 50818
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Microbotryum violaceum 22
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Thielavia terrestris NRRL 8126
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Lachancea kluyveri
NoYes   Ashbya gossypii ATCC 10895
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Bathycoccus prasinos
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Brachybacterium faecium DSM 4810
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Clostridium phytofermentans ISDg
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus faecium Aus0004
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus polymyxa M1
NoYes   Solibacillus silvestris StLB046
NoYes   Spirosoma linguale DSM 74
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Pedobacter saltans DSM 12145
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Flavobacterium johnsoniae UW101
NoYes   Opitutus terrae PB90-1
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia glumae BGR1
NoYes   Collimonas fungivorans Ter331
NoYes   Methylobacterium sp. 4-46
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Pelagibacterium halotolerans B2
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Frateuria aurantia DSM 6220
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Legionella longbeachae NSW150
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Klebsiella oxytoca E718
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Haloferax volcanii DS2
NoYes   Aspergillus fumigatus A1163
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecium Aus0085
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Enterococcus faecium DO
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus infantis NRRL B-14911
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Xylella fastidiosa subsp. fastidiosa GB514
NoYes   Xylella fastidiosa M12
NoYes   Xylella fastidiosa Temecula1
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]