SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

FAD/NAD(P)-binding domain alignments in Malus x domestica

These alignments are sequences aligned to the 0046128 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1cf3a1          gieaslltdp.........................................................................
MDP0000813172  spytv..............................................................................
MDP0000251581  spytv..............................................................................
MDP0000188391  spytv..............................................................................
MDP0000254144  egs................................................................................
MDP0000321972  ps.................................................................................
MDP0000299806  n..................................................................................
MDP0000283451  n..................................................................................
MDP0000296714  kkk................................................................................
MDP0000162193  kkk................................................................................
MDP0000769741  sps................................................................................
MDP0000295277  n..................................................................................
MDP0000897124  ...................................................................................
MDP0000854208  ...................................................................................
MDP0000241767  kkk................................................................................
MDP0000318858  rtgkr..............................................................................
MDP0000248995  ...................................................................................
MDP0000442206  rtgkr..............................................................................
MDP0000181673  ...................................................................................
MDP0000315409  ...................................................................................
MDP0000053966  ...................................................................................
MDP0000294615  ...................................................................................
MDP0000306147  kkk................................................................................
MDP0000180064  k..................................................................................
MDP0000261625  pssss..............................................................................
MDP0000300208  ...................................................................................
MDP0000247171  ...................................................................................
MDP0000308095  klk................................................................................
MDP0000319421  ...................................................................................
MDP0000232295  itsdvnea...........................................................................
MDP0000188994  s..................................................................................
MDP0000159189  s..................................................................................
MDP0000656178  ngsppk.............................................................................
MDP0000910523  ...................................................................................
MDP0000119941  n..................................................................................
MDP0000231799  naxppk.............................................................................
MDP0000255025  klk................................................................................
MDP0000231632  kr.................................................................................
MDP0000173300  nv.................................................................................
MDP0000158474  ng.................................................................................
MDP0000276878  mr.................................................................................
MDP0000154720  p..................................................................................
MDP0000549646  sanglnpsydlsafkfdpikesivsremtrrymtdmity............................................
MDP0000158853  mvakks.............................................................................
MDP0000702799  mvakks.............................................................................
MDP0000233110  n..................................................................................
MDP0000260827  ...................................................................................
MDP0000941459  mvakks.............................................................................
MDP0000185338  dy.................................................................................
MDP0000451172  ...................................................................................
MDP0000136847  fsylkfvrnatdlp.....................................................................
MDP0000177641  qvsg...............................................................................
MDP0000413935  ...................................................................................
MDP0000206098  sanglnpsyxlsafkfdpikesivsremtrrymtdmity............................................
MDP0000845788  esppaspenaien......................................................................
MDP0000465595  sg.................................................................................
MDP0000137211  fsylkfvrnatdlp.....................................................................
MDP0000130099  sehdfsysksvvnatdlpq................................................................
MDP0000425135  ylkfvvnatdfpte.....................................................................
MDP0000200780  n..................................................................................
MDP0000142434  g..................................................................................
MDP0000248951  dfsylkfvrnatdlp....................................................................
MDP0000869086  skn................................................................................
MDP0000318256  rnfsyvkfvrnatdlpll.................................................................
MDP0000231634  kr.................................................................................
MDP0000626995  sanglnpsynlsafkfdpikesivsremtrrymtdmity............................................
MDP0000123832  ...................................................................................
MDP0000236092  msangltpsydlsafkfdpikesivsremtrrymtdmity...........................................
MDP0000199159  skn................................................................................
MDP0000162755  g..................................................................................
MDP0000173666  kr.................................................................................
MDP0000262982  ...................................................................................
MDP0000184832  qvsg...............................................................................
MDP0000598927  ...................................................................................
MDP0000561228  dfsysksvinatdlp....................................................................
MDP0000175650  p..................................................................................
MDP0000233802  ddlktl.............................................................................
MDP0000321186  drv................................................................................
MDP0000161955  t..................................................................................
MDP0000213381  t..................................................................................
MDP0000168437  ...................................................................................
MDP0000823251  ddlktl.............................................................................
MDP0000191389  t..................................................................................
MDP0000199319  t..................................................................................
MDP0000857446  t..................................................................................
MDP0000266638  t..................................................................................
MDP0000208936  i..................................................................................
MDP0000202883  t..................................................................................
MDP0000288439  vsg................................................................................
MDP0000295839  e..................................................................................
MDP0000903805  lvfqnfsylkfvrnatdlp................................................................
MDP0000202123  y..................................................................................
MDP0000227773  pkx................................................................................
MDP0000317524  skn................................................................................
MDP0000320748  t..................................................................................
MDP0000634676  n..................................................................................
MDP0000235846  ptddlktl...........................................................................
MDP0000251344  ptddlktl...........................................................................
MDP0000501957  t..................................................................................
MDP0000209681  e..................................................................................
MDP0000293482  pk.................................................................................
MDP0000233995  e..................................................................................
MDP0000257243  vfqnfsyvkfvrnatdlp.................................................................
MDP0000160099  qpkn...............................................................................
MDP0000193196  t..................................................................................
MDP0000208234  ...................................................................................
MDP0000251783  sylkfvrnatdlp......................................................................
MDP0000686885  ...................................................................................
MDP0000138851  ...................................................................................
MDP0000194930  k..................................................................................
MDP0000169201  mgkq...............................................................................
MDP0000399642  mgkq...............................................................................
MDP0000582079  e..................................................................................
MDP0000129765  pk.................................................................................
MDP0000272655  lvfqnfsylkfvcnatdlp................................................................
MDP0000686821  e..................................................................................
MDP0000170414  mgkq...............................................................................
MDP0000320804  mgkq...............................................................................
MDP0000189790  ...................................................................................
MDP0000847111  vq.................................................................................
MDP0000289536  ...................................................................................
MDP0000123987  mgkq...............................................................................
MDP0000245245  mgkq...............................................................................
MDP0000188553  s..................................................................................
MDP0000296599  kr.................................................................................
MDP0000746652  t..................................................................................
MDP0000259265  vs.................................................................................
MDP0000151331  dfgylkfvynatdlpl...................................................................
MDP0000309775  k..................................................................................
MDP0000232736  pskp...............................................................................
MDP0000320539  ...................................................................................
MDP0000239909  rh.................................................................................
MDP0000259264  vs.................................................................................
MDP0000293613  isasasn............................................................................
MDP0000253362  isasasn............................................................................
MDP0000182973  ...................................................................................
MDP0000138005  s..................................................................................
MDP0000261301  t..................................................................................
MDP0000771633  lra................................................................................
MDP0000851102  lra................................................................................
MDP0000159873  nlr................................................................................
MDP0000140206  k..................................................................................
MDP0000261201  nlr................................................................................
MDP0000252244  lr.................................................................................
MDP0000261821  aa.................................................................................
MDP0000124454  pskp...............................................................................
MDP0000234830  l..................................................................................
MDP0000297861  regrrvhvierdltepdrivgellqpggylklielgledcveeidaqrvvgyalfkdgkntrltypleqfnsdv.........
MDP0000152184  ...................................................................................
MDP0000157871  isl................................................................................
MDP0000250932  ...................................................................................
MDP0000219521  g..................................................................................
MDP0000239289  t..................................................................................
MDP0000258995  ...................................................................................
MDP0000167343  g..................................................................................
MDP0000222306  g..................................................................................
MDP0000829384  t..................................................................................
MDP0000145663  rsr................................................................................
MDP0000288439  sg.................................................................................
MDP0000267350  erllpdwykekgielilnteivna...........................................................
MDP0000155608  lkvaiidsnpavsnglsikkedppdprasavapatislfqdigawkyveqnrhayfdqmqvwdytglgytrynardvhkdslg
MDP0000194622  ...................................................................................
MDP0000134271  kvg................................................................................
MDP0000312748  d..................................................................................
MDP0000197715  ik.................................................................................
MDP0000220943  kig................................................................................
MDP0000320539  a..................................................................................
MDP0000140206  g..................................................................................
MDP0000215521  kig................................................................................
MDP0000203847  ntrig..............................................................................
MDP0000201011  ntr................................................................................
MDP0000204596  whfanldygcaaplkevslpnwnqddvygg.....................................................
MDP0000148978  frasprpt...........................................................................
MDP0000130369  kekk...............................................................................
MDP0000314606  isasasn............................................................................
MDP0000263146  kkk................................................................................
MDP0000250583  dkkkp..............................................................................
MDP0000208233  ...................................................................................
MDP0000158720  ...................................................................................
MDP0000152184  ...................................................................................
MDP0000182702  tgnlnlitqalaavgcempvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygvcwkvfnasnslelksl
MDP0000261638  ...................................................................................
MDP0000130370  kekk...............................................................................
MDP0000272119  a..................................................................................
MDP0000305861  kqk................................................................................
MDP0000255696  kkkix..............................................................................
MDP0000214280  rdfgylkfvynatdlpl..................................................................
MDP0000210966  sy.................................................................................
MDP0000610999  ps.................................................................................
MDP0000242546  ps.................................................................................
MDP0000320742  epdre..............................................................................
MDP0000654164  ...................................................................................
MDP0000256300  qkfts..............................................................................
MDP0000235080  mn.................................................................................
MDP0000284363  kkr................................................................................
MDP0000125043  vtiedgrnfiadaaiitvphgilkakliefvpqlpewkvaaisdlgvgnenkvalrfekxfwpnvellgivapnsyacgyfln
MDP0000192359  wlylyhs............................................................................
MDP0000440005  grerk..............................................................................
MDP0000609131  t..................................................................................
MDP0000362000  kpr................................................................................
MDP0000150210  k..................................................................................
MDP0000158790  vl.................................................................................
MDP0000427950  k..................................................................................
MDP0000569169  lisasasn...........................................................................
MDP0000525742  en.................................................................................
MDP0000559829  t..................................................................................
MDP0000321788  empvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygvcwkvfnasnslelksleepiyhfgqffqkpve
MDP0000919183  h..................................................................................
MDP0000146158  h..................................................................................
MDP0000832077  kig................................................................................
MDP0000621365  atdlpl.............................................................................
MDP0000875229  lv.................................................................................
MDP0000251344  lrt................................................................................
MDP0000168919  xleqg..............................................................................
MDP0000267855  r..................................................................................
MDP0000195207  vg.................................................................................
MDP0000400145  t..................................................................................
MDP0000919183  kprvvvlgtgwaacrflkgldtkvydvvcisprnhmvftpllastcvgtlefrsvaepvshiqsamatspnsyfylascvgld
MDP0000307336  kr.................................................................................
MDP0000263146  kkll...............................................................................
MDP0000309730  r..................................................................................
MDP0000163903  s..................................................................................
MDP0000611628  hcvvigggptgvefsgelsdfimkdvqerfshvkdyikvtlieairnksldqgkfglpsntxxyfllilgmdlkcgpfhq...
MDP0000119779  s..................................................................................
MDP0000120904  g..................................................................................
MDP0000150544  k..................................................................................
MDP0000902209  r..................................................................................
MDP0000269370  gv.................................................................................
MDP0000146158  ekprvvvlgtgwaacrflkgldtkvydvvcisprnhmvftpllastcvgtlefrsvaepvsriqsalaaspssyfymascvgl
MDP0000124051  qvl................................................................................
MDP0000255696  ekkril.............................................................................
MDP0000305861  ekkril.............................................................................
MDP0000611628  kprvvvlgtgwaacrflkgldtkvydvvcisprnhmvftpllastcvgtlefrsvaepvsriqsalaxspssyfymascxgld
MDP0000309622  ...................................................................................
MDP0000239909  h..................................................................................
MDP0000126888  ...................................................................................
MDP0000869086  lqedgk.............................................................................
MDP0000317524  skn................................................................................
MDP0000160099  qiesl..............................................................................
MDP0000251205  nxiydsdplekiywdxvvlvgdaahpttphalrstnm..............................................
MDP0000314335  ermlripredefwsrgisacaicdg..........................................................
MDP0000638870  t..................................................................................
MDP0000790657  rer................................................................................
MDP0000748068  ...................................................................................
MDP0000727481  ...................................................................................
MDP0000301246  tsipypvfpggaligcsagflnvpkikgthtamksgmlaaeatfsllhegsrmekyw..........................
MDP0000190684  kvlf...............................................................................
MDP0000456223  ...................................................................................
MDP0000745172  ssydlsafkfdpikesivsremtrhymtdmityad................................................
MDP0000407932  ...................................................................................
MDP0000440896  ptnqgdgdncfisasy...................................................................
MDP0000694227  lvadergyehllhkmaedflfnsegkllds.....................................................
MDP0000123987  siilkkspssls.......................................................................
MDP0000138005  s..................................................................................
MDP0000258205  fdpstr.............................................................................
MDP0000245245  siilkkspssls.......................................................................
MDP0000306704  ikivhsnvhkvpttdmealkpllmglfekrrafkfiiyvq...........................................
MDP0000478654  t..................................................................................
MDP0000728219  merf...............................................................................
MDP0000170414  e..................................................................................
MDP0000284363  h..................................................................................
MDP0000219560  mgatwihgiggspvhkiaqeinprvsasvgvhgrvlrrahhrremwvgagtgcggphfvsvqeldglcsgeaeseyrmfpgee
MDP0000235930  mkr................................................................................
MDP0000755938  kivfkrsts..........................................................................
MDP0000138851  nkk................................................................................
MDP0000261638  ptnqdagdncfisasy...................................................................
MDP0000317524  qiesl..............................................................................
MDP0000294615  ptnqdagdncfisasy...................................................................
MDP0000208234  nkk................................................................................
MDP0000216129  ggdhcflpggngrlvhalaenvpilyerivntvrygsgrvqlc........................................
MDP0000219521  fseadk.............................................................................
MDP0000248995  pvneptldncfistsydatth..............................................................
MDP0000256328  kprvvvlgtgwaacrflkgldtkvydvvcisprnhmvftpllastcvgtlefrsvaepvsriqsalatspssyfymascagld
MDP0000181673  pvnepaldncfistsydatthf.............................................................
MDP0000169201  e..................................................................................
MDP0000263530  qieqkn.............................................................................
MDP0000295839  dgkn...............................................................................
MDP0000297466  ...................................................................................
MDP0000281982  tisppwdfvdtpcdyasycggcsqgssnymealksplmgliekliarkfily...............................
MDP0000053966  ptnqdagdncfisasy...................................................................
MDP0000795740  gng................................................................................
MDP0000212327  ...................................................................................
MDP0000437365  e..................................................................................
MDP0000135231  q..................................................................................
MDP0000167343  eadkg..............................................................................
MDP0000222306  eadkg..............................................................................
MDP0000183517  p..................................................................................
MDP0000686821  gkn................................................................................
MDP0000430157  ...................................................................................
MDP0000373054  grrvhvierdlsepdrivgellqpggylklielglegkqllkitanesidaqkvfgyalykngndtklsyrlknyasdivrrs
MDP0000295306  pvneptldncfistsydatt...............................................................
MDP0000233995  sgkn...............................................................................
MDP0000209681  gkn................................................................................
MDP0000876898  tmqnksmpaapqptpgaillgdafnmrhpltgggmtvalsdivllrdl...................................
MDP0000738522  gfaynlqqeddgttpvq..................................................................
MDP0000399642  egevspvktdxxilatgfrgdkklkdifvsptfqdyia.............................................
MDP0000215521  kilfkrsskxwfwsg....................................................................
MDP0000170521  ddnrvgplykhifppslapalsfvglpwkaepfpmfelqskwiagvlsnrialpsqqemmedvkafyssleasgtpkhythdi
MDP0000262982  rg.................................................................................
MDP0000321186  r..................................................................................
MDP0000266051  gle................................................................................
MDP0000837610  mpatpvptpgaillgdalnmrhpltgggmtvalsdivll............................................
MDP0000582079  gkn................................................................................
MDP0000538071  g..................................................................................
MDP0000241703  rplqrsplegfylagdytkqky.............................................................
MDP0000671114  sydlsafkfdpikesivsremtrxymtdmityad.................................................
MDP0000315388  tvtga..............................................................................
MDP0000134271  kvg................................................................................
MDP0000297581  grirfqrsildfeqrkrq.................................................................
MDP0000911003  ...................................................................................
MDP0000576650  m..................................................................................
MDP0000149205  fi.................................................................................
MDP0000315409  ptnqgdgdncfisavrmneflhlhliii.......................................................
MDP0000320804  ...................................................................................
MDP0000474647  t..................................................................................
MDP0000566648  t..................................................................................
MDP0000171379  ...................................................................................
MDP0000814529  t..................................................................................
MDP0000218295  gitkgwetkkk........................................................................
MDP0000220943  ...................................................................................
MDP0000795437  ihgripqlavigfseslsnlytsemrcrwvaellgrtftlpsikemekdvnewdgfak.........................
MDP0000919706  qnfgylkfvrnatdl....................................................................
MDP0000295675  t..................................................................................
MDP0000147542  t..................................................................................
MDP0000272126  aatls..............................................................................
MDP0000196881  ...................................................................................
MDP0000268346  mf.................................................................................
MDP0000147542  mf.................................................................................
MDP0000948298  rhpltgggmtvalsdivvlrnllrplhnlndapalckyl............................................
MDP0000220943  kgkilfkrsskwwfw....................................................................
MDP0000182589  mf.................................................................................
MDP0000557870  ivri...............................................................................
MDP0000308870  mfanglnpsydlsafkfdpikesivsremtrxyxtdxityad.........................................
MDP0000322449  litqalaavgcempvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygvcwkvfnasnslelksleepiy
MDP0000286494  t..................................................................................
MDP0000150868  rhpltgggmtvalsdivllrdllrplsdfndapalcd..............................................
MDP0000155608  nlsmgmestssglneqgnlakld............................................................
MDP0000168505  lpsvseeekkklls.....................................................................
MDP0000196888  satgvfl............................................................................
MDP0000154812  t..................................................................................
MDP0000186080  t..................................................................................
MDP0000220012  sc.................................................................................
MDP0000169409  s..................................................................................
MDP0000373095  fpghst.............................................................................
MDP0000235846  lrt................................................................................
MDP0000207126  gflffesqakwiaqllsgkttlpsrd.........................................................
MDP0000268357  seeekkklls.........................................................................
MDP0000770761  ...................................................................................
MDP0000149067  ppk................................................................................


                                                                                       10        20 
                                                                                        |         | 
d1cf3a1          ..............................................................----------KDVSGRTVDYI
MDP0000813172  ..............................................................-------------VDHTYDAV
MDP0000251581  ..............................................................-------------VDHTYDAV
MDP0000188391  ..............................................................-------------VDHTYDAV
MDP0000254144  ..............................................................-------------------VI
MDP0000321972  ..............................................................-------------------VI
MDP0000299806  ..............................................................-------------------VV
MDP0000283451  ..............................................................-------------------VV
MDP0000296714  ..............................................................-------------------II
MDP0000162193  ..............................................................-------------------II
MDP0000769741  ..............................................................-------------------VI
MDP0000295277  ..............................................................------------------DVV
MDP0000897124  ..............................................................------------------DVV
MDP0000854208  ..............................................................-----------------FDFA
MDP0000241767  ..............................................................-------------------II
MDP0000318858  ..............................................................-------------------VA
MDP0000248995  ..............................................................-------------MDEEYDVI
MDP0000442206  ..............................................................-------------------VA
MDP0000181673  ..............................................................-------------MDEEYDVI
MDP0000315409  ..............................................................-------------MDEEYDVI
MDP0000053966  ..............................................................-------------MDEEYDVI
MDP0000294615  ..............................................................-------------MDEEYDVI
MDP0000306147  ..............................................................-------------------II
MDP0000180064  ..............................................................---------------KNYDAI
MDP0000261625  ..............................................................-------------------VI
MDP0000300208  ..............................................................----------------DFDLF
MDP0000247171  ..............................................................------------------DVV
MDP0000308095  ..............................................................-------------------VA
MDP0000319421  ..............................................................-------------------IV
MDP0000232295  ..............................................................-------------SGKSFDYI
MDP0000188994  ..............................................................-------------------VV
MDP0000159189  ..............................................................-------------------VV
MDP0000656178  ..............................................................--------------SFDYDLL
MDP0000910523  ..............................................................------------------DVV
MDP0000119941  ..............................................................------------------DVV
MDP0000231799  ..............................................................--------------SFDYDLL
MDP0000255025  ..............................................................-------------------VA
MDP0000231632  ..............................................................-------------------VA
MDP0000173300  ..............................................................----------------KCDVI
MDP0000158474  ..............................................................-----------------YDYI
MDP0000276878  ..............................................................-------------------VA
MDP0000154720  ..............................................................-----------------YDIA
MDP0000549646  ..............................................................---------------ADTDVV
MDP0000158853  ..............................................................------------------RVV
MDP0000702799  ..............................................................------------------RVV
MDP0000233110  ..............................................................-----------------CDVV
MDP0000260827  ..............................................................----------------DVDVI
MDP0000941459  ..............................................................------------------RIV
MDP0000185338  ..............................................................-----------------YDYI
MDP0000451172  ..............................................................----------------HYDYI
MDP0000136847  ..............................................................-------------LQEKYDYI
MDP0000177641  ..............................................................---------------KSFDYI
MDP0000413935  ..............................................................----------------DVDVI
MDP0000206098  ..............................................................---------------ADTDVV
MDP0000845788  ..............................................................-------------------VV
MDP0000465595  ..............................................................---------------KSFDYI
MDP0000137211  ..............................................................-------------LQEEYDYI
MDP0000130099  ..............................................................--------------EEVYDYI
MDP0000425135  ..............................................................---------------DYYDYI
MDP0000200780  ..............................................................-------------------IV
MDP0000142434  ..............................................................-------------------IA
MDP0000248951  ..............................................................-------------LQEKYDYI
MDP0000869086  ..............................................................-------------------VC
MDP0000318256  ..............................................................---------------EEYDYI
MDP0000231634  ..............................................................-------------------VA
MDP0000626995  ..............................................................---------------ADTDVV
MDP0000123832  ..............................................................---------------------
MDP0000236092  ..............................................................---------------ADTDVV
MDP0000199159  ..............................................................-------------------VC
MDP0000162755  ..............................................................-------------------VV
MDP0000173666  ..............................................................-------------------VA
MDP0000262982  ..............................................................--------------------I
MDP0000184832  ..............................................................---------------KSFDYI
MDP0000598927  ..............................................................-----------------FDFA
MDP0000561228  ..............................................................-------------LEEVYDYI
MDP0000175650  ..............................................................-------------------VL
MDP0000233802  ..............................................................----------------RTKVC
MDP0000321186  ..............................................................---------------------
MDP0000161955  ..............................................................------------------DVV
MDP0000213381  ..............................................................------------------DVV
MDP0000168437  ..............................................................-----------------ADII
MDP0000823251  ..............................................................----------------RTKVC
MDP0000191389  ..............................................................------------------DVV
MDP0000199319  ..............................................................------------------DVV
MDP0000857446  ..............................................................------------------DVV
MDP0000266638  ..............................................................------------------DVV
MDP0000208936  ..............................................................----------------KCDVV
MDP0000202883  ..............................................................------------------DVV
MDP0000288439  ..............................................................---------------KSFDYI
MDP0000295839  ..............................................................----------------EVDVV
MDP0000903805  ..............................................................-------------LQEEYDYI
MDP0000202123  ..............................................................----------------DFDLF
MDP0000227773  ..............................................................-------------------VC
MDP0000317524  ..............................................................-------------------VC
MDP0000320748  ..............................................................------------------DVV
MDP0000634676  ..............................................................-----------------TDVV
MDP0000235846  ..............................................................----------------RTKVC
MDP0000251344  ..............................................................----------------RTKVC
MDP0000501957  ..............................................................------------------DVV
MDP0000209681  ..............................................................-----------------VQVI
MDP0000293482  ..............................................................-------------------AV
MDP0000233995  ..............................................................-----------------VQVV
MDP0000257243  ..............................................................-------------LQEEYDYI
MDP0000160099  ..............................................................-------------------VC
MDP0000193196  ..............................................................------------------DVV
MDP0000208234  ..............................................................-------------------VI
MDP0000251783  ..............................................................-------------LQEKYDYI
MDP0000686885  ..............................................................-----------------FDVI
MDP0000138851  ..............................................................-------------------VI
MDP0000194930  ..............................................................----------------KWDAL
MDP0000169201  ..............................................................-------------------VA
MDP0000399642  ..............................................................-------------------VA
MDP0000582079  ..............................................................-----------------VQVI
MDP0000129765  ..............................................................-------------------AV
MDP0000272655  ..............................................................-------------LQEEYDYI
MDP0000686821  ..............................................................-----------------VQVV
MDP0000170414  ..............................................................-------------------VA
MDP0000320804  ..............................................................-------------------VA
MDP0000189790  ..............................................................-----------------VDVI
MDP0000847111  ..............................................................-------------------VI
MDP0000289536  ..............................................................----------------EYDII
MDP0000123987  ..............................................................-------------------VA
MDP0000245245  ..............................................................-------------------VA
MDP0000188553  ..............................................................-------------------VI
MDP0000296599  ..............................................................-------------------VV
MDP0000746652  ..............................................................------------------DVV
MDP0000259265  ..............................................................-------------------VV
MDP0000151331  ..............................................................--------------GXKYDYI
MDP0000309775  ..............................................................-------------------IA
MDP0000232736  ..............................................................------------------HVI
MDP0000320539  ..............................................................-------------------YV
MDP0000239909  ..............................................................-------------------VA
MDP0000259264  ..............................................................-------------------VV
MDP0000293613  ..............................................................----------------PLDIL
MDP0000253362  ..............................................................----------------PLDIL
MDP0000182973  ..............................................................-----------------VDCV
MDP0000138005  ..............................................................-------------------VI
MDP0000261301  ..............................................................----------------TFDLI
MDP0000771633  ..............................................................--------------------A
MDP0000851102  ..............................................................--------------------A
MDP0000159873  ..............................................................-------------------VA
MDP0000140206  ..............................................................----------------SFKYV
MDP0000261201  ..............................................................-------------------VA
MDP0000252244  ..............................................................-------------------VA
MDP0000261821  ..............................................................---------------KNFKYV
MDP0000124454  ..............................................................------------------HVI
MDP0000234830  ..............................................................------------------DIL
MDP0000297861  ..............................................................---------------------
MDP0000152184  ..............................................................-------------------YV
MDP0000157871  ..............................................................--------------KKSFKYV
MDP0000250932  ..............................................................----------------RYDVI
MDP0000219521  ..............................................................---------------------
MDP0000239289  ..............................................................------------------DVI
MDP0000258995  ..............................................................------------------DCV
MDP0000167343  ..............................................................---------------------
MDP0000222306  ..............................................................---------------------
MDP0000829384  ..............................................................----------------TFDLI
MDP0000145663  ..............................................................-----------------LDVI
MDP0000288439  ..............................................................---------------KSFDYI
MDP0000267350  ..............................................................---------------------
MDP0000155608  cvvenkvlhssllscmqntdfqktvypsrlstmtlqprnlsmgmestssglneqgnlakldl---------------------
MDP0000194622  ..............................................................-----------------VDLA
MDP0000134271  ..............................................................---------------------
MDP0000312748  ..............................................................---------------KKWDAL
MDP0000197715  ..............................................................-----------------RDVV
MDP0000220943  ..............................................................---------------------
MDP0000320539  ..............................................................---------------------
MDP0000140206  ..............................................................---------------------
MDP0000215521  ..............................................................---------------------
MDP0000203847  ..............................................................---------------------
MDP0000201011  ..............................................................-------------------IA
MDP0000204596  ..............................................................---------------------
MDP0000148978  ..............................................................---------------KPLKVV
MDP0000130369  ..............................................................------------------KVV
MDP0000314606  ..............................................................----------------PLDIL
MDP0000263146  ..............................................................-------------------VV
MDP0000250583  ..............................................................------------------RIC
MDP0000208233  ..............................................................-------------------VI
MDP0000158720  ..............................................................--------------------V
MDP0000152184  ..............................................................---------------------
MDP0000182702  .............................eepiyhfgqffqkpvecltlayylpqnagdiac---------------------
MDP0000261638  ..............................................................-------------MDEEYDVI
MDP0000130370  ..............................................................------------------KVV
MDP0000272119  ..............................................................----------------TFDLI
MDP0000305861  ..............................................................-------------------IV
MDP0000255696  ..............................................................---------------------
MDP0000214280  ..............................................................--------------GXKYDYI
MDP0000210966  ..............................................................-----------------YDYI
MDP0000610999  ..............................................................----------------TFDLI
MDP0000242546  ..............................................................----------------TFDLI
MDP0000320742  ..............................................................--------------SIQYDVV
MDP0000654164  ..............................................................---------------------
MDP0000256300  ..............................................................---------------------
MDP0000235080  ..............................................................----------------TTKVA
MDP0000284363  ..............................................................-------------------VV
MDP0000125043  ........................................................lhkatg---------------------
MDP0000192359  ..............................................................---------------------
MDP0000440005  ..............................................................------------------KVV
MDP0000609131  ..............................................................-------------------VC
MDP0000362000  ..............................................................-------------------VV
MDP0000150210  ..............................................................----------------KWDAL
MDP0000158790  ..............................................................------------------DLV
MDP0000427950  ..............................................................---------------------
MDP0000569169  ..............................................................----------------PLDIL
MDP0000525742  ..............................................................-------------------VV
MDP0000559829  ..............................................................------------------DVV
MDP0000321788  .............................................cltlayylpqnagdiac---------------------
MDP0000919183  ..............................................................---------------------
MDP0000146158  ..............................................................---------------------
MDP0000832077  ..............................................................---------------------
MDP0000621365  ..............................................................--------------EEVYDYI
MDP0000875229  ..............................................................---------------------
MDP0000251344  ..............................................................------------------RIC
MDP0000168919  ..............................................................---------------------
MDP0000267855  ..............................................................-------------------YA
MDP0000195207  ..............................................................---------------------
MDP0000400145  ..............................................................---------------TTFDLI
MDP0000919183  ..........................................tdkhevycetvsngglshep---------------------
MDP0000307336  ..............................................................-------------------VA
MDP0000263146  ..............................................................---------------------
MDP0000309730  ..............................................................-------------------YA
MDP0000163903  ..............................................................---------------------
MDP0000611628  ..............................................................---------------------
MDP0000119779  ..............................................................---------------------
MDP0000120904  ..............................................................---------------------
MDP0000150544  ..............................................................----------------KWDAL
MDP0000902209  ..............................................................-------------------YA
MDP0000269370  ..............................................................---------------------
MDP0000146158  ........................................dtdkhevycetisngglshepy---------------------
MDP0000124051  ..............................................................------------------DYI
MDP0000255696  ..............................................................---------------------
MDP0000305861  ..............................................................---------------------
MDP0000611628  ........................................tdkhevycxtisngglshepyr---------------------
MDP0000309622  ..............................................................-----------------VDVI
MDP0000239909  ..............................................................---------------------
MDP0000126888  ..............................................................----------------RYDVI
MDP0000869086  ..............................................................---------------------
MDP0000317524  ..............................................................-------------------VC
MDP0000160099  ..............................................................---------------------
MDP0000251205  ..............................................................---------------------
MDP0000314335  ..............................................................---------------------
MDP0000638870  ..............................................................------------------DVV
MDP0000790657  ..............................................................---------------------
MDP0000748068  ..............................................................---------------------
MDP0000727481  ..............................................................---------------------
MDP0000301246  ..............................................................---------------------
MDP0000190684  ..............................................................---------------------
MDP0000456223  ..............................................................-------------MDEEYDVI
MDP0000745172  ..............................................................-----------------TGIV
MDP0000407932  ..............................................................---------------------
MDP0000440896  ..............................................................---------------------
MDP0000694227  ..............................................................---------------------
MDP0000123987  ..............................................................---------------------
MDP0000138005  ..............................................................-------------------VI
MDP0000258205  ..............................................................---------------SRLDVI
MDP0000245245  ..............................................................---------------------
MDP0000306704  ..............................................................---------------------
MDP0000478654  ..............................................................-------------------VC
MDP0000728219  ..............................................................---------------------
MDP0000170414  ..............................................................---------------------
MDP0000284363  ..............................................................---------------------
MDP0000219560  ..............................................................---------------------
MDP0000235930  ..............................................................-------------------VV
MDP0000755938  ..............................................................---------------------
MDP0000138851  ..............................................................-------------------VL
MDP0000261638  ..............................................................---------------------
MDP0000317524  ..............................................................---------------------
MDP0000294615  ..............................................................---------------------
MDP0000208234  ..............................................................-------------------VL
MDP0000216129  ..............................................................---------------------
MDP0000219521  ..............................................................---------------------
MDP0000248995  ..............................................................---------------------
MDP0000256328  ..........................................tdkhevycktisngglshxp---------------------
MDP0000181673  ..............................................................---------------------
MDP0000169201  ..............................................................---------------------
MDP0000263530  ..............................................................----------------TTRVA
MDP0000295839  ..............................................................-------------------VL
MDP0000297466  ..............................................................------------------DLV
MDP0000281982  ..............................................................---------------------
MDP0000053966  ..............................................................---------------------
MDP0000795740  ..............................................................---------------------
MDP0000212327  ..............................................................-----------------ADII
MDP0000437365  ..............................................................----------------EYDVV
MDP0000135231  ..............................................................----------------TFDVL
MDP0000167343  ..............................................................---------------------
MDP0000222306  ..............................................................---------------------
MDP0000183517  ..............................................................-------------------VL
MDP0000686821  ..............................................................-------------------VL
MDP0000430157  ..............................................................---------------------
MDP0000373054  ............................................................fh---------------------
MDP0000295306  ..............................................................---------------------
MDP0000233995  ..............................................................-------------------VL
MDP0000209681  ..............................................................-------------------VL
MDP0000876898  ..............................................................---------------------
MDP0000738522  ..............................................................---------------------
MDP0000399642  ..............................................................---------------------
MDP0000215521  ..............................................................---------------------
MDP0000170521  ..............................................................---------------------
MDP0000262982  ..............................................................---------------------
MDP0000321186  ..............................................................-------------------VC
MDP0000266051  ..............................................................---------------------
MDP0000837610  ..............................................................---------------------
MDP0000582079  ..............................................................-------------------VL
MDP0000538071  ..............................................................---------------------
MDP0000241703  ..............................................................---------------------
MDP0000671114  ..............................................................-----------------TGII
MDP0000315388  ..............................................................---------------------
MDP0000134271  ..............................................................---------------------
MDP0000297581  ..............................................................---------------------
MDP0000911003  ..............................................................-----------------FDVL
MDP0000576650  ..............................................................---------------------
MDP0000149205  ..............................................................----------------SVDCM
MDP0000315409  ..............................................................---------------------
MDP0000320804  ..............................................................---------------------
MDP0000474647  ..............................................................----------------SVDCV
MDP0000566648  ..............................................................----------------SVDCV
MDP0000171379  ..............................................................-------------MDEEYDVI
MDP0000814529  ..............................................................----------------SVDCV
MDP0000218295  ..............................................................-------------MFTSVDCV
MDP0000220943  ..............................................................---------------------
MDP0000795437  ..............................................................---------------------
MDP0000919706  ..............................................................------------PLQEEYDYI
MDP0000295675  ..............................................................----------------SVDCV
MDP0000147542  ..............................................................----------------SVDCV
MDP0000272126  ..............................................................---------------------
MDP0000196881  ..............................................................-----------------VDCV
MDP0000268346  ..............................................................---------------TSVDCV
MDP0000147542  ..............................................................---------------TSVDCV
MDP0000948298  ..............................................................---------------------
MDP0000220943  ..............................................................---------------------
MDP0000182589  ..............................................................---------------TSIDCV
MDP0000557870  ..............................................................---------------------
MDP0000308870  ..............................................................-----------------TGVV
MDP0000322449  ..................................hfgqffqkpvecltlayylpqnagdiac---------------------
MDP0000286494  ..............................................................----------------SVDCV
MDP0000150868  ..............................................................---------------------
MDP0000155608  ..............................................................---------------------
MDP0000168505  ..............................................................-------------------FV
MDP0000196888  ..............................................................----------TPEIEXSTDVV
MDP0000154812  ..............................................................----------------SVDCV
MDP0000186080  ..............................................................----------------SVDCV
MDP0000220012  ..............................................................-----------------TDVV
MDP0000169409  ..............................................................---------------------
MDP0000373095  ..............................................................---------------------
MDP0000235846  ..............................................................------------------RIC
MDP0000207126  ..............................................................---------------------
MDP0000268357  ..............................................................-------------------FV
MDP0000770761  ..............................................................---------------------
MDP0000149067  ..............................................................--------------SFDYDLL


                        30                       40                             50                  
                         |                        |                              |                  
d1cf3a1          IAGGGLTGLTTAARLTE....N...........PNI....S....VLVI...ES..........GSYE.SDR...........
MDP0000813172  VVGAGGAGLRAAIGLSE....-...........HGF....N....TACI...TKlfpt......R---.-SH...........
MDP0000251581  VVGAGGAGLRAAIGLSE....-...........HGF....N....TACI...TKlfpt......R---.-SH...........
MDP0000188391  VVGAGGAGLRAAIGLSE....-...........HGF....N....TACI...TKlfpt......R---.-SH...........
MDP0000254144  IVGAGLAGLAAARQLMQ....-...........LGF....K....VAVL...EG..........RNRP.GGRvytqkmgkdgk
MDP0000321972  VIGGGISGIAAARILHD....-...........ASF....K....VLLL...ES..........RDRL.GGR...........
MDP0000299806  IVGAGLAGLVAARQLVF....-...........LGF....K....VVVL...EG..........RSRP.GGRvktrkmvgere
MDP0000283451  IVGAGLAGLVAARQLVF....-...........LGF....K....VAVL...EG..........RSRP.GGRvktrkmvaere
MDP0000296714  VIGAGPAGLTAARHLQR....-...........QGF....S....VTIL...EA..........RSRI.GGRvytdr......
MDP0000162193  VIGAGPAGLTAARHLQR....-...........QGF....S....VTIL...EA..........RSRI.GGRvytdr......
MDP0000769741  VIGGGMAGVSAARALHD....-...........ASI....Q....VVLL...ES..........RDRL.GGR...........
MDP0000295277  VVGGGPGGYVAAIKAAQ....-...........LGL....K....TTCI...EK..........RGAL.GGTclnv.......
MDP0000897124  VVGGGPGGYVAAIKAAQ....-...........LGL....K....TTCI...EK..........RGAL.GGTclnv.......
MDP0000854208  VIGSGVAGLRYALEVAK....-...........HG-....S....VAVI...TK..........AEPH.ESN...........
MDP0000241767  VIGAGPAGLTAARHLQR....-...........QGF....S....VTIL...EA..........RSRI.GGRvytdr......
MDP0000318858  IVGSGPAGLAAADQLNR....-...........IGH....T....VTVY...ER..........ADRI.GGLmm.........
MDP0000248995  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGEcaslnlvql..
MDP0000442206  IVGSGPAGLAAADQLNR....-...........IGH....T....VTVY...ER..........ADRI.GGLmm.........
MDP0000181673  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGEcaslnlvql..
MDP0000315409  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGEstslnlnql..
MDP0000053966  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGEstslnlnql..
MDP0000294615  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGEstslnlnql..
MDP0000306147  VIGAGPAGLIAVCNLQR....-...........QGF....S....VTIL...EA..........RSRI.GGR...........
MDP0000180064  VIGSGIGGLVAATQLAV....-...........KGA....K....VLVL...EK..........YVIP.GGS...........
MDP0000261625  IVGAGVSGLSAAKVLIE....-...........NGVe...D....VVIL...EA..........SDRI.GGRirkqdfgg...
MDP0000300208  VIGAGSGGVRASRFSAN....-...........FGA....K....VGIC...ELpfhpvsseviGGVG.GTCvir........
MDP0000247171  IVGAGIAGLATAVALKR....-...........AGV....E....AXVL...EK..........SD--.---...........
MDP0000308095  IIGAGLAGMSTAVELLD....-...........QGH....E....VDIY...ES..........RPFI.GGKv..........
MDP0000319421  IVGGGICGLATALALHR....-...........KGI....R....SVVL...ER..........SNRL.PATgv.........
MDP0000232295  VIGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........GGSP.YGDplvld......
MDP0000188994  IVGAGIAGLSAALGLHR....-...........LGI....R....SLVL...ES..........SD--.---...........
MDP0000159189  IVGAGIAGLSAALGLHR....-...........LGI....R....SLVL...ES..........SD--.---...........
MDP0000656178  IIGAGVGGHGAALHAVE....-...........KGL....K....TAIV...EG..........DVVG.GTCvnr........
MDP0000910523  IVGAGIAGLATAVALKK....-...........AGL....K....ALVL...EK..........SD--.---...........
MDP0000119941  VVGGGPGGYVAAIKAAQ....-...........LGL....K....TTCI...EK..........RGAL.GGTclnv.......
MDP0000231799  IIGAGVGGHGAALHAVE....-...........KGL....K....TAIV...EG..........DVVG.GTCvnr........
MDP0000255025  IIGAGLAGMSTAVELLD....-...........QGH....E....VDIY...ES..........RPFI.GGKv..........
MDP0000231632  VVGAGVSGLAAAYKLKS....-...........HGF....D....VAVF...EA..........EGRA.GGK...........
MDP0000173300  IVGSGCGGGVAAAALAS....-...........SGH....K....VIVL...EK..........GNYF.---...........
MDP0000158474  VVGGGTAGCPLAATLSK....-...........-NF....N....VLVL...ER..........GGVP.FSNanv........
MDP0000276878  VIGAGMSGLVSAYVLAK....-...........EGV....E....VVVY...EK..........DDYL.GGH...........
MDP0000154720  IVGGGMVGMALACSLAKmpl.T...........KHL....K....VAII...DS..........NPAV.SNGlsikked....
MDP0000549646  VVGAGSAGLSCAYELSK....N...........PDV....Q....VAII...EQ..........SVSP.GG-...........
MDP0000158853  IIGAGMAGVTAANKLYT....A...........AGSkdlfE....LVVV...EG..........GERI.GGR...........
MDP0000702799  IIGAGMAGVTAANKLYT....A...........AGSkdlfE....LVVV...EG..........GERI.GGR...........
MDP0000233110  IVGSGCGGGVAAAVLAQ....-...........SGQ....K....VVVL...EK..........GNYF.V--...........
MDP0000260827  IVGAGVAGAALAHTLGK....-...........DGR....R....VHVI...ER..........DLTE.---...........
MDP0000941459  IIGAGMAGVTAANKLYT....A...........AGSkdlfE....LVVV...EG..........GERI.GGR...........
MDP0000185338  IVGGGTAGCPLAATLSS....-...........R-F....R....VLLL...ER..........GGVA.YGN...........
MDP0000451172  VIGGGTAGCPLAATLS-....-...........HGA....T....VLVL...ER..........GGSP.YGN...........
MDP0000136847  VVGGGTAGCPLAATLS-....-...........ANY....S....VLLL...ER..........GDIP.---...........
MDP0000177641  IVGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........GGSP.---...........
MDP0000413935  IVGAGVAGAALAHTLGK....-...........DGR....R....VHVI...ER..........DLTE.---...........
MDP0000206098  VVGAGSAGLSCAYELSK....N...........PDV....Q....VAII...EQ..........SVSP.GG-...........
MDP0000845788  IIGSGPAGFTAAIYAAR....-...........ANL....K....PLVF...EG..........YQSG.P--...........
MDP0000465595  VIGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........GGSP.YGN...........
MDP0000137211  VVGGGTAGCPLATTLS-....-...........ANY....S....VLLL...ER..........GDIP.---...........
MDP0000130099  VVGGGTAGCPLAATLS-....-...........LNY....S....VLVL...ER..........GSFP.A--...........
MDP0000425135  IVGGGTAGCPLAATLSS....-...........R-F....R....VLLL...ER..........GGVA.YGN...........
MDP0000200780  IVGAGIAGLATALSLHR....-...........LGV....G....SLVL...EQae........SLRT.GGT...........
MDP0000142434  IVGGGICGLATALALHR....-...........KGF....T....SVVL...ER..........SESL.RATgg.........
MDP0000248951  VVGGGTAGCPLAATLS-....-...........ANY....S....VLLL...ER..........GDIP.---...........
MDP0000869086  VIGAGPSGLVAARELRK....-...........EGH....K....VVVL...EQ..........NHDV.GGQwlydpnveged
MDP0000318256  VVGGGTAGCPLATTLS-....-...........ANY....S....VLLL...ER..........GNIP.---...........
MDP0000231634  VVGGGVSGLAAAYKLKS....-...........HGF....D....VAVF...EA..........EGRA.GGN...........
MDP0000626995  VVGAGSAGLSCAYELSK....N...........PDV....Q....VAII...EQ..........SVSP.GG-...........
MDP0000123832  ----GIAGLATAVALKR....-...........AGV....E....AXVL...EK..........SD--.---...........
MDP0000236092  VVGAGSAGLSCAYELSK....N...........PDV....Q....VAII...EQ..........SVSP.GG-...........
MDP0000199159  VIGAGPSGLVAARELRK....-...........EGH....S....VVVL...EQ..........NHDV.GGQwlydpnveged
MDP0000162755  IVGAGLSGLATSLGLHR....-...........LGI....R....SLVL...ES..........SD--.---...........
MDP0000173666  VVGAGVSGLAAAYKLKS....-...........HGF....D....VAVF...EA..........EGRA.GGK...........
MDP0000262982  IVGAGPSGLATAACLRD....-...........QGV....P....FVVF...ER..........AECI.ASL...........
MDP0000184832  IVGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........GG--.---...........
MDP0000598927  VIGSGVAGLRYALEVAK....-...........HG-....S....VAVI...TK..........AEPH.ESN...........
MDP0000561228  VVGGGTAGCPLAATLSS....-...........K-Y....S....VLVL...ER..........GSFP.---...........
MDP0000175650  IVGAGPVGLVLSILLTK....-...........LGV....K....CSVV...EK..........SKTF.SNHpqa........
MDP0000233802  IIGSGPAAHTAAIYAAR....-...........AEL....K....PILF...EGmman......D---.---...........
MDP0000321186  -----------------....-...........---....-....----...--..........----.---...........
MDP0000161955  IVGAGVAGAALAYTLAK....-...........DGR....R....VHVI...ER..........DLSE.---...........
MDP0000213381  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ERdl........NE--.---...........
MDP0000168437  VVGAGVVGSALAYTLGK....-...........DGR....R....VHVX...ERdlse......P---.---...........
MDP0000823251  IIGSGPAAHTAAIYAAR....-...........AEL....K....PILF...EGmman......D---.---...........
MDP0000191389  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........DLSE.---...........
MDP0000199319  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ERdl........NE--.---...........
MDP0000857446  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........DLSE.---...........
MDP0000266638  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ERdl........NE--.---...........
MDP0000208936  IVGSGCGGGVAAAVLAQ....-...........SGQ....K....VVVL...EK..........GNYF.V--...........
MDP0000202883  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........DLSE.---...........
MDP0000288439  IVGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........DT--.---...........
MDP0000295839  IVGAGPAGIATSACLNH....-...........LNI....S....NVVI...ER..........EDSY.ASL...........
MDP0000903805  VVGGGTAGCPLATTLS-....-...........ANY....S....VLLL...ER..........GNIP.---...........
MDP0000202123  TIGAGSGGVRASRFAAN....-...........FGA....S....VAVC...ELpfstissdtaGGVG.GTCvlr........
MDP0000227773  VIGAGPSGLVAARELRK....-...........EGH....R....VVVL...EQ..........NHEV.GGQwlydpnveged
MDP0000317524  VIGAGPSGLVAARELRN....-...........EGH....R....VVVL...EQ..........NHDV.GGQwlydpnveged
MDP0000320748  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........DLSE.---...........
MDP0000634676  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ERdl........NE--.---...........
MDP0000235846  IIGSGPAAHTAAIYAAR....-...........AEL....K....PILF...EGmmandiap..GGQL.TTT...........
MDP0000251344  IIGSGPAAHTAAIYAAR....-...........AEL....K....PILF...EGmmandiap..GGQL.TTT...........
MDP0000501957  IVGAGVAGAALAYTLGK....-...........EGX....R....VHVI...ERdl........NE--.---...........
MDP0000209681  IVGAGPAGLATSACLNH....-...........LKI....S....NVVL...ER..........EDCY.ASL...........
MDP0000293482  IVGGSIAGVSCAHTLIS....-...........AGW....D....VLLV...EK..........SYAP.P--...........
MDP0000233995  IVGAGPAGLATSACLNH....-...........LKI....P....NVVL...ER..........EDCY.ASL...........
MDP0000257243  VVGGGTAGCPLATTLS-....-...........ANY....S....VLLL...ER..........GN--.---...........
MDP0000160099  VIGAGPSGLVAARELRK....-...........EGH....R....VVVL...EQ..........NHEV.GGQwlydpnveged
MDP0000193196  IVGAGVAGAALAYTLGK....-...........EGX....R....VHVI...ERdl........NE--.---...........
MDP0000208234  IVGAGPSGLATAGCLSR....-...........LAI....P....YIIL...ER..........EDCF.ASL...........
MDP0000251783  VVGGGTAGCPLAATLS-....-...........ANY....S....VLLL...ER..........GDIP.---...........
MDP0000686885  VVGAGVMGSSTAYQTAK....-...........RGH....K....TLLL...EQ..........FDFL.HHRgsshgesr...
MDP0000138851  IVGAGTSGLAMAGCLSR....-...........LAI....P....YIIL...ER..........EDCF.ASL...........
MDP0000194930  VIGGGHNGLTAAAYLAR....-...........SGL....S....VAVL...ER..........RHVI.GGAavteelvp...
MDP0000169201  IVGAGISGLLACKYTLS....-...........KGF....Q....PIVF...ES..........TSSI.GGVwtktiestklq
MDP0000399642  IVGAGISGLLACKYTLS....-...........KGF....Q....PIVF...ES..........TSSI.GGVwtktiestklq
MDP0000582079  IVGAGPAGLATSACLNH....-...........LKI....S....NVVL...ER..........EDCY.ASL...........
MDP0000129765  IVGGSIAGVSCAHTLVL....-...........TGW....N....VLVV...EK..........SCAP.P--...........
MDP0000272655  VVGVGTAGCPLVTTLS-....-...........ANY....S....VLLL...ER..........GNIP.---...........
MDP0000686821  IVGAGPAGLATSACLNH....-...........LNI....T....NAVL...ER..........EDCY.ASL...........
MDP0000170414  IVGAGISGLLACKYTLS....-...........KRF....Q....PIVF...ES..........TSSI.GGVwiktvestklq
MDP0000320804  IIGAGISGLLACKYTLS....-...........KGF....H....PIVF...EN..........SSSI.GGVwt.........
MDP0000189790  IVGAGVAGSALAYTLGKi...VisyniicielqDGX....R....VHVI...ER..........DLTK.---...........
MDP0000847111  IVGAGPAGLATSACLNH....-...........LKI....S....NVVL...ER..........EDCY.ASL...........
MDP0000289536  VVGAGIMGSSTAYQTSK....-...........RSQ....K....TLLL...EQ..........FDFL.HHRgsshgesr...
MDP0000123987  IVGAGISGLLACKYTIS....-...........KGF....Q....PILF...ES..........TSSI.GGVwtktvestklq
MDP0000245245  IVGAGISGLLACKYTIS....-...........KGF....Q....PILF...ES..........TSSI.GGVwtktvestklq
MDP0000188553  VIGGGISGIAAARILHD....-...........ASF....K....VFLL...ES..........RDRL.GGR...........
MDP0000296599  VCGGGVIGVCAAYFLSK....-...........RGA....A....VTLV...EK..........SSVA.CAA...........
MDP0000746652  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........DLSE.---...........
MDP0000259265  IVGAGPSGIATSALLNS....-...........HSV....P....NLVF...ER..........EDCC.ASLwkkrs......
MDP0000151331  VVGGGTSGCPLAATLSA....-...........K-Y....S....VLVL...ER..........GXLP.T--...........
MDP0000309775  VVGSGPSGLFAALVLAE....-...........FGA....D....VTLL...ER..........GQPV.EQR...........
MDP0000232736  VIGHGLAGLAAARQMMR....-...........FGF....K....VTAL...EG..........RNRA.GGWvytkkmeggir
MDP0000320539  ILGGGVAAGYAALEFTK....-...........RGI....S....----...--..........----.HGE...........
MDP0000239909  VIGAGAGGLIAARELWR....-...........EGH....K....VVVF...ER..........EDQV.GGTwvytpkve...
MDP0000259264  IVGAGPSGIATSALLNS....-...........HSV....P....NLXF...ER..........EDCC.ASLwkkrs......
MDP0000293613  VIGGGATGSGVALDAVT....-...........RGL....R....VGLV...ER..........EDFS.SGT...........
MDP0000253362  VIGGGATGSGVALDAVT....-...........RGL....R....VGLV...ER..........EDFS.SGT...........
MDP0000182973  VIGAGVVGLAVARELAL....-...........KGR....E....VLVL...DS..........APTF.GTS...........
MDP0000138005  VIGGGISGIAAARILHD....-...........ASF....K....VFLL...ES..........RDRL.GGR...........
MDP0000261301  VVGTGLPATVIAAAASA....-...........AGK....T....VLHL...DR..........NHFY.GSQfaslhldqlt.
MDP0000771633  VIGAGPAGSSAAEALAT....-...........GGV....E....CFMF...ER..........SGPS.TAKpcg........
MDP0000851102  VIGAGPAGSSAAEALAT....-...........GGV....E....CFMF...ER..........SGPS.TAKpcg........
MDP0000159873  VIGGGPAGGAAAETLAK....-...........GGV....E....TFLI...ERkmdn......C---.---...........
MDP0000140206  IIGGGVAAGYAAREFVK....-...........QGL....K....----...--..........---P.GEL...........
MDP0000261201  VIGGGPAGGAAAETLAK....-...........GGV....E....TFLI...ERkmdn......CKPC.GGA...........
MDP0000252244  VIGGGPAGGAAAETLAK....-...........GGV....E....TFLI...ERkmdn......CKPC.GGA...........
MDP0000261821  ILGGGVSAGYAAREFAK....-...........QGLkpg.E....LAVI...SK..........EA--.---...........
MDP0000124454  VIGHGLAGLAAARQMMR....-...........FGF....K....VTAL...EG..........RNRA.GGWvytkkmeggir
MDP0000234830  VIGGGATGCGVALDATT....-...........RGL....R....VGLV...ER..........EDFS.SGT...........
MDP0000297861  -----------------....-...........---....-....----...--..........----.---...........
MDP0000152184  ILGGGVAAGYAALEFTK....-...........RGI....S....----...--..........----.HGE...........
MDP0000157871  IIGGGVAAGYAAREFVK....-...........QGL....-....----...EP..........GE--.--L...........
MDP0000250932  VVGGGHAGCEAAIASAH....-...........LGA....K....TLLL...TL..........N---.---...........
MDP0000219521  IIGAGVSGIAAAKQLAH....-...........--Y....N....PIIL...EA..........SDSI.GGVwrhc.......
MDP0000239289  VVGAGVAGAALALTLAK....-...........EGR....H....VHVI...ER..........DLTE.---...........
MDP0000258995  VVGGGISGLCIAQALAT....K...........HGDtvp.N....VIVT...EA..........RDRV.GGN...........
MDP0000167343  IIGAGVSGIAAAKQLAH....-...........--Y....N....PIIL...EA..........SDSI.GGVwrhc.......
MDP0000222306  IIGAGVSGIAAAKQLAH....-...........--Y....N....PIIL...EA..........SDSI.GGVwrhc.......
MDP0000829384  VVGTGLPATIIAAAASA....-...........SGK....T....VLHL...DR..........NHFY.GSQfaslqldelts
MDP0000145663  IIGTGPAGLRLAEQLSR....-...........YGI....K....VCCV...DP..........SPL-.---...........
MDP0000288439  IVGGGTAGCPLAATLSE....-...........K-F....S....VLLV...ER..........GGSP.YENplime......
MDP0000267350  -----------------....-...........---....-....----...--..........----.---...........
MDP0000155608  -----------------....-...........---....-....----...--..........----.---...........
MDP0000194622  VVGGGPAGLAVAQQVSE....-...........AGL....S....VCSI...DP..........SPKL.---...........
MDP0000134271  IIGAGISGIAAAKQL--....-...........SGH....S....PVVF...EA..........TNSI.GGVwrhc.......
MDP0000312748  VIGGGHNGLTAAAYLAR....-...........SGL....S....VAVL...ER..........RHVI.GGAavteelvpgfk
MDP0000197715  VVGSGCGGCVVAVVLAS....-...........SGH....K....VIVL...EK..........GNYF.T--...........
MDP0000220943  IIGAGISGIAAAKQL--....-...........SGH....S....PVVF...EA..........TDSI.GGVwkhc.......
MDP0000320539  -----------------....-...........---....-....----...--..........----.---...........
MDP0000140206  -----------------....-...........---....-....----...--..........----.---...........
MDP0000215521  IIGAGISGIVATKQL--....-...........LGH....N....PVVF...EA..........TDSI.GGVwkqc.......
MDP0000203847  IVGGGPSGLSSAYALVK....-...........XGYs...N....VTVL...EK..........HHTV.GGMcesvxiegk..
MDP0000201011  IVGGGPSGLSSAYALVK....-...........LGYs...N....VTVL...EK..........HHTV.GGMcesvdiegk..
MDP0000204596  -----------------....-...........---....-....----...--..........----.---...........
MDP0000148978  IAGAGLAGLATAKYLAD....-...........AGH....Q....PILL...EA..........RDVL.GGKdgglgiielsa
MDP0000130369  VVGSGWAGLGAAHHLCN....-...........QGF....D....VTVI...EQ..........GSGL.GVLhe.........
MDP0000314606  VIGGGATGSGVALDAVT....-...........RGL....R....VGLV...ER..........EDFS.SGT...........
MDP0000263146  VLGTGWAGVSFLKNLRS....-...........SSY....D....VEVV...SP..........KN--.---...........
MDP0000250583  ILGGGFGGLYTALRLESle..Wpdd........KKP....Q....VLLV...DQ..........SE--.---...........
MDP0000208233  IVGAGPSGLATAGCLSR....-...........LAI....P....YIVL...ER..........EDCF.ASL...........
MDP0000158720  VVGGGAAGVYGAIRAKTl...A...........PNL....N....VVII...EK..........GRPL.SKVkisgggr....
MDP0000152184  -----------------....-...........---....-....----...--..........----.---...........
MDP0000182702  -----------------....-...........---....-....----...--..........----.---...........
MDP0000261638  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGE...........
MDP0000130370  VVGSGWAGLGAAHHLCN....-...........QGF....D....VTVI...EQ..........GSGL.GVLhe.........
MDP0000272119  IIGTGLLGSVIAAAASA....-...........AGK....T....VLQL...DP..........YNSY.G--...........
MDP0000305861  VLGTGWAGTSFLRNLKN....-...........PNY....E....VQII...SP..........RNYF.---...........
MDP0000255696  VLGTGWAGTSFLRNLKN....-...........PNY....E....VQVI...SP..........RNYF.---...........
MDP0000214280  VVGGGTSGCPLAATLSA....-...........K-Y....S....VLVL...ER..........GXLP.T--...........
MDP0000210966  IVGGGTAGCPLAASLSQ....-...........-NY....S....VLLL...ER..........GGSP.YGN...........
MDP0000610999  VIGTGLPGSVIAAAAST....-...........AGK....A....VLHL...DT..........NQFY.GGHfaslplddlfp
MDP0000242546  VIGTGLPGSVIAAAAST....-...........AGK....A....VLHL...DT..........NQFY.GGHfaslplddlfp
MDP0000320742  IVGAGPAGLSAAIRMKQl...Crekd.......VDL....S....VCVV...EK..........GAEV.G--...........
MDP0000654164  -----------ATLAAQ....-...........LGL....K....TTCI...EK..........RGAL.DGTclnv.......
MDP0000256300  -----------------....-...........---....-....----...--..........----.---...........
MDP0000235080  VVGSGISGAVCASTLAR....-...........NGV....S....VTLF...ES..........ARGP.GGRmsqrr......
MDP0000284363  VLGTGWAGTSFLKYLDA....-...........SAY....D....VQVV...SP..........RNYF.A--...........
MDP0000125043  -----------------....-...........---....-....----...--..........----.---...........
MDP0000192359  -----------------....-...........---....-....----...--..........----.---...........
MDP0000440005  VVGGGVAGSLLAKSLQF....-...........-VA....D....FTLI...DE..........KE--.---...........
MDP0000609131  IIGSGIGGSSVAHFLRR....Yspph.......LNF....T....IRIF...ER..........NPVV.GGR...........
MDP0000362000  VLGSGWAGCRLMKGLDT....-...........EQY....D....IVCV...SP..........RN--.---...........
MDP0000150210  VIGGGHNGLTAAAYLAR....-...........SGL....S....VAVL...ER..........RHVI.GGAavteelvp...
MDP0000158790  VIGCGPAGLALAAESAK....-...........LGL....K....VGLI...--..........----.---...........
MDP0000427950  -----------------....-...........LGI....R....SLVL...ES..........SD--.---...........
MDP0000569169  VIGGGATGSGVALDAVT....-...........RGL....R....VGLV...ER..........EDFS.SGT...........
MDP0000525742  IIGSGPAGFTAAIYAAR....-...........ANL....K....PLVF...EG..........YQSGpGGQlmtt.......
MDP0000559829  IVGAXVAGAALAYTLGK....-...........EGR....R....VHVI...ER..........X---.---...........
MDP0000321788  -----------------....-...........---....-....----...--..........----.---...........
MDP0000919183  -----------------....-...........---....-....----...--..........----.---...........
MDP0000146158  -----------------....-...........---....-....----...--..........----.---...........
MDP0000832077  IIGAGISGIAAAKQL--....-...........SGH....S....PVVF...EA..........TDSI.GGVwkhc.......
MDP0000621365  VVGGGTAGCPLAATLSS....-...........-NY....S....VLVL...ER..........GSFP.---...........
MDP0000875229  -----------------....-...........---....-....----...--..........----.---...........
MDP0000251344  IIGGGLTAHTAAIYAAR....-...........ADL....K....PILF...EScmsnkixp..GGRL.TTT...........
MDP0000168919  -----------------....-...........---....-....----...--..........----.---...........
MDP0000267855  VLGAGFAGLSVAWHLLKqspkD...........SNI....R....VDIY...DE..........AGIG.GGA...........
MDP0000195207  IIGGGMAGLACALFLEK....-...........RGV....R....STVF...DT..........GIHG.LGGrlg........
MDP0000400145  VVGTGLPATIIAAAASA....-...........SGK....T....VLHL...DR..........NHFY.GSQ...........
MDP0000919183  -----------------....-...........---....-....----...--..........----.---...........
MDP0000307336  VVGAGVSGLAAAYKLKS....-...........HGF....D....VAVF...EA..........EGRA.GGK...........
MDP0000263146  -----------------....-...........---....-....----...--..........----.---...........
MDP0000309730  VLGAGFAGLSVAWHLLKqspkD...........SNI....R....VDIY...DE..........AGIG.GGA...........
MDP0000163903  -----------------....-...........---....-....----...--..........----.---...........
MDP0000611628  -----------------....-...........---....-....----...--..........----.---...........
MDP0000119779  -----------------....-...........---....-....----...--..........----.---...........
MDP0000120904  -----------------....-...........---....-....----...--..........----.---...........
MDP0000150544  VIGGGHNGLTAAAYLAR....-...........SGL....S....VAVL...ER..........RHVI.GGAavte.......
MDP0000902209  VLGAGFAGLSVAWHLLKqspkD...........SNI....R....VDIY...DE..........AGIG.GGA...........
MDP0000269370  -----------------....-...........---....-....----...--..........----.---...........
MDP0000146158  -----------------....-...........---....-....----...--..........----.---...........
MDP0000124051  TVGGGTAGCPLAATLSE....-...........K--....-....----...--..........----.---...........
MDP0000255696  -----------------....-...........---....-....----...--..........----.---...........
MDP0000305861  -----------------....-...........---....-....----...--..........----.---...........
MDP0000611628  -----------------....-...........---....-....----...--..........----.---...........
MDP0000309622  IVGAGVAGSALAYTLGK....-...........DGR....R....VHVI...ER..........DLTK.---...........
MDP0000239909  -----------------....-...........---....-....----...--..........----.---...........
MDP0000126888  VVGGGHAGCEAAIASAH....-...........LGA....K....TLLL...--..........----.---...........
MDP0000869086  -----------------....-...........---....-....----...--..........----.---...........
MDP0000317524  VIGAGPSGLVAARELRN....-...........EGH....R....VVVL...EQ..........NHDV.GGQwlydpnveged
MDP0000160099  -----------------....-...........---....-....----...--..........----.---...........
MDP0000251205  -----------------....-...........---....-....----...--..........----.---...........
MDP0000314335  -----------------....-...........---....-....----...--..........----.---...........
MDP0000638870  IVGAGVAGAALAYTLGK....-...........EGR....R....VHVI...ERdlse......P---.---...........
MDP0000790657  -----------------....-...........---....-....----...--..........----.---...........
MDP0000748068  -----------------....-...........---....-....----...--..........----.---...........
MDP0000727481  -----------------....-...........---....-....----...--..........----.---...........
MDP0000301246  -----------------....-...........---....-....----...--..........----.---...........
MDP0000190684  -----------------....-...........---....-....----...--..........----.---...........
MDP0000456223  VLGTGLKECILSGLLSV....-...........DGL....K....VLHM...DR..........NDYY.GGE...........
MDP0000745172  LVGAGSAGLSCAYELSK....N...........PDV....Q....VAIT...EQ..........SVSL.GG-...........
MDP0000407932  -----------------....-...........---....-....----...--..........----.---...........
MDP0000440896  -----------------....-...........---....-....----...--..........----.---...........
MDP0000694227  -----------------....-...........---....-....----...--..........----.---...........
MDP0000123987  -----------------....-...........---....-....----...--..........----.---...........
MDP0000138005  VIGGGISGIAAARILHD....-...........ASF....K....VFLL...ES..........RDRL.GGR...........
MDP0000258205  IIGTGPAGLRLAEQVSR....-...........YDI....K....VCSV...DP..........SPL-.---...........
MDP0000245245  -----------------....-...........---....-....----...--..........----.---...........
MDP0000306704  -----------------....-...........---....-....----...--..........----.---...........
MDP0000478654  IIGSGIGGSSVAHFLRR....Yspph.......LNF....T....IRIF...ER..........NPVV.GGR...........
MDP0000728219  -----------------....-...........---....-....----...--..........----.---...........
MDP0000170414  -----------------....-...........---....-....----...--..........----.---...........
MDP0000284363  -----------------....-...........---....-....----...--..........----.---...........
MDP0000219560  -----------------....-...........---....-....----...--..........----.---...........
MDP0000235930  VIGGGVGGSVVAHSLQ-....-...........FCA....D....VVLV...DQ..........KEY-.---...........
MDP0000755938  -----------------....-...........---....-....----...--..........----.---...........
MDP0000138851  VVGAGNSGMEISLDLAN....-...........HGA....K....TSII...VR..........SP--.---...........
MDP0000261638  -----------------....-...........---....-....----...--..........----.---...........
MDP0000317524  -----------------....-...........---....-....----...--..........----.---...........
MDP0000294615  -----------------....-...........---....-....----...--..........----.---...........
MDP0000208234  VVGAGNSGMEISLDLAN....-...........HGA....K....TSII...VR..........SPV-.---...........
MDP0000216129  -----------------....-...........---....-....----...--..........----.---...........
MDP0000219521  -----------------....-...........---....-....----...--..........----.---...........
MDP0000248995  -----------------....-...........---....-....----...--..........----.---...........
MDP0000256328  -----------------....-...........---....-....----...--..........----.---...........
MDP0000181673  -----------------....-...........---....-....----...--..........----.---...........
MDP0000169201  -----------------....-...........---....-....----...--..........----.---...........
MDP0000263530  VVGSGIPGAVCASTLGR....-...........NGV....S....VTLL...ES..........ARVP.GRR...........
MDP0000295839  VVGSGNSGMEIAYDLTN....-...........WGA....N....TSIV...VR..........SP--.---...........
MDP0000297466  VIGWGPAGLALAAESAK....-...........LGV....K....VGLI...--..........----.---...........
MDP0000281982  -----------------....-...........---....-....----...--..........----.---...........
MDP0000053966  -----------------....-...........---....-....----...--..........----.---...........
MDP0000795740  -----------------....-...........---....-....----...--..........----.---...........
MDP0000212327  VVGAG------------....Q...........DGR....R....VHVV...ERdlse......PDRI.VGE...........
MDP0000437365  VVGSGYGGSVVACRLSM....A...........GGR....S....VCLL...EK..........GR--.---...........
MDP0000135231  VIGAGIIGLTIARQFLI....G...........SDL....S....VAVI...DK..........SVPC.SGAtgagq......
MDP0000167343  -----------------....-...........---....-....----...--..........----.---...........
MDP0000222306  -----------------....-...........---....-....----...--..........----.---...........
MDP0000183517  IVGAAPVGLVLPLLLTK....-...........LGV....K....CSVV...EK..........SEAF.SNHpqv........
MDP0000686821  VVGSGNSGMEIAYDLSN....-...........SGA....N....TSIV...VR..........SP--.---...........
MDP0000430157  -----------------....-...........---....-....----...--..........----.---...........
MDP0000373054  -----------------....-...........---....-....----...--..........----.---...........
MDP0000295306  -----------------....-...........---....-....----...--..........----.---...........
MDP0000233995  VVGSGNSGMEIAYDLSN....-...........SGA....N....TSIV...VR..........SP--.---...........
MDP0000209681  VVGSGNSGMEIAYDLSN....-...........SGA....N....TSIV...VR..........SP--.---...........
MDP0000876898  -----------------....-...........---....-....----...--..........----.---...........
MDP0000738522  -----------------....-...........---....-....----...--..........----.---...........
MDP0000399642  -----------------....-...........---....-....----...--..........----.---...........
MDP0000215521  -----------------....-...........---....-....----...--..........----.---...........
MDP0000170521  -----------------....-...........---....-....----...--..........----.---...........
MDP0000262982  -----------------....-...........---....-....----...--..........----.---...........
MDP0000321186  VVGSGPAGFYTAEKMXKa...H...........QEA....E....VDII...DR..........LPXP.FGLvr.........
MDP0000266051  -----------------....-...........---....-....----...--..........----.---...........
MDP0000837610  -----------------....-...........---....-....----...--..........----.---...........
MDP0000582079  VVGSGNSGMEIAYDLSN....-...........SGA....N....TSIV...IR..........SP--.---...........
MDP0000538071  -----------------....-...........---....-....----...--..........----.---...........
MDP0000241703  -----------------....-...........---....-....----...--..........----.---...........
MDP0000671114  VVGXGSAXLSCTYELSK....K...........PDV....Q....VAIT...EQ..........SVSX.GG-...........
MDP0000315388  -----------------....-...........---....-....----...--..........----.---...........
MDP0000134271  IIGAGISGIAAAKQL--....-...........SGH....S....PVVF...EA..........TNSI.GGVwrhc.......
MDP0000297581  -----------------....-...........---....-....----...--..........----.---...........
MDP0000911003  ICG-GTLGIFIATALCA....-...........KGL....R....VGIV...ER..........NVLK.GREqe.........
MDP0000576650  VVGGGISGLCIAQVLATk...H...........NDTvp..N....VIVT...EA..........RDRM.GGN...........
MDP0000149205  VVGGGISGLCFAQVLATk...H...........DDTvp..N....VIVT...EA..........RDRM.GGN...........
MDP0000315409  -----------------....-...........---....-....----...--..........----.---...........
MDP0000320804  -----------------....-...........---....-....----...--..........----.---...........
MDP0000474647  VVGGGISGLCIAQVLATk...H...........SDAip..I....VIVT...EA..........KDQV.GGN...........
MDP0000566648  VVGGGISGLCIAQVLAT....K...........HGD....A....VPIIivtEA..........KDQV.GGN...........
MDP0000171379  VLGTGLKECILSGLLSV....-...........DGL....K....VNIL...D-..........----.---...........
MDP0000814529  VVGGGISGLCIAQVLATk...H...........SDAip..I....VIVT...EA..........KDQV.GGN...........
MDP0000218295  VVGGGISGLCIAQVLAT....K...........HGD....A....VPIIivtEA..........KDQV.GGN...........
MDP0000220943  IIGAGISGIAAAKQL--....-...........SGH....S....PVVF...EA..........TDSI.GGVwkhc.......
MDP0000795437  -----------------....-...........---....-....----...--..........----.---...........
MDP0000919706  VVGGGTAGCPLAATLS-....-...........---....-....----...--..........----.---...........
MDP0000295675  VVGGGISGLCIAQVLATk...H...........SDAip..I....VIVT...EA..........KDQV.GGN...........
MDP0000147542  VVGGGISGLCIAQVLAT....-...........KHG....DvvpiVIVT...EA..........KDHV.GGN...........
MDP0000272126  -----------------....-...........HGA....S....FLVL...ER..........GGSP.YGN...........
MDP0000196881  VVGGGINGLCIAQVLAT....K...........HGDvvp.N....VIVT...EA..........RDRV.GGN...........
MDP0000268346  VVGGGISGLCVAQVLAT....K...........HGD....-....----...--..........----.---...........
MDP0000147542  VVGGGISGLCIAQVLAT....-...........KHG....DvvpiVIVT...EA..........KDHV.GGN...........
MDP0000948298  -----------------....-...........---....-....----...--..........----.---...........
MDP0000220943  -----------------....-...........---....-....----...--..........----.---...........
MDP0000182589  VVGGGISGLCIAQVLAT....-...........KHG....-....----...--..........----.---...........
MDP0000557870  -----------------....-...........---....-....----...--..........----.---...........
MDP0000308870  VVDAGFARLSYTYEXNK....N...........PDV....Q....VAIT...EQ..........SVSP.SG-...........
MDP0000322449  -----------------....-...........---....-....----...--..........----.---...........
MDP0000286494  VVGGGISGLCVAQVLAT....K...........HGD....A....VLIV...--..........----.---...........
MDP0000150868  -----------------....-...........---....-....----...--..........----.---...........
MDP0000155608  -----------------....-...........---....-....----...--..........----.---...........
MDP0000168505  CVGGGPVGVEFAAELHD....-...........---....-....----...--..........----.---...........
MDP0000196888  IVGAGVAGAALAYTLGK....-...........---....-....----...--..........----.---...........
MDP0000154812  VVGGGISGLYVAQVLAT....K...........HGD....A....VLIV...--..........----.---...........
MDP0000186080  VVGGGISGLYVAQVLAT....K...........HGD....A....VLIV...--..........----.---...........
MDP0000220012  IVGAGVAGAALAYTLGK....-...........---....-....----...--..........----.---...........
MDP0000169409  -----------------....-...........---....-....FLVL...ER..........GGSP.YGN...........
MDP0000373095  -----------------....-...........---....-....----...--..........----.---...........
MDP0000235846  VIGSGLPAHTAAVYAAR....-...........AEL....K....PILA...LRglhvq.....QNRP.GGR...........
MDP0000207126  -----------------....-...........---....-....----...--..........----.---...........
MDP0000268357  CVGGGPVGVEFAAELHD....-...........---....-....----...--..........----.---...........
MDP0000770761  -----------------....-...........---....-....----...--..........----.---...........
MDP0000149067  IIGAGVGGHGAALHVVK....-...........---....-....----...--..........----.---...........


                             60           70           80                                           
                              |            |            |                                           
d1cf3a1          ..........GPIIEDL...NAYGDIFGSSV...DHAYETVE.........................................
MDP0000813172  ..........TVAAQGGinaALGNMTEDDWR...WHMYDTV-.........................................
MDP0000251581  ..........TVAAQGGinaALGNMTEDDWR...WHMYDTV-.........................................
MDP0000188391  ..........TVAAQGGinaALGNMTEDDWR...WHMYDTV-.........................................
MDP0000254144  ..fsavdlggS------...---------VI...TGIHANPLgvlarqlsiplhkvrdkcplykpdgtpvnkdidsnieiifn
MDP0000321972  ..........IHTDYSF...GCPVDMGASWL...HGVCNENPlaplirrlgltlyrtsgddsvlydhdlesfal.........
MDP0000299806  ......gveaA------...---ADLGGSVL...TGINGNPLgvlarq...................................
MDP0000283451  ......gveaA------...---ADLGGSVL...TGINGNPLgvlarq...................................
MDP0000296714  ..........S-----Sl..SVPVDLGASII...TGVEADWAterrpdpsslvcaqlgleltvlnsdcplydiatgekvpadl
MDP0000162193  ..........S-----Sl..SVPVDLGASII...TGVEADWAterrpdpsslvcaqlgleltvlnsdcplydiat........
MDP0000769741  ..........VCTDYSF...GFPIDLGASWL...HGVCKENPlapligrlglplyrtsgdnsvlydhdlesy...........
MDP0000295277  ..........GCIPSKA...LLHSSHMYYEA...KHAFSHHGvkfsd....................................
MDP0000897124  ..........GCIPSKA...LLHSSHMFHEA...KHAFSHHGvkfsn....................................
MDP0000854208  ..........TNYAQGG...VSAVLSQSDSVe..SHMQDTIV.........................................
MDP0000241767  ..........S-----Sl..SVPVDLGASII...TGVEADWAterrpdpsslvcaqlgleltvlnsdcply............
MDP0000318858  ..........YGVPNMK...TDKVEIVQRRV...NLMTEEGV.........................................
MDP0000248995  ..........WKRFRGD...DKPPAHLGSSR...DYNVDMVPkfmmangtlvr..............................
MDP0000442206  ..........YGVPNMK...TDKKEIVQRRV...NLMAEEGV.........................................
MDP0000181673  ..........WKRFRGD...DKPPAHLGSSR...DYNVDMVPkfmmangtlvr..............................
MDP0000315409  ..........WKXFRGE...DKPPETLGSSR...EYNVDMIPkfmmangalvrvlihtdvtkyln..................
MDP0000053966  ..........WKRFRGE...DKPPETLGSSK...DYNVDMIPkfmmangglvrvlihtnvt......................
MDP0000294615  ..........WKRFRGE...DKPPETLGSSK...DYNVDMIPkfmmangglvrvlihtnvt......................
MDP0000306147  ..........VYTDRLSl..SVPVDLGASII...TGVEADWAterrpdpsslvcaqlgleltvlnsdcply............
MDP0000180064  ..........SGYYERD...GYTFDVGSSVM...FGFSDKVVsyyheehcvlvetcthgnvtadihysishrhatgnlnlitq
MDP0000261625  ..........VSVELGA...GWIVGVGGXEL...NPVLDLALksnlrtifsdysnaryniydrsgkifprglveetykkeves
MDP0000300208  ..........GCVPKKI...LVYGASFGGEI...EDARNYGWevnek....................................
MDP0000247171  ..........GLRATGA...A---LTLFPNA...WCALDALG.........................................
MDP0000308095  ..........GSFVDKK...GNHIEMGLHVF...FGCYSNLFrlmkkvgadenl.............................
MDP0000319421  ..........AIIVHLN...GWRALDQLGVA...SLLRQTSF.........................................
MDP0000232295  ..........T------...-----------...---KYYGFsllrtdqytsvaq............................
MDP0000188994  ..........SXRXTGF...XLTTWTNAWKA...LDALGTGDtlrqqhgalrgnvts..........................
MDP0000159189  ..........SXRXTGF...XLTTWTNAWKA...LDALGTGDtlrqqhgalrgnvts..........................
MDP0000656178  ..........GCVPSKA...LLAVSGRMRELqneHHLKALGLqvsa.....................................
MDP0000910523  ..........SLRVTGA...AL---TLFPNA...WCALDALG.........................................
MDP0000119941  ..........GCIPSKV...SLFSLLLAPTV...PYLPARALlhsshmyyeakhafshhgvkfsd..................
MDP0000231799  ..........GCVPSKA...LLAVSGRMRELqneHHLKALGLqvsa.....................................
MDP0000255025  ..........GSFVDKK...GNHIEMGLHVF...FGCYSNLFrlmkkvdnfcllelllhlai.....................
MDP0000231632  ..........LRSVSRD...GLVWDEGANTM...TESETEVQtlldnlglrekqqfpisqtkryivrngmpvllptnpialit
MDP0000173300  ..........-------...--TPSDYSSLE...APSHDHLYesggi....................................
MDP0000158474  ..........SFLQNFH...IALADTSPTSA...SQ------.........................................
MDP0000276878  ..........ARTVTFD...GVDLDLGFMVFn..RVNVKELIxydarltipvflktglqvtypnmmeffeslgvdmetsdmsf
MDP0000154720  ..........P-----P...DPRVSTVTPVTi..SLFKDIGAwkyveqnrh................................
MDP0000549646  ..........GAWLGGQ...LFSAMVVRKPA...HLFLNELG.........................................
MDP0000158853  ..........INTSEFG...GDRIEMGATWI...HGIEGSPVhkiaqeinaleseqpwecmdgssdepttvaegg........
MDP0000702799  ..........INTSEFG...GDRIEMGATWI...HGIEGSPVhkiaqeinaleseqpwecmdgssdepttvaegg........
MDP0000233110  ..........------P...KDYSSLEGPSM...SELYESGGi........................................
MDP0000260827  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCV.........................................
MDP0000941459  ..........INTSEFG...GDRIEMGATWI...HGIGGSPVhkiaqeinalexahpwecmdgssde................
MDP0000185338  ..........RNLMTKE...GFLATLMDVNS...LDSPTQ--.........................................
MDP0000451172  ..........PNIINID...KFAPTLLDTSP...TSPAQ---.........................................
MDP0000136847  ..........TAYPNVLs..NAGILANFMQE...DDGKTP-Aq........................................
MDP0000177641  ..........--YEXPL...IMENKNYG---...-------Lslvqtdeytsvaq............................
MDP0000413935  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCV.........................................
MDP0000206098  ..........GAWLGGQ...LFSAMILTDRH...VDRMQQVV.........................................
MDP0000845788  ..........-------...------GGQLMtt.TEVENFPGfp.......................................
MDP0000465595  ..........PLVLDTK...YYGFSLLQTDQ...-------Ytsvaq....................................
MDP0000137211  ..........TTYPSVS...TVEGILENFMLe..DDGTTP-Lq........................................
MDP0000130099  ..........-SYPNVLt..QDGFIYNLQQE...DDGE---Tpvq......................................
MDP0000425135  ..........RNLMTRE...GFLATLMD--V...NSFDSPTQ.........................................
MDP0000200780  ..........SLTLFKN...GWRVXDAIGVG...NHLRTQFLeiqgmvv..................................
MDP0000142434  ..........GITIRAN...GWRALDELGVA...SKLRQTAL.........................................
MDP0000248951  ..........TAYPNVLs..NAGILANFMQE...DDGKTP-Aq........................................
MDP0000869086  ........plGRVPTL-...-----------...-------Kvhsslytslrlisprei........................
MDP0000318256  ..........SAYPNVL...RQNETLANFM-...-------Qeddgktpaq................................
MDP0000231634  ..........LRSVSRD...DLIWDEGANLM...VFSQTESEtevqtlldnlglrekqqfpisqtkryivrngtpvllptxpi
MDP0000626995  ..........GAWLGGQ...LFSAMVVRKPA...HLFLNELG.........................................
MDP0000123832  ..........GLRATGA...A---LTLFPNA...WCALDALG.........................................
MDP0000236092  ..........GAWLGGQ...LFSAMVVRKPA...HLFLNELG.........................................
MDP0000199159  ..........PLGRSPT...LKVHSSLYTSL...-------Rlisprei..................................
MDP0000162755  ..........SLRTTGF...ALTTWTNAWKA...LDALGIGDslrqqhvtldg..............................
MDP0000173666  ..........LRSVSRD...GLVWDEGANTM...TESETEVQtlldnlglrekqqfpisqtkryivrngmpvllptnpialit
MDP0000262982  ..........------Wq..KRTYDRLKLHL...PKAFCQLPkf.......................................
MDP0000184832  ..........SPYENPL...IMENKNFGLSL...VQTDEYTSvaq......................................
MDP0000598927  ..........TNYAQGG...VSAVLSLSDSVe..SHVQDTIV.........................................
MDP0000561228  ..........TSYPNVL...TQEGFIYNLQQ...EDDG---Etpvq.....................................
MDP0000175650  ..........HFINNRS...MEVFRKLDGL-...-------Aeeiqrsqppvd..............................
MDP0000233802  ..........-------...-IAPGGQLTTT...TDVENFPGfp.......................................
MDP0000321186  ..........-------...-----------...--------.........................................
MDP0000161955  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000213381  ..........PDRIVGE...LLQPGGYLKLIe..LGLEDXAN.........................................
MDP0000168437  ..........-DRIVGE...LLQPGGYLRLV...ELGLEDCV.........................................
MDP0000823251  ..........-------...-IAPGGQLTTT...TDVENFPGfp.......................................
MDP0000191389  ..........PDRIVGE...LLQPGGYLKLIe..LGLADCAN.........................................
MDP0000199319  ..........PDRIVGE...LLQPGGYLKLIe..LGLEDXAN.........................................
MDP0000857446  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000266638  ..........PDRIVGE...LLQPGGYLKLIe..LGLEDXAN.........................................
MDP0000208936  ..........------P...KDYSSLEGPSM...NELYESGGi........................................
MDP0000202883  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000288439  ..........-------...--RSYLDLSLFv..SRVLSHLRekrrftgk.................................
MDP0000295839  ..........W------...--RKRSYDRL-...-------Klhlakqfcelpympfppnyprylsknefvqyle........
MDP0000903805  ..........SAYPNVL...LANGTFANFMQ...EDDGKTPAq........................................
MDP0000202123  ..........GCVPKKL...LVYASKFAHEF...EESNGFGWryeie....................................
MDP0000227773  ..........P-----L...GRSPTL-----...-------Kvhsslysslriispres........................
MDP0000317524  .........pL------...GRAPTL-----...-------Kvhsslytslrlmlprei........................
MDP0000320748  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000634676  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000235846  ..........TDVENFP...GFP--------...--------.........................................
MDP0000251344  ..........TDVENFP...GFP--------...--------.........................................
MDP0000501957  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000209681  ..........WKKXS--...--YDRLKLHLA...KEF----Celpym....................................
MDP0000293482  ..........TGSPTGA...GLGLDPLSLRLiq.SWIQDPDLlhkatlp..................................
MDP0000233995  ..........W----KK...KSYDRLKLHLA...KEF----Celpym....................................
MDP0000257243  ..........-------...--IPSAYPNVL...HDGKTPAQ.........................................
MDP0000160099  ..........P-----L...GRSPTL-----...-------Kvhsslysslriispres........................
MDP0000193196  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000208234  ..........WKKYSYD...RLHLHLQKQFC...-----ELPhmsfptscptyv.............................
MDP0000251783  ..........TAYPNVLs..NAGILANFMQE...DDGKTP-Aq........................................
MDP0000686885  ..........TIRATYPe..DYYTPLVLES-...---YKLWQqaeseigynvyfkanqldmapan..................
MDP0000138851  ..........WTKYSYD...RLHLHLRKQFC...----EL-Phmsfptsyp................................
MDP0000194930  ..........G------...-FKFSRCSYLQ...SLLRPSIIkelelprhglkllkg..........................
MDP0000169201  ..........T------...---PKPLYQFS...DFPWPSSVeedfpsqhqvldyiqsya.......................
MDP0000399642  ..........T------...---PKPLYQFS...DFPWPSSVeedfpsqhqvldyiqsya.......................
MDP0000582079  ..........WKKRSYD...----RLKLHLA...KEF----Celpymtfppnaptyi..........................
MDP0000129765  ..........TGSQTGA...GLGLDPLSLRLiq.SWIQDPELlh.......................................
MDP0000272655  ..........SAYPNVL...CQNETLANFMQe..DDGKTP-Vq........................................
MDP0000686821  ..........W----KK...KSYDRLKLHL-...-------Akqfcelpym................................
MDP0000170414  tpkplyqfsdFPWPSS-...-----------...-------Vexdfpsqhqvldyiqsya.......................
MDP0000320804  ..........K--TVETtk.IQTPKEFYQFS...DFPWPSSVteghpdqnqvlnyiqsya.......................
MDP0000189790  ..........PDRIVGE...LLQPGAYLRLI...ELGLEDCV.........................................
MDP0000847111  ..........WKKRSYD...----RLKLHLA...KEF----Celpymtfpxnaptyi..........................
MDP0000289536  ..........TIRATYP...EDYYXPLV---...MESYKLWQqaeseigynvyfkahqldm......................
MDP0000123987  ......tpkpV------...-------YQFS...DFPWPSSVeedfpsqhqvldyiqsya.......................
MDP0000245245  ......tpkpV------...-------YQFS...DFPWPSSVeedfpsqhqvldyiqsya.......................
MDP0000188553  ..........IHTDYSF...GCPVDMGASWL...HGVCNENPlaplirrlgltlyrtsgddsvlydhdlesfal.........
MDP0000296599  ..........SGKAGGFl..ALDWCDGKPLA...SLARASFHlhlsla...................................
MDP0000746652  ..........PDRIVGE...LLQPGGYLKLI...ELGLEDCAn........................................
MDP0000259265  ..........YDRLNLH...LAKGYCSLPLM...PHSFRTSTfmskydfiayld.............................
MDP0000151331  ..........-AYPNXLn..QDGFLYXLX--...-------Qeddgntpvq................................
MDP0000309775  ..........GRDIGAL...VVRRMLQTESN...FCFGEGGA.........................................
MDP0000232736  ..egvaadlgG------...--------SVL...TGTLGNPLgivarqlgyvlhkvrdkclp.....................
MDP0000320539  ..........LCIISEE...SVPPYERPALS...---KGFLL.........................................
MDP0000239909  ..........S------...--DPIGIHPNR...TTVHSSMYeslrtnlprev..............................
MDP0000259264  ..........YDRLNLH...LAKGYCSLPLM...PHSFRTSTfmskydfiayld.............................
MDP0000293613  ..........SSRSTKL...IHGGVRYLEKA...VFNLDYGQ.........................................
MDP0000253362  ..........SSRSTKL...IHGGVRYLEKA...VFNLDYGQ.........................................
MDP0000182973  ..........TSSRNSE...VIHAGIYYPTH...SLKAKFCV.........................................
MDP0000138005  ..........IHTDYSF...GCPVDMGASWL...HGVCNENP.........................................
MDP0000261301  ..........SFINSHA...TPPSTIIDTTSt..SISHDYTVldvtlrsvyssietanyapeivadqsskfl...........
MDP0000771633  ..........GAIPLCM...LDEFDIPSHLI...DRQVTRMR.........................................
MDP0000851102  ..........GAIPLCM...LDEFDIPSHLI...DRQVTRMR.........................................
MDP0000159873  ..........--KPCGG...AIPLCMVGEFNlp.LDIIDRRVtkmkmispsn...............................
MDP0000140206  ..........AIISKEA...VAPYERPALSK...AYLLPEGA.........................................
MDP0000261201  ..........--IPLCM...VGEFDLPLDII...DRRVTKMKmispsnvav................................
MDP0000252244  ..........--IPLCM...VGEFDLPLDII...DRRVTKMKmispsnvav................................
MDP0000261821  ..........-------...VAPYERPALSK...AYLXPESP.........................................
MDP0000124454  .......egvA------...---ADLGGSVL...--------.........................................
MDP0000234830  ..........SSRSTKL...IH-GGRRIAYI...HTCVRYLEkavfnldygq...............................
MDP0000297861  ..........-------...-----------...--------.........................................
MDP0000152184  ..........LCIISEE...SVPPYERP---...ALSKGFLL.........................................
MDP0000157871  ..........AIISKEA...VAPYERPALSK...GYLLPEGA.........................................
MDP0000250932  ..........IDRIAWQ...PCNPAVGGPAK...SQLVHEVDalggeigkisdr.............................
MDP0000219521  ..........SYSSTKLq..SHRCDYEFSDF...PWPDRDNTeypshleilaylnsya.........................
MDP0000239289  ..........PDRIVGE...LLQPGGYLKLM...ELGLEDCVeeidaqrvvgyvlfkdg........................
MDP0000258995  ..........IITVEKD...GYLWEEGPNSF...QPSDPMLTmmvdcglk.................................
MDP0000167343  ..........SYNSTKLq..SHRCDYEFSDF...PWPDRDNTdypsyleildylksya.........................
MDP0000222306  ..........SYNSTKLq..SHRCDYEFSDF...PWPDRDNTdypsyleildylksya.........................
MDP0000829384  .fikshatppSTIIGST...STGSSLDYTAL...DVTLRSVYsnietanyapeilanqfskflidlggprx............
MDP0000145663  ..........SMWPNNY...GVWVDEFESLNl..ESCLDKIW.........................................
MDP0000288439  ..........NKNFGLS...LVQTDEYTSVA...QS-----Fvskdggfqsp...............................
MDP0000267350  ..........-------...-----------...--------.........................................
MDP0000155608  ..........-------...-----------...--------.........................................
MDP0000194622  ..........IWPNNYG...VWVDEFEAMDM...LDCLDTTW.........................................
MDP0000134271  ..........SYNSTKLq..TPRCDFEFSNY...PWAERDNSsfpshvevleylhgyathfdllkyvkfeskvvevryvggig
MDP0000312748  ...fsrcsylQSLLRPS...IIKYETQLEKF...CEFMDPLLdsappeslq................................
MDP0000197715  ..........------H...LDYSSLEAPSH...DQLYEAGGii.......................................
MDP0000220943  ..........SYNSTKLq..TPRCDFEFSDY...PWVERDNSsfpshvevleylhgyathfdllkyvkfeskvveiryvggid
MDP0000320539  ..........-------...-----------...--------.........................................
MDP0000140206  ..........-------...-----------...--------.........................................
MDP0000215521  ..........S-YNSTK...LQSPRCNFEFS...DYPWAERDnssfpshvevleylhgya.......................
MDP0000203847  ..........IYDLGGQ...VLAANSAPVIF...HLAKETGSeldemdshklalidksg........................
MDP0000201011  ..........IYDLGGQ...VLAANSAPVIF...HLAKETGSelvemdshklalidksg........................
MDP0000204596  ..........-------...-----------...--------.........................................
MDP0000148978  .......fdqTLLSVGG...GVCVGMGDVLSd..RWQHGK-Iv........................................
MDP0000130369  ..........IGIQRGN...WYPFRNI----...FSLVDELGikpftnwtkfaq.............................
MDP0000314606  ..........SSRSTKL...IHGGRRIAYVH...SYTTTTLT.........................................
MDP0000263146  ..........YFMFTPL...LPSVTCGTVEA...RSIVEPIRki.......................................
MDP0000250583  ..........RFVFKPM...LYELLTGEVDA...WEIAPRFL.........................................
MDP0000208233  ..........WKKYSYD...RLHLHLQKQFC...-----ELPhmsfptsyp................................
MDP0000158720  ..........CNVTNGH...CVDTMVLAENY...PRGHRELK.........................................
MDP0000152184  ..........-------...-----------...--------.........................................
MDP0000182702  ..........-------...-----------...--------.........................................
MDP0000261638  ..........STSLNLN...QFMMANGGLVR...VLIHTNVTkyln.....................................
MDP0000130370  ..........I----GI...QRGNWYPFRNI...FSLVDELGikpftnwtkfaq.............................
MDP0000272119  ..........SHFASLH...LNDFTSFIHSH...ATPSST--.........................................
MDP0000305861  ..........--AFTPL...LPSVTC-----...--------.........................................
MDP0000255696  ..........--AFTPL...LPSVTC-----...--------.........................................
MDP0000214280  ..........-AYPNXLn..QDGFLYXLX--...-------Qeddgntpvq................................
MDP0000210966  ..........-------...--PNITNLSTF...GSALSDLSpaspsq...................................
MDP0000610999  .flnshasppS------...-----------...--------.........................................
MDP0000242546  .flnshasppS------...-----------...--------.........................................
MDP0000320742  ..........AHIISGN...VFEPRALNELL...PQWKDEESpitvpvtsdkfwlltkd........................
MDP0000654164  ..........RCIPSKA...LLHSSHMYYEA...KHAFSHHGvkfsn....................................
MDP0000256300  ..........-------...-----------...--------.........................................
MDP0000235080  ..........EVVEDEK...ELLFDHGAPFF...NANKTEVL.........................................
MDP0000284363  ..........-------...-----FTPLLP...SVTC----.........................................
MDP0000125043  ..........-------...-----------...--------.........................................
MDP0000192359  ..........-------...-----------...--------.........................................
MDP0000440005  ..........-------...--YFEIPWTSL...RTMVE---.........................................
MDP0000609131  ..........MATVNVS...GHIFEAGASILh..PRNLHAVNytkllnlavnspsssdessssafgiwdghqfvf........
MDP0000362000  ..........HMVFTPL...LASTCVGTLEF...RSVAEPIAriqpaisretgsyfflsnc......................
MDP0000150210  ..........G------...-FKFSRCSYLQ...SLLRPSIIkelelprhglkllkg..........................
MDP0000158790  ..........-------...--GPDLPFTNN...YGVWEDEFkdlglegciehvwqnti........................
MDP0000427950  ..........SMRMTGF...ALTTWTNAWKA...LDALGTGDtlrqqhgallgcdgvns........................
MDP0000569169  ..........SSRSTKL...IHGGVRYLEKA...VFNLDYGQ.........................................
MDP0000525742  ..........TEVENFP...GFP--------...--------.........................................
MDP0000559829  ..........-------...LSEPDRIFELL...QPAGGYLKkhixsnivg................................
MDP0000321788  ..........-------...-----------...--------.........................................
MDP0000919183  ..........-------...-----------...--------.........................................
MDP0000146158  ..........-------...-----------...--------.........................................
MDP0000832077  ..........SYNSTKLq..TPRCDFEFSDY...PWVERDNSsfpshvevl................................
MDP0000621365  ..........TSYPNVLt..QDGFILNLQQD...DDGETPVQ.........................................
MDP0000875229  ..........-------...-----------...--------.........................................
MDP0000251344  ..........THFENFP...VFPQTILMANY...RMQSDRFH.........................................
MDP0000168919  ..........-------...-----------...--------.........................................
MDP0000267855  ..........SGVSGGL...LHPYSPKAKLL...WRAADCWSeslnllsaaeaavasaa........................
MDP0000195207  ..........TRVVDPQ...PLIFDHAAQFF...---TASDPqfvglvqgwlxqglvxewqgavgele...............
MDP0000400145  ..........-------...-----------...--------.........................................
MDP0000919183  ..........-------...-----------...--------.........................................
MDP0000307336  ..........LRSVSRD...GLVWDEGA---...--------.........................................
MDP0000263146  ..........-------...-----------...--------.........................................
MDP0000309730  ..........SGVSGGL...LHPYSPKAKLL...WRAADCWSeslnllsaaeaavasaa........................
MDP0000163903  ..........-------...-----------...--------.........................................
MDP0000611628  ..........-------...-----------...--------.........................................
MDP0000119779  ..........-------...-----------...--------.........................................
MDP0000120904  ..........-------...-----------...--------.........................................
MDP0000150544  ..........E------...-----------...--------.........................................
MDP0000902209  ..........SGVSGGL...LHPYSPKAKLL...WRAADCWSeslnllsaaeaavasaa........................
MDP0000269370  ..........-------...-----------...--------.........................................
MDP0000146158  ..........-------...-----------...--------.........................................
MDP0000124051  ..........-------...-----------...--------.........................................
MDP0000255696  ..........-------...-----------...--------.........................................
MDP0000305861  ..........-------...-----------...--------.........................................
MDP0000611628  ..........-------...-----------...--------.........................................
MDP0000309622  ..........PDRIVGE...LLQPGAYLRLI...ELGLEDCV.........................................
MDP0000239909  ..........-------...-----------...--------.........................................
MDP0000126888  ..........-------...-----------...--------.........................................
MDP0000869086  ..........-------...-----------...--------.........................................
MDP0000317524  ........plG------...-RAPTL-----...-------Kvhsslytslrlmlprei........................
MDP0000160099  ..........-------...-----------...--------.........................................
MDP0000251205  ..........-------...-----------...--------.........................................
MDP0000314335  ..........-------...-----------...--------.........................................
MDP0000638870  ..........-DRIVGE...LLQPGGYLKLI...--------.........................................
MDP0000790657  ..........-------...-----------...--------.........................................
MDP0000748068  ..........-------...-----------...--------.........................................
MDP0000727481  ..........-------...-----------...--------.........................................
MDP0000301246  ..........-------...-----------...--------.........................................
MDP0000190684  ..........-------...-----------...--------.........................................
MDP0000456223  ..........-------...-----------...--------.........................................
MDP0000745172  ..........GAWLSGH...LL---------...--------.........................................
MDP0000407932  ..........-------...-----------...--------.........................................
MDP0000440896  ..........-------...-----------...--------.........................................
MDP0000694227  ..........-------...-----------...--------.........................................
MDP0000123987  ..........-------...-----------...--------.........................................
MDP0000138005  ..........IHTDYSF...GCPVDMGASWL...HGVCNENPlaplirrlgltlyrtsgddsvlydhdlesfal.........
MDP0000258205  ..........SMWPNNY...GVWVDEFESLNl..ESCFDKTWpmasvhv..................................
MDP0000245245  ..........-------...-----------...--------.........................................
MDP0000306704  ..........-------...-----------...--------.........................................
MDP0000478654  ..........MATVNXS...GHIFEAGASIL...--------.........................................
MDP0000728219  ..........-------...-----------...--------.........................................
MDP0000170414  ..........-------...-----------...--------.........................................
MDP0000284363  ..........-------...-----------...--------.........................................
MDP0000219560  ..........-------...-----------...--------.........................................
MDP0000235930  ..........-------...---FEIPWGSL...RAMVE---.........................................
MDP0000755938  ..........-------...-----------...--------.........................................
MDP0000138851  ..........VHFLSRG...MLYFFVLLKLFp..SSMVDSLLvllsklvfgnlasygier.......................
MDP0000261638  ..........-------...-----------...--------.........................................
MDP0000317524  ..........-------...-----------...--------.........................................
MDP0000294615  ..........-------...-----------...--------.........................................
MDP0000208234  ..........HFLSRGM...VYLALVLLKHFp..LSMVDSLL.........................................
MDP0000216129  ..........-------...-----------...--------.........................................
MDP0000219521  ..........-------...-----------...--------.........................................
MDP0000248995  ..........-------...-----------...--------.........................................
MDP0000256328  ..........-------...-----------...--------.........................................
MDP0000181673  ..........-------...-----------...--------.........................................
MDP0000169201  ..........-------...-----------...--------.........................................
MDP0000263530  ..........ICREVVE...DGKELLFDHCA...PFFNAYNT.........................................
MDP0000295839  ..........VHILTKE...IVFLGMVLA--...--------.........................................
MDP0000297466  ..........-------...--GPDLPFTNN...YDLGLEGCiehvcqntivy..............................
MDP0000281982  ..........-------...-----------...--------.........................................
MDP0000053966  ..........-------...-----------...--------.........................................
MDP0000795740  ..........-------...-----------...--------.........................................
MDP0000212327  ..........-------...LLQPGGYLRLVe..LGLEDKQR.........................................
MDP0000437365  ..........-------...-----------...--------.........................................
MDP0000135231  ..........GYIWMGH...KTPGS------...--------.........................................
MDP0000167343  ..........-------...-----------...--------.........................................
MDP0000222306  ..........-------...-----------...--------.........................................
MDP0000183517  ..........H------...--FINNRSMEV...FRKLDGLAeeiqrsqppve..............................
MDP0000686821  ..........VHVLSKE...IVFFGMVLLKLlp.VTIVDKVVvglgklkygnlskygiqk.......................
MDP0000430157  ..........-------...-----------...--------.........................................
MDP0000373054  ..........-------...-----------...--------.........................................
MDP0000295306  ..........-------...-----------...--------.........................................
MDP0000233995  ..........VHVLNKE...IVHFGMVLLKFip.LKMVDKVVvrlgklkygnlsk............................
MDP0000209681  ..........VHVLNKE...IVHFGMVLLKFip.LKMVDKVVvrlgklkygnlsk............................
MDP0000876898  ..........-------...-----------...--------.........................................
MDP0000738522  ..........-------...-----------...--------.........................................
MDP0000399642  ..........-------...-----------...--------.........................................
MDP0000215521  ..........-------...-----------...--------.........................................
MDP0000170521  ..........-------...-----------...--------.........................................
MDP0000262982  ..........-------...-----------...--------.........................................
MDP0000321186  ..........S------...GVAPDH-----...--------.........................................
MDP0000266051  ..........-------...-----------...--------.........................................
MDP0000837610  ..........-------...-----------...--------.........................................
MDP0000582079  ..........VHVLNKE...IVHFGMVSLKFlp.LNIVDKAVvllgkl...................................
MDP0000538071  ..........-------...-----------...--------.........................................
MDP0000241703  ..........-------...-----------...--------.........................................
MDP0000671114  ..........GAX----...-----------...--------.........................................
MDP0000315388  ..........-------...-----------...--------.........................................
MDP0000134271  ..........SYNSTKLq..TPRCDFEFSNY...PWAERDNSsfpshvevleylhgyathfdllkyvkfeskvvevryvggig
MDP0000297581  ..........-------...-----------...--------.........................................
MDP0000911003  ..........WNISRKE...LMELVEIGVLL...EGDIEQVT.........................................
MDP0000576650  ..........IITI---...-----------...--------.........................................
MDP0000149205  ..........IITIEKD...DYP--------...--------.........................................
MDP0000315409  ..........-------...-----------...--------.........................................
MDP0000320804  ..........-------...-----------...--------.........................................
MDP0000474647  ..........IITVEK-...-----------...--------.........................................
MDP0000566648  ..........IITVW--...-----------...--------.........................................
MDP0000171379  ..........-------...-----------...--------.........................................
MDP0000814529  ..........IITVEK-...-----------...--------.........................................
MDP0000218295  ..........-------...-----------...--------.........................................
MDP0000220943  ..........SYNSTKLq..TPRCDFEFSDY...PWVERDNSsfpshvevleylhgyathfdllkyvkfeskvveiryvggid
MDP0000795437  ..........-------...-----------...--------.........................................
MDP0000919706  ..........-------...-----------...--------.........................................
MDP0000295675  ..........IITVEK-...-----------...--------.........................................
MDP0000147542  ..........IITVEKD...-----------...--------.........................................
MDP0000272126  ..........PNIINIE...NFAPTLLDTSP...TSPGQ---.........................................
MDP0000196881  ..........II-----...-----------...--------.........................................
MDP0000268346  ..........-------...-----------...--------.........................................
MDP0000147542  ..........IITVEKD...GYARAE-----...--------.........................................
MDP0000948298  ..........-------...-----------...-------E.........................................
MDP0000220943  ..........-------...-----------...--------.........................................
MDP0000182589  ..........-------...-----------...--------.........................................
MDP0000557870  ..........-------...-----------...--------.........................................
MDP0000308870  ..........-------...-----------...--------.........................................
MDP0000322449  ..........-------...-----------...--------.........................................
MDP0000286494  ..........-------...-----------...--------.........................................
MDP0000150868  ..........-------...-----------...-----Y--.........................................
MDP0000155608  ..........-------...-----------...--------.........................................
MDP0000168505  ..........-------...-----------...--------.........................................
MDP0000196888  ..........-------...-----------...--------.........................................
MDP0000154812  ..........-------...-----------...--------.........................................
MDP0000186080  ..........-------...-----------...--------.........................................
MDP0000220012  ..........-------...-----------...--------.........................................
MDP0000169409  ..........PNIINIE...NFAPTLLDTSP...TSPGQ---.........................................
MDP0000373095  ..........-------...-----------...--------.........................................
MDP0000235846  ..........HHHHHPL...RELPGIPSNNS...HDQLPNAVspfrhhdllgngqqsrllgdpfq..................
MDP0000207126  ..........-------...-----------...--------.........................................
MDP0000268357  ..........-------...-----------...--------.........................................
MDP0000770761  ..........-------...-----------...--------.........................................
MDP0000149067  ..........-------...-----------...--------.........................................


                                                 90       100                         110           
                                                  |         |                           |           
d1cf3a1          ..........................LATNNQTALIRSGNGLGGS..................TLVNGGTWTRPHKAQVDS..
MDP0000813172  ..........................KGSDW----------LGDQ..................DAIQYMC--REAPKAVIE..
MDP0000251581  ..........................KGSDW----------LGDQ..................DAIQYMC--REAPKAVIE..
MDP0000188391  ..........................KGSDW----------LGDQ..................DAIQYMC--REAPKAVIE..
MDP0000254144  ................klldkvmelrQTMGGFGNDISLGSV----..................---------------LEK..
MDP0000321972  ..........................F------------------..................------------------..
MDP0000299806  ..........................LGLPLHKVRDICPLYLPDG..................KAVNSEMDSSIETSFNKL..
MDP0000283451  ..........................LGLPLHKVRDICPLYLPDG..................KAVNSEMDSSIEASFNKL..
MDP0000296714  ..................dealeaefN------------------..................SLLDDMVLLVAQEGEQTR..
MDP0000162193  ..........................G------------------..................---------EKVPADLDE..
MDP0000769741  ..........................A------------------..................------------LFDMDG..
MDP0000295277  ..........................VEIDLPAMMSQKDKAV---..................---------SNLTRGIEG..
MDP0000897124  ..........................VEIDLPAMMSQKDKAV---..................---------SNLTRGIEG..
MDP0000854208  ..........................AGAYLCDEETVRVVC----..................---------TEGPERIRE..
MDP0000241767  ..........................DIATGXKVPADLD------..................---------EALEAEFNS..
MDP0000318858  ..........................NFVVNANIGNDPLYS----..................---------------LER..
MDP0000248995  ..........................VLIHTDVTKYLYFKAVDGS..................FVYNKGKVHKVPATDMEAlk
MDP0000442206  ..........................NFVVNANIG----------..................---------NDPLYSLDR..
MDP0000181673  ..........................VLIHTDVTKYLYFKAVDGS..................FVYNKGKVHKVPATDMEA..
MDP0000315409  ..........................F------------KAVDGS..................FVYNKGKVHKVPANDVEAlk
MDP0000053966  ..........................K--------YLNFKAVDGS..................FVYNKGKVHKVPANDVEAlk
MDP0000294615  ..........................K--------YLNFKAVDGS..................FVYNKGKVHKVPANDVEAlk
MDP0000306147  ..........................DIATGXKVPADLD------..................---------EALEAEFNS..
MDP0000180064  alaavgcempvipdpttvhyhlpdnlSVVVHREYSE---------..................---FISELTNKFPHEKQG..
MDP0000261625  ....................avqklkK------------------..................------------------..
MDP0000300208  ..........................VDFNWKKLLQKKTDEI---..................---------VRLNGIYKR..
MDP0000247171  ..........................VSQHLTSLYAPIKKGY---..................-------VTDIDTGEIQE..
MDP0000308095  ..........................LVKDHTHTFVNKGGNI---..................---------GELDFRFPI..
MDP0000319421  ..........................PILSGQLISLGSGEI----..................---------EXMDVGKEE..
MDP0000232295  ..........................XFVSNDGVRNLRGRVLGGG..................SAINGGFYSRASEDFVEK..
MDP0000188994  ..........................STISGLPVFEMSFKA----..................---------KGKNGDHEV..
MDP0000159189  ..........................STISGLPVFEMSFKA----..................---------KGKNGDHEV..
MDP0000656178  ..........................AGYDRQGVADHANNLA---..................---------TKIRNSLTN..
MDP0000910523  ..........................VSHHLTSLYATIKKG----..................---------YITNIDTGE..
MDP0000119941  ..........................VEIDLPAMMSQKDKAV---..................---------SNLTRGIEG..
MDP0000231799  ..........................AGYDRQGVADHANNLA---..................---------TKIRNSLTN..
MDP0000255025  ..........................LRIIANKFSWTTTKQVGADenllvk............DHTHTFVNKGGSIGELDF..
MDP0000231632  .................snflsaqskL------------------..................-----------------Xii
MDP0000173300  ..........................LVTVDGKIVLQAGSTVGGG..................SAINWSACIKTPNYVLQE..
MDP0000158474  ..........................PFVSTDGVINTRARVLGGG..................SCINAGFYTRASTRLNAS..
MDP0000276878  .sasldngrgcewgsrnglsslfaqkTNLINPY-FWQMLRE----..................-------ITKFKHDAINY..
MDP0000154720  ..........................AYFDQMQVWDYTGLG----..................-------YTRYDAR----..
MDP0000549646  ..........................IDYDEQDNYVVIKHA----..................------------------..
MDP0000158853  ..........................L------------------..................---------VLEPDVVDR..
MDP0000702799  ..........................L------------------..................---------VLEPDVVDR..
MDP0000233110  ..........................MASVDAMVMILAGSTVGGG..................SAVNWSASIRTPHNVLRE..
MDP0000260827  ..........................EQIDAQRVFGYALFK----..................---------DGKNTRLSY..
MDP0000941459  ..........................P-----------------TtvaxxxlelepdvvdpisSLFKNLMDYAQGKQVFDE..
MDP0000185338  ..........................AFTSEEGVANVRGRILGGS..................SAINAGFYSRADQDFYMK..
MDP0000451172  ..........................QFTSEDGVYNIRARVLGGG..................SAVNAGFYTRASTHYIKE..
MDP0000136847  ..........................RFTSEDGVAFVRGRVLGGS..................SMINVGLYSRADSEFLKK..
MDP0000177641  ..........................SFVSKDGVSNLRGRVLGGG..................SAINGGFFSRASXDYVKR..
MDP0000413935  ..........................EQIDAQRVFGYALFK----..................---------DGKNTKLSY..
MDP0000206098  ..........................----------RKPAHL---..................-------F----------..
MDP0000845788  ..........................EGITGPDLMERMRKQA---..................--------ERWGAEL---..
MDP0000465595  ..........................SFVSNDGVSNLRGRVLGGA..................SAINGGFYSRASEDFVEK..
MDP0000137211  ..........................RFVSEDGVANVRGRILGGT..................SMVSGGAYSRADSEFYKK..
MDP0000130099  ..........................RVMSEDGIPTVRGRILGGT..................SIINAGVYARANISFFSQ..
MDP0000425135  ..........................AFTSEEGVANVRGRILGGS..................SAINAGFYSRADQDFYTK..
MDP0000200780  ..........................KTDNGRELRSFKFKE----..................---------EDESQEVRA..
MDP0000142434  ..........................PLQGARDIYXHNGKQQ---..................---------KISYGGA--..
MDP0000248951  ..........................RFTSEDGVAFVRGRVLGGS..................SMINIGLYSRADSEFLKK..
MDP0000869086  ..........................MGFTDFPFAVKKGRDM---..................---------RRFPGHREL..
MDP0000318256  ..........................RFTSEDGVANLRGRILGGS..................SMINIGXYSRADGEFYQK..
MDP0000231634  .............aliksnflsaqskL------------------..................-----------------Lii
MDP0000626995  ..........................IDYDEQDNYVVIKHA----..................------------------..
MDP0000123832  ..........................VSQHLTSLYAPIKKGY---..................-------VTDIDTGEIQE..
MDP0000236092  ..........................IDYDEQDNYVVIKHA----..................------------------..
MDP0000199159  ..........................MGFTDFPFAVKKGRDM---..................---------RRFPGHTEL..
MDP0000162755  ..........................NSFERRNVTSSRITGL---..................---------QTFQMSFDA..
MDP0000173666  .................snflsaqskLXIILEPYXWKK-------..................------------------..
MDP0000262982  ..........................PFPEDFPEYPTKRQFID--..................-------YLESYAKHFEI..
MDP0000184832  ..........................SFVSKDGVSNLRGRVLGGG..................SAINGGFFSRASEDYVKR..
MDP0000598927  ..........................AGAYLCDEETVRVVC----..................---------TEGPERIRE..
MDP0000561228  ..........................RVMSEDGIPTVRGRILGGT..................SMISAGVYARANISFFNE..
MDP0000175650  ..........................LWRKFIYCTSLYGSILGS-..................-------VDHMQPQDFEQ..
MDP0000233802  ..........................DGILGYDLMDRCRKQ----..................-------SIRFGTEVFTE..
MDP0000321186  ..........................-------------------..................------------------..
MDP0000161955  ..........................ESIDAQKVFGYALYK----..................---------DGNDTKLSY..
MDP0000213381  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000168437  ..........................NEIDAQRVFGYALYK----..................---------DGKSTKLPY..
MDP0000823251  ..........................DGILGYDLMDRCRKQ----..................-------SIRFGTEVFTE..
MDP0000191389  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000199319  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000857446  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000266638  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000208936  ..........................LSSVDGMVMILAGSTVGGG..................SAVNWSASIKTPDNVLRD..
MDP0000202883  ..........................ESVDAQKVFGYALYK----..................---------NGNDTKLSY..
MDP0000288439  ..........................LGAMASSSGTGAGRVLGGG..................SAINGGFFSRASXDYVKR..
MDP0000295839  ..........................AYVSHFKITPRYDRV----..................------------------..
MDP0000903805  ..........................RFTSEDGVANLRGRVLGRG..................SMINVALYSRADGEFYEK..
MDP0000202123  ..........................PKHDWSTLIANKNAEL---..................---------KRLTGIYKN..
MDP0000227773  ..........................MGFTDFPFAVKKGRDM---..................---------RRFPGHTEL..
MDP0000317524  ..........................AGFTDFPFAVKKGRDM---..................---------RRFPGHTEL..
MDP0000320748  ..........................DSIDAXKVFGYALYK----..................------------------..
MDP0000634676  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000235846  ..........................DGILGFELMDRCRKQ----..................-------SIRFGTAVFTE..
MDP0000251344  ..........................DGILGFELMDRCRKQ----..................-------SIRFGTAVFTE..
MDP0000501957  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000209681  ..........................PFPSNAPTYIPKDMFVQ--..................-------YLDNYVSQFKI..
MDP0000293482  ..........................LTIDQNDAIDGENKVK---..................-------WTLTRDEDFNC..
MDP0000233995  ..........................PFPSNAPTYIPKDMFVQ--..................-------YLDNYVSQFKI..
MDP0000257243  ..........................RFTSEDGVANLRGRILGGS..................SMINIGXYSRADGEFYQK..
MDP0000160099  ..........................MGFTDFPFAVKKGRDM---..................---------RRFPGHTEL..
MDP0000193196  ..........................ESIDAQKVFGYALYK----..................------------------..
MDP0000208234  ..........................P---KHQFIQYLEDY----..................----------VSHFSISP..
MDP0000251783  ..........................RFTSEDGVAFVRGRVLGGS..................NALLEAGVRPDNGLTLDH..
MDP0000686885  ..........................DKVLLAVVDSCRKNSV---..................---------AFSVMNRDQ..
MDP0000138851  ..........................TYVPKNQFIRYLED-----..................---------YVSHFSIRP..
MDP0000194930  ..........................SHSSFTPCLDGRYLLLGPN..................KDHNHSEISKFSKRDADA..
MDP0000169201  ..........................QHFDLLKHIKFDTKV----..................---CGIEYEGASEDEMQA..
MDP0000399642  ..........................QHFDLLKHIKFDTKV----..................---CGIEYEGASEDEMQA..
MDP0000582079  ..........................PKDMFVQYLETNVSQLGIN..................PRCNQNVKSALYEVDINK..
MDP0000129765  ..........................Q------------------..................---------TTLPFTIDQ..
MDP0000272655  ..........................RFTSEDGVANVRGRILGWS..................SMINIGIYSRADSEFYEK..
MDP0000686821  ..........................PFPSDTPTYVPKNLFVQ--..................-------YLDTYVSHFNI..
MDP0000170414  ..........................QHFDLLKHIKFDTKV----..................---CGIEYEGASEDEMQA..
MDP0000320804  ..........................QHFDLLKHIKFNNKV----..................---SGIEYEGPSGDEMQA..
MDP0000189790  ..........................---NKXDAQXIFGYVL---..................-------YKDGIRTKLPY..
MDP0000847111  ..........................PKDMFVQYLETNVSQLGIN..................PXCNQNVKSALYEVDINK..
MDP0000289536  ..........................APANDKVLHAVVESC----..................---------RKNXVAFRV..
MDP0000123987  ..........................QHFDLLKHIKFDTKV----..................---CGIEYEGASEDEMQA..
MDP0000245245  ..........................QHFDLLKHIKFDTKV----..................---CGIEYEGASEDEMQA..
MDP0000188553  ..........................F------------------..................--------------DM--..
MDP0000296599  ..........................QELDGPKSYGYRPLT----..................-----TLSLTVSESETSK..
MDP0000746652  ..........................ESIDAQKVFGYAL------..................------------------..
MDP0000259265  ..........................EYVSRFNVKPRYCRHV---..................------------------..
MDP0000151331  ..........................RIMSEDXIPTVRGRILGGT..................SMINAGVXARANISFYNE..
MDP0000309775  ..........................GTWSDGKLVTRIGRNS---..................---------GSVLAVMET..
MDP0000232736  ..........................YSFDGKPVD----------..................------------------..
MDP0000320539  ..........................PEAPARLPSFHTCVG----..................---------ANEERLTAK..
MDP0000239909  ..........................M--GFRDYPFVAREG----..................---DEERDPRRFXGHKEV..
MDP0000259264  ..........................EYVSRFNVKPRYCRHV---..................------------------..
MDP0000293613  ..........................LKLVFHALEERKQVI----..................---------ENAPHLCHA..
MDP0000253362  ..........................LKLVFHALEERKQVI----..................---------ENAPHLCHA..
MDP0000182973  ..........................-----------RGRY----..................-------------LLYKY..
MDP0000138005  ..........................LAPLIRRLGLTLYRTSGDD..................SVLYDHDLESFAL-----..
MDP0000261301  ..........................I------------------..................------------------..
MDP0000771633  ..........................-IFSPSNLAVDFGKTL---..................-----------LPHEFIA..
MDP0000851102  ..........................-IFSPSNLAVDFGKTL---..................-----------LPHEFIA..
MDP0000159873  ..........................V-------------A----..................-------------VDIGQ..
MDP0000140206  ..........................ARLPGFHVCVG--------..................---------SGGEKLLPE..
MDP0000261201  ..........................D------------------..................---------------IGQ..
MDP0000252244  ..........................D------------------..................---------------IGQ..
MDP0000261821  ..........................ARLPGFHVCVG--------..................---------SGGERLLPD..
MDP0000124454  ..........................-------------------..................------------------..
MDP0000234830  ..........................LKLVFHALEERKQVI----..................---------DNAPHLCHA..
MDP0000297861  ..........................-------------------..................------------------..
MDP0000152184  ..........................PEAPARLPSFHTCVG----..................---------ANEERLTPE..
MDP0000157871  ..........................TRLPGFHVCVG--------..................---------SGGEKLLPE..
MDP0000250932  ..........................CYLQKRVLNASRGPAV---..................---------RALRAQTDK..
MDP0000219521  ..........................EHFDVLKFVRFNSKVV---..................-----EVRFIGDRENIEF..
MDP0000239289  ..........................KNTRLTYPLEQFHSDVAGR..................SFHNGRFIQR--------..
MDP0000258995  ..........................D------------------..................------------------..
MDP0000167343  ..........................EHFDVLKFVRFNSKV----..................------------------..
MDP0000222306  ..........................EHFDVLKFVRFNSKV----..................------------------..
MDP0000829384  ..........................L------------------..................------------------..
MDP0000145663  ..........................-------------------..................----PMASVHVNDSKIKF..
MDP0000288439  ..........................RKSSRRRIGYQRRIV----..................-------------SDAYK..
MDP0000267350  ..........................-------------------..................------------------..
MDP0000155608  ..........................-------------------..................------------------..
MDP0000194622  ..........................-----------SGAVV---..................---------YIDEESKKD..
MDP0000134271  ......................hqttTQFPGNSNSXEYGNLLNGD..................PVWEVA------------..
MDP0000312748  ..........................C---------ESSCSVSDRfknkmhn...........SMFWARCLRQAAALGQKD..
MDP0000197715  ..........................V-TADGKIILQVRSTD---..................------------------..
MDP0000220943  .....................dhqttTQFPMN-------------..................------------------..
MDP0000320539  ..........................-------------------..................------------------..
MDP0000140206  ..........................-------------------..................------------------..
MDP0000215521  ..........................THFDLLKYVKFESKVV---..................-----EIRYVGGIDDHQT..
MDP0000203847  ..........................Q-YQDIKVADDYVSVI---..................-------SLTLELQDKAA..
MDP0000201011  ..........................Q-YQDIKVADDYV------..................-------SVITLTLELQD..
MDP0000204596  ..........................-------------------..................------------------..
MDP0000148978  ..........................MGTGMKQACIYSERMMECN..................SVTNLGMRFLVVSSLHY-..
MDP0000130369  ..........................YSAEGLEIELEVLKCVNGG..................SNVLQAE--FPVFQDLPQ..
MDP0000314606  ..........................-----------CVQIL---..................-------SAQESVELFXT..
MDP0000263146  ..........................TEKKGLDVEFREAECY---..................---------RIDPKNKKV..
MDP0000250583  ..........................DLLANTSVXFYQDKAK---..................---------LL-------..
MDP0000208233  ..........................TYVPKNQFXQYLED-----..................---------YVSHFSISP..
MDP0000158720  ..........................------------GAFF---..................-------NTHGPADTMSW..
MDP0000152184  ..........................-------------------..................------------------..
MDP0000182702  ..........................-------------------..................------------------..
MDP0000261638  ..........................FKAVDGSFVYNKGKK----..................---------RRARK----..
MDP0000130370  ..........................YSAEGLEIELEVLKCVNGG..................SNVLQAEFPNVLSPLIQV..
MDP0000272119  ..........................-------------------..................------------------..
MDP0000305861  ..........................GTVEARSIVEPIRNIV---..................---------RKKNVDVQF..
MDP0000255696  ..........................GTVEARSIVEPIRNIV---..................---------RKKNVDVQF..
MDP0000214280  ..........................RIMSEDXIPTVRGRILGGT..................SMINAGVXARANISFYNE..
MDP0000210966  ..........................RFISEDGVINARARVLGGG..................SCLNAGFYTRAPPDYIRE..
MDP0000610999  ..........................-------------------..................------------------..
MDP0000242546  ..........................-------------------..................------------------..
MDP0000320742  ..........................RALSLPSPFDNRGNYV---..................------ISLSELVRWMGV..
MDP0000654164  ..........................VEIDLPAMMSQKDKVV---..................---------SNLTRGIEG..
MDP0000256300  ..........................----EEGVPNVRGWVLDGS..................SMINAGFYTTADKEFF--..
MDP0000235080  ..........................---GLVXEWESKGLVA---..................-------CWKEKFGFFDR..
MDP0000284363  ..........................GTVEARSIVEPXRNII---..................---------KKRNGEIKF..
MDP0000125043  ..........................-------------------..................------------------..
MDP0000192359  ..........................---------NLRGRVLGGG..................SAINGGFFSRASDDYVKR..
MDP0000440005  ..........................PTFGERSIINHRDYLT---..................------------------..
MDP0000609131  ..........................KTLSFKSELPFVDKIVSLA..................NSLLMLFRYGYSLIRMDK..
MDP0000362000  ..........................IGLDPDKHXVKCETVT---..................------------------..
MDP0000150210  ..........................SHSSFTPCLDGRYLLLGPN..................KDHNHSEISKFSKRDADA..
MDP0000158790  ..........................VYLDGDSDPIMIDRAYG--..................------------------..
MDP0000427950  ..........................V----------VAKWLG--..................------------------..
MDP0000569169  ..........................LKLVFHALEERKQVIENAP..................HLCHALPCMTPCFDWFEV..
MDP0000525742  ..........................EGITGPDLMERMRKQ----..................------------------..
MDP0000559829  ..........................XS-----------------..................------------------..
MDP0000321788  ..........................-------------------..................------------------..
MDP0000919183  ..........................-------------------..................------------------..
MDP0000146158  ..........................-------------------..................------------------..
MDP0000832077  ..........................E------------------..................------------------..
MDP0000621365  ..........................RVMSEDGIPTVRGRILGGT..................SIINAGVYARANISFFS-..
MDP0000875229  ..........................-------------------..................------------------..
MDP0000251344  ..........................-------------------..................------------ATILSE..
MDP0000168919  ..........................-------------------..................------------------..
MDP0000267855  ..........................QTSDGPTPIVRRRGIL---..................---------R--------..
MDP0000195207  ..........................VGGNFVPLPSSSPSCF---..................---NGMV------VLVKA..
MDP0000400145  ..........................-------------------..................------------------..
MDP0000919183  ..........................-------------------..................------------------..
MDP0000307336  ..........................-------------------..................------------------..
MDP0000263146  ..........................-------------------..................------------------..
MDP0000309730  ..........................QXSDGPTPIVRRRGIL---..................---------RP-------..
MDP0000163903  ..........................-------------------..................------------------..
MDP0000611628  ..........................-------------------..................------------------..
MDP0000119779  ..........................-------------------..................------------------..
MDP0000120904  ..........................-------------------..................------------------..
MDP0000150544  ..........................-------------------..................------------------..
MDP0000902209  ..........................QTSDGPTPIVRRRGIL---..................------------------..
MDP0000269370  ..........................-------------------..................------------------..
MDP0000146158  ..........................-------------------..................------------------..
MDP0000124051  ..........................FLVLLDGVYNFRGRVLGGG..................SAINGGVFSRASEDYVEK..
MDP0000255696  ..........................-------------------..................------------------..
MDP0000305861  ..........................-------------------..................------------------..
MDP0000611628  ..........................-------------------..................------------------..
MDP0000309622  ..........................NKIDAQKI-----------..................------------------..
MDP0000239909  ..........................-------------------..................------------------..
MDP0000126888  ..........................-------------------..................------------------..
MDP0000869086  ..........................-------------------..................------------------..
MDP0000317524  ..........................AGFTDFPFAVKKGRDM---..................---------RRFPGHTEL..
MDP0000160099  ..........................-------------------..................------------------..
MDP0000251205  ..........................-------------------..................------------------..
MDP0000314335  ..........................-------------------..................------------------..
MDP0000638870  ..........................-------------------..................------------------..
MDP0000790657  ..........................-------------------..................------------------..
MDP0000748068  ..........................-------------------..................------------------..
MDP0000727481  ..........................-------------------..................------------------..
MDP0000301246  ..........................-------------------..................-------D----------..
MDP0000190684  ..........................-------------------..................------------------..
MDP0000456223  ..........................-------------------..................------------------..
MDP0000745172  ..........................-------------------..................------------------..
MDP0000407932  ..........................-------------------..................------------------..
MDP0000440896  ..........................-------------------..................------------------..
MDP0000694227  ..........................-------------------..................------------------..
MDP0000123987  ..........................-------------------..................------------------..
MDP0000138005  ..........................F------------------..................--------------DM--..
MDP0000258205  ..........................NDSQTKYLDRPYGRV----..................------------------..
MDP0000245245  ..........................-------------------..................------------------..
MDP0000306704  ..........................-------------------..................------------------..
MDP0000478654  ..........................-------------------..................------------------..
MDP0000728219  ..........................-------------------..................------------------..
MDP0000170414  ..........................-------------------..................------------------..
MDP0000284363  ..........................-------------------..................------------------..
MDP0000219560  ..........................-------------------..................------------------..
MDP0000235930  ..........................PSFAKRSIINHCDYL----..................------------------..
MDP0000755938  ..........................-------------------..................------------------..
MDP0000138851  ..........................PQKGPIYMKAK--------..................------------------..
MDP0000261638  ..........................-------------------..................------------------..
MDP0000317524  ..........................-------------------..................------------------..
MDP0000294615  ..........................-------------------..................------------------..
MDP0000208234  ..........................---------------V---..................---------LLSKLVYGN..
MDP0000216129  ..........................------N------------..................------------------..
MDP0000219521  ..........................-------------------..................------------------..
MDP0000248995  ..........................-------------------..................------------------..
MDP0000256328  ..........................-------------------..................------------------..
MDP0000181673  ..........................-------------------..................------------------..
MDP0000169201  ..........................-------------------..................------------------..
MDP0000263530  ..........................KVLGLVHEWESKGLVA---..................-------CWKEKFGFF--..
MDP0000295839  ..........................-------------------..................------------------..
MDP0000297466  ..........................L--DDDSDPIMIPRAYG--..................-----R---VCQYMLHEE..
MDP0000281982  ..........................-------------------..................------------------..
MDP0000053966  ..........................-------------------..................------------------..
MDP0000795740  ..........................-------------------..................------------------..
MDP0000212327  ..........................NCVNEIDAQRVFGYAL---..................-------YKDGKSTKLPY..
MDP0000437365  ..........................-------------------..................------------------..
MDP0000135231  ..........................-------------------..................------------------..
MDP0000167343  ..........................-------------------..................------------------..
MDP0000222306  ..........................-------------------..................------------------..
MDP0000183517  ..........................LWRKFLYCTSLCGSILGQS..................TICNPKICXQIIFKLIGR..
MDP0000686821  ..........................PKQGPFYLKATKGRSP---..................---------TIDVGCIKK..
MDP0000430157  ..........................-------------------..................------------------..
MDP0000373054  ..........................-------------------..................------------------..
MDP0000295306  ..........................-------------------..................------------------..
MDP0000233995  ..........................FGIRRPKEGPFYLKAT---..................---------KGRS-----..
MDP0000209681  ..........................FGIRRPKEGPFYLKAT---..................---------KGRS-----..
MDP0000876898  ..........................-------------------..................------------------..
MDP0000738522  ..........................RIMSEDGIPTVRGRLLGGT..................SMINAGVYARANMSFYNQ..
MDP0000399642  ..........................-------------------..................------------------..
MDP0000215521  ..........................-------------------..................------------------..
MDP0000170521  ..........................-------------------..................------------------..
MDP0000262982  ..........................-------------------..................------------------..
MDP0000321186  ..........................---PETKVVLAYGAE----..................------------------..
MDP0000266051  ..........................-------------------..................------------------..
MDP0000837610  ..........................-------------------..................------------R-----..
MDP0000582079  ..........................K------------------..................------------------..
MDP0000538071  ..........................-------------------..................------------------..
MDP0000241703  ..........................-------------------..................------------------..
MDP0000671114  ..........................-------------------..................------------------..
MDP0000315388  ..........................-------------------..................------------------..
MDP0000134271  ......................hqttTQFPGNSNSXEYGNLLNGD..................PVWEVA------------..
MDP0000297581  ..........................-------------------..................------------------..
MDP0000911003  ..........................-------------------..................-----------------A..
MDP0000576650  ..........................-------------------..................------------------..
MDP0000149205  ..........................-------------------..................------------------..
MDP0000315409  ..........................-------------------..................------------------..
MDP0000320804  ..........................-------------------..................------------------..
MDP0000474647  ..........................-------------------..................------------------..
MDP0000566648  ..........................-------------------..................------------------..
MDP0000171379  ..........................-------------------..................------------------..
MDP0000814529  ..........................-------------------..................------------------..
MDP0000218295  ..........................-------------------..................------------------..
MDP0000220943  .....................dhqttTQFPMN-------------..................------------------..
MDP0000795437  ..........................----------R--------..................------------------..
MDP0000919706  ..........................-------------------..................------------------..
MDP0000295675  ..........................-------------------..................------------------..
MDP0000147542  ..........................-------------------..................------------------..
MDP0000272126  ..........................HFTSEDRVFNICTRVLGGG..................SVLNARFYKRASTHYIRE..
MDP0000196881  ..........................-------------------..................------------------..
MDP0000268346  ..........................-------------------..................------------------..
MDP0000147542  ..........................-------------------..................------------------..
MDP0000948298  ..........................-------------------..................------------------..
MDP0000220943  ..........................-------------------..................------------------..
MDP0000182589  ..........................-------------------..................------------------..
MDP0000557870  ..........................-------------------..................------------------..
MDP0000308870  ..........................-------------------..................------------------..
MDP0000322449  ..........................-------------------..................------------------..
MDP0000286494  ..........................-------------------..................------------------..
MDP0000150868  ..........................-------------------..................------------------..
MDP0000155608  ..........................-------------------..................------------------..
MDP0000168505  ..........................-------------------..................------------------..
MDP0000196888  ..........................-------------------..................------------------..
MDP0000154812  ..........................-------------------..................------------------..
MDP0000186080  ..........................-------------------..................------------------..
MDP0000220012  ..........................-------------------..................------------------..
MDP0000169409  ..........................HFTSEDRVFNICTRVLGGG..................SVLNARFYKRASTHYIRE..
MDP0000373095  ..........................-------------------..................------------------..
MDP0000235846  ..........................DQKTARPCRLRRRHH----..................-------WRRRQTPSLHW..
MDP0000207126  ..........................-------------------..................------------------..
MDP0000268357  ..........................-------------------..................------------------..
MDP0000770761  ..........................-------------------..................------------------..
MDP0000149067  ..........................-------------------..................------------------..


                    120                                                                             
                      |                                                                             
d1cf3a1          .....WETV.FGN.E....................................................................
MDP0000813172  .....LEN-.YGL.P....................................................................
MDP0000251581  .....LEN-.YGL.P....................................................................
MDP0000188391  .....LEN-.YGL.P....................................................................
MDP0000254144  .....LRQL.YSV.A....................................................................
MDP0000321972  .....----.---.-....................................................................
MDP0000299806  .....LDRV.CKL.Rhamieevksv..........................................................
MDP0000283451  .....LDRV.CKL.Rhamieevksv..........................................................
MDP0000296714  .....MSLE.KGL.Ehalkrrrmaktstsveekelhdlmdgfida......................................
MDP0000162193  .....ALE-.A--.Efnsllddmvllvakegeqtrxsleegleyalkrrrmaktgtsieakelnglm................
MDP0000769741  .....----.--N.Qvpqdlvtkvgevfenilketdavrqefsedmpiarafsivferkpelrle..................
MDP0000295277  .....LFKK.NKV.T....................................................................
MDP0000897124  .....LFKK.NKV.T....................................................................
MDP0000854208  .....LIA-.MGA.S....................................................................
MDP0000241767  .....LLDD.MEV.S....................................................................
MDP0000318858  .....LRE-.---.-....................................................................
MDP0000248995  splmgL---.---.Fekrrarkffi..........................................................
MDP0000442206  .....LRE-.---.-....................................................................
MDP0000181673  .....LKS-.---.Plmglfekrrarkfil.....................................................
MDP0000315409  splmgL---.---.Fekrrarkffi..........................................................
MDP0000053966  splmgL---.---.Fekrrarkffi..........................................................
MDP0000294615  splmgL---.---.Fekrrarkffi..........................................................
MDP0000306147  .....LLDD.MEV.S....................................................................
MDP0000180064  .....ILKF.YGV.C....................................................................
MDP0000261625  .....----.---.Leagggdfsnvteppttqktpielaidftlhdfempevepistfldygereflvadergyehmlykmae
MDP0000300208  .....LLSN.SGV.K....................................................................
MDP0000247171  .....VSF-.---.-....................................................................
MDP0000308095  .....GAPI.HGI.L....................................................................
MDP0000319421  .....L---.---.-....................................................................
MDP0000232295  .....V---.---.-....................................................................
MDP0000188994  .....RRV-.---.-....................................................................
MDP0000159189  .....RRV-.---.-....................................................................
MDP0000656178  .....SMNS.LGV.D....................................................................
MDP0000910523  .....IQE-.---.-....................................................................
MDP0000119941  .....LFKK.NKV.T....................................................................
MDP0000231799  .....SMNS.LGV.D....................................................................
MDP0000255025  .....RFP-.IGA.P....................................................................
MDP0000231632  lepyxWKK-.KGV.S....................................................................
MDP0000173300  .....WNKD.HKI.K....................................................................
MDP0000158474  .....CVP-.---.-....................................................................
MDP0000276878  .....LEEL.ENN.Q....................................................................
MDP0000154720  .....----.---.-....................................................................
MDP0000549646  .....----.---.-....................................................................
MDP0000158853  .....ISSL.FKN.Lmdyaqgkkvfdespeivcngefeygklgeeasricasnggv...........................
MDP0000702799  .....ISSL.FKN.Lmdyaqgkkvfdespeivcngefeygklgeeasricasnggv...........................
MDP0000233110  .....WSVD.HKI.P....................................................................
MDP0000260827  .....PLEK.FHS.D....................................................................
MDP0000941459  .....SPE-.REC.N....................................................................
MDP0000185338  .....----.--TsV....................................................................
MDP0000451172  .....VGW-.---.-....................................................................
MDP0000136847  .....SGIK.LDM.-....................................................................
MDP0000177641  .....VGWN.KX-.-....................................................................
MDP0000413935  .....PLEK.FHS.D....................................................................
MDP0000206098  .....----.LNE.L....................................................................
MDP0000845788  .....----.YQE.D....................................................................
MDP0000465595  .....VAW-.---.-....................................................................
MDP0000137211  .....----.---.-....................................................................
MDP0000130099  .....SGV-.---.-....................................................................
MDP0000425135  .....TSV-.---.-....................................................................
MDP0000200780  .....VER-.---.R....................................................................
MDP0000142434  .....----.---.-....................................................................
MDP0000248951  .....SGIK.LDM.-....................................................................
MDP0000869086  .....LLYL.KDF.C....................................................................
MDP0000318256  .....SGIK.LDM.N....................................................................
MDP0000231634  .lepyLWKK.KGV.S....................................................................
MDP0000626995  .....----.---.-....................................................................
MDP0000123832  .....VSF-.---.-....................................................................
MDP0000236092  .....----.---.-....................................................................
MDP0000199159  .....LLYL.KDF.C....................................................................
MDP0000162755  .....KGK-.---.-....................................................................
MDP0000173666  .....----.KGV.S....................................................................
MDP0000262982  .....NPKF.NXC.V....................................................................
MDP0000184832  .....VGWN.KQ-.-....................................................................
MDP0000598927  .....LIA-.MGA.S....................................................................
MDP0000561228  .....SG--.--V.E....................................................................
MDP0000175650  .....VVSP.VSV.A....................................................................
MDP0000233802  .....TVN-.---.-....................................................................
MDP0000321186  .....----.---.-....................................................................
MDP0000161955  .....PLEN.YPS.D....................................................................
MDP0000213381  .....----.NGN.D....................................................................
MDP0000168437  .....PLEN.FHP.D....................................................................
MDP0000823251  .....TVN-.---.-....................................................................
MDP0000191389  .....----.NGN.D....................................................................
MDP0000199319  .....----.NGN.D....................................................................
MDP0000857446  .....----.NGN.D....................................................................
MDP0000266638  .....----.NGN.D....................................................................
MDP0000208936  .....WSVD.HKI.P....................................................................
MDP0000202883  .....PLE-.---.-....................................................................
MDP0000288439  .....VGWN.KEM.-....................................................................
MDP0000295839  .....----.---.-....................................................................
MDP0000903805  .....----.---.-....................................................................
MDP0000202123  .....VLSN.ANV.T....................................................................
MDP0000227773  .....LLYL.KDF.C....................................................................
MDP0000317524  .....LLYL.KDF.C....................................................................
MDP0000320748  .....----.NGN.D....................................................................
MDP0000634676  .....----.NGN.D....................................................................
MDP0000235846  .....TVN-.---.-....................................................................
MDP0000251344  .....TVN-.---.-....................................................................
MDP0000501957  .....----.NGN.D....................................................................
MDP0000209681  .....NPKCnRSV.K....................................................................
MDP0000293482  .....RAA-.---.-....................................................................
MDP0000233995  .....NPKCnRSV.K....................................................................
MDP0000257243  .....----.---.-....................................................................
MDP0000160099  .....LLYL.KDF.C....................................................................
MDP0000193196  .....----.NGN.D....................................................................
MDP0000208234  .....MYK-.RNV.E....................................................................
MDP0000251783  .....IKG-.TKI.T....................................................................
MDP0000686885  .....LHQ-.---.-....................................................................
MDP0000138851  .....MYK-.RNV.E....................................................................
MDP0000194930  .....YPR-.YGN.Qlgnfcefmdplldsappeslqcesscsvsdrfknkmhnsmfwarclrqaaalgqkdfvefxdlllspa
MDP0000169201  .....WSH-.WGG.T....................................................................
MDP0000399642  .....WSH-.WGG.T....................................................................
MDP0000582079  .....WRVT.AEN.T....................................................................
MDP0000129765  .....NAX-.---.-....................................................................
MDP0000272655  .....----.---.-....................................................................
MDP0000686821  .....NPKCnRSV.K....................................................................
MDP0000170414  .....WSH-.WGG.T....................................................................
MDP0000320804  .....WSH-.WGG.T....................................................................
MDP0000189790  .....PSEN.FNP.D....................................................................
MDP0000847111  .....WRVT.AEN.T....................................................................
MDP0000289536  .....MNR-.---.-....................................................................
MDP0000123987  .....WSH-.WGG.T....................................................................
MDP0000245245  .....WSH-.WGG.T....................................................................
MDP0000188553  .....----.---.Dgrqvpqkmvvevgdtfkkilkgtekvriensddmsvcqaisvvmdrhpelsltdltpntsrqkglahe
MDP0000296599  .....PSGK.SNL.P....................................................................
MDP0000746652  .....----.---.-....................................................................
MDP0000259265  .....----.---.D....................................................................
MDP0000151331  .....----.---.S....................................................................
MDP0000309775  .....LVH-.FGA.P....................................................................
MDP0000232736  .....----.---.-....................................................................
MDP0000320539  .....WYKE.HGV.E....................................................................
MDP0000239909  .....LMYL.KDF.S....................................................................
MDP0000259264  .....----.---.D....................................................................
MDP0000293613  .....LPCM.TP-.-....................................................................
MDP0000253362  .....LPCM.TP-.-....................................................................
MDP0000182973  .....CSE-.---.-....................................................................
MDP0000138005  .....----.---.-....................................................................
MDP0000261301  .....----.---.Dlggprvlfcadkavdlivksgvdsyltfksidvsficdesgglsnvpdsrsaifkdkslslieknqlm
MDP0000771633  .....ML--.---.-....................................................................
MDP0000851102  .....ML--.---.-....................................................................
MDP0000159873  .....TLK-.---.-....................................................................
MDP0000140206  .....WYAE.KGI.E....................................................................
MDP0000261201  .....TLK-.---.-....................................................................
MDP0000252244  .....TLK-.---.-....................................................................
MDP0000261821  .....WYKE.KGI.E....................................................................
MDP0000124454  .....----.---.-....................................................................
MDP0000234830  .....LPC-.---.-....................................................................
MDP0000297861  .....----.---.-....................................................................
MDP0000152184  .....WYKE.HGI.E....................................................................
MDP0000157871  .....WYAE.KGI.V....................................................................
MDP0000250932  .....XEYA.MEM.R....................................................................
MDP0000219521  .....GVKP.VEY.R....................................................................
MDP0000239289  .....----.---.-....................................................................
MDP0000258995  .....----.---.-....................................................................
MDP0000167343  .....----.---.Vevrfvgdrettdfdvkpveyq...............................................
MDP0000222306  .....----.---.Vevrfvgdrettdfdvkpveyq...............................................
MDP0000829384  .....----.---.Fcadkaidliaksgvgsylsfksidvsficdengrlsnvpdsrsaifkdkslslieknqlmrffklvqq
MDP0000145663  .....LDR-.---.-....................................................................
MDP0000288439  .....WVES.RNA.-....................................................................
MDP0000267350  .....----.---.-....................................................................
MDP0000155608  .....----.---.-....................................................................
MDP0000194622  .....LNR-.---.-....................................................................
MDP0000134271  .....----.---.-....................................................................
MDP0000312748  .....FVEF.MDL.L....................................................................
MDP0000197715  .....----.NKI.K....................................................................
MDP0000220943  .....----.---.-....................................................................
MDP0000320539  .....----.---.-....................................................................
MDP0000140206  .....----.---.-....................................................................
MDP0000215521  .....ITQ-.LPM.N....................................................................
MDP0000203847  .....KSGR.IGV.H....................................................................
MDP0000201011  .....KAAK.SGR.I....................................................................
MDP0000204596  .....----.---.-....................................................................
MDP0000148978  .....----.SPS.S....................................................................
MDP0000130369  .....LPAP.FGT.Lyytqfaqlplvdrltslp..................................................
MDP0000314606  .....LARK.---.-....................................................................
MDP0000263146  .....LCRS.TQH.S....................................................................
MDP0000250583  .....----.YPS.D....................................................................
MDP0000208233  .....MYK-.RNV.E....................................................................
MDP0000158720  .....FXD-.QGV.E....................................................................
MDP0000152184  .....----.---.-....................................................................
MDP0000182702  .....----.---.-....................................................................
MDP0000261638  .....----.FFI.Y....................................................................
MDP0000130370  .....GLS-.APA.E....................................................................
MDP0000272119  .....----.---.-....................................................................
MDP0000305861  .....TEA-.ACL.K....................................................................
MDP0000255696  .....SEA-.---.A....................................................................
MDP0000214280  .....----.---.S....................................................................
MDP0000210966  .....AXW-.---.-....................................................................
MDP0000610999  .....----.---.-....................................................................
MDP0000242546  .....----.---.-....................................................................
MDP0000320742  .....KAEE.LGV.E....................................................................
MDP0000654164  .....LFK-.---.-....................................................................
MDP0000256300  .....-MK-.SG-.-....................................................................
MDP0000235080  .....ISN-.---.-....................................................................
MDP0000284363  .....WEAEcVKI.D....................................................................
MDP0000125043  .....----.---.-....................................................................
MDP0000192359  .....VGWN.KQM.V....................................................................
MDP0000440005  .....----.NGQ.L....................................................................
MDP0000609131  .....F---.---.-....................................................................
MDP0000362000  .....----.---.-....................................................................
MDP0000150210  .....YPR-.YGN.Q....................................................................
MDP0000158790  .....----.---.-....................................................................
MDP0000427950  .....----.---.-....................................................................
MDP0000569169  .....VYYW.MGL.K....................................................................
MDP0000525742  .....----.---.-....................................................................
MDP0000559829  .....----.---.-....................................................................
MDP0000321788  .....----.---.-....................................................................
MDP0000919183  .....----.---.-....................................................................
MDP0000146158  .....----.---.-....................................................................
MDP0000832077  .....----.---.-....................................................................
MDP0000621365  .....----.---.-....................................................................
MDP0000875229  .....----.---.-....................................................................
MDP0000251344  .....MVN-.---.-....................................................................
MDP0000168919  .....----.---.-....................................................................
MDP0000267855  .....----.---.-....................................................................
MDP0000195207  .....RMIN.VER.P....................................................................
MDP0000400145  .....----.---.-....................................................................
MDP0000919183  .....----.---.-....................................................................
MDP0000307336  .....----.---.-....................................................................
MDP0000263146  .....----.---.-....................................................................
MDP0000309730  .....----.---.-....................................................................
MDP0000163903  .....----.---.-....................................................................
MDP0000611628  .....----.---.-....................................................................
MDP0000119779  .....----.---.-....................................................................
MDP0000120904  .....----.---.-....................................................................
MDP0000150544  .....----.---.-....................................................................
MDP0000902209  .....----.---.-....................................................................
MDP0000269370  .....----.---.-....................................................................
MDP0000146158  .....----.---.-....................................................................
MDP0000124051  .....VGW-.NKMvL....................................................................
MDP0000255696  .....----.---.-....................................................................
MDP0000305861  .....----.---.-....................................................................
MDP0000611628  .....----.---.-....................................................................
MDP0000309622  .....----.---.-....................................................................
MDP0000239909  .....----.---.-....................................................................
MDP0000126888  .....----.---.-....................................................................
MDP0000869086  .....----.---.-....................................................................
MDP0000317524  .....LLYL.KDF.C....................................................................
MDP0000160099  .....----.---.-....................................................................
MDP0000251205  .....----.---.-....................................................................
MDP0000314335  .....----.---.-....................................................................
MDP0000638870  .....----.---.-....................................................................
MDP0000790657  .....----.---.-....................................................................
MDP0000748068  .....----.---.-....................................................................
MDP0000727481  .....----.---.-....................................................................
MDP0000301246  .....----.---.-....................................................................
MDP0000190684  .....----.---.-....................................................................
MDP0000456223  .....----.---.-....................................................................
MDP0000745172  .....----.---.-....................................................................
MDP0000407932  .....----.---.-....................................................................
MDP0000440896  .....----.---.-....................................................................
MDP0000694227  .....----.---.-....................................................................
MDP0000123987  .....----.---.-....................................................................
MDP0000138005  .....----.---.Dgrqvpqkmvvevgdtfkkilkgtekvriensddmsvcqaisvvmdrhpelsltdltpntsrqkglahe
MDP0000258205  .....----.---.-....................................................................
MDP0000245245  .....----.---.-....................................................................
MDP0000306704  .....----.---.-....................................................................
MDP0000478654  .....----.---.-....................................................................
MDP0000728219  .....----.---.-....................................................................
MDP0000170414  .....----.---.-....................................................................
MDP0000284363  .....----.---.-....................................................................
MDP0000219560  .....----.---.-....................................................................
MDP0000235930  .....----.PNV.R....................................................................
MDP0000755938  .....----.---.-....................................................................
MDP0000138851  .....----.---.-....................................................................
MDP0000261638  .....----.---.-....................................................................
MDP0000317524  .....----.---.-....................................................................
MDP0000294615  .....----.---.-....................................................................
MDP0000208234  .....LAS-.YGI.E....................................................................
MDP0000216129  .....----.---.-....................................................................
MDP0000219521  .....----.---.-....................................................................
MDP0000248995  .....----.---.-....................................................................
MDP0000256328  .....----.---.-....................................................................
MDP0000181673  .....----.---.-....................................................................
MDP0000169201  .....----.---.-....................................................................
MDP0000263530  .....----.---.-....................................................................
MDP0000295839  .....----.---.-....................................................................
MDP0000297466  .....LLR-.---.-....................................................................
MDP0000281982  .....----.---.-....................................................................
MDP0000053966  .....----.---.-....................................................................
MDP0000795740  .....----.---.-....................................................................
MDP0000212327  .....PLE-.---.-....................................................................
MDP0000437365  .....----.---.-....................................................................
MDP0000135231  .....----.---.-....................................................................
MDP0000167343  .....----.---.-....................................................................
MDP0000222306  .....----.---.-....................................................................
MDP0000183517  .....ELGX.INV.I....................................................................
MDP0000686821  .....IKT-.REI.T....................................................................
MDP0000430157  .....----.---.-....................................................................
MDP0000373054  .....----.---.-....................................................................
MDP0000295306  .....----.---.-....................................................................
MDP0000233995  .....----.ATI.D....................................................................
MDP0000209681  .....----.ATI.D....................................................................
MDP0000876898  .....----.---.-....................................................................
MDP0000738522  .....----.---.S....................................................................
MDP0000399642  .....----.---.-....................................................................
MDP0000215521  .....----.---.-....................................................................
MDP0000170521  .....----.---.-....................................................................
MDP0000262982  .....----.---.-....................................................................
MDP0000321186  .....----.---.-....................................................................
MDP0000266051  .....----.---.-....................................................................
MDP0000837610  .....----.---.-....................................................................
MDP0000582079  .....----.---.-....................................................................
MDP0000538071  .....----.---.-....................................................................
MDP0000241703  .....----.---.-....................................................................
MDP0000671114  .....----.---.-....................................................................
MDP0000315388  .....----.---.-....................................................................
MDP0000134271  .....----.---.-....................................................................
MDP0000297581  .....----.---.-....................................................................
MDP0000911003  .....AKF-.---.-....................................................................
MDP0000576650  .....----.---.-....................................................................
MDP0000149205  .....----.---.-....................................................................
MDP0000315409  .....----.---.-....................................................................
MDP0000320804  .....----.---.-....................................................................
MDP0000474647  .....----.---.-....................................................................
MDP0000566648  .....----.---.-....................................................................
MDP0000171379  .....----.---.-....................................................................
MDP0000814529  .....----.---.-....................................................................
MDP0000218295  .....----.---.-....................................................................
MDP0000220943  .....----.---.-....................................................................
MDP0000795437  .....----.---.-....................................................................
MDP0000919706  .....----.---.-....................................................................
MDP0000295675  .....----.---.-....................................................................
MDP0000147542  .....----.---.-....................................................................
MDP0000272126  .....VGWN.QGM.V....................................................................
MDP0000196881  .....----.---.-....................................................................
MDP0000268346  .....----.---.-....................................................................
MDP0000147542  .....----.---.-....................................................................
MDP0000948298  .....----.---.-....................................................................
MDP0000220943  .....----.---.-....................................................................
MDP0000182589  .....----.---.-....................................................................
MDP0000557870  .....----.---.-....................................................................
MDP0000308870  .....----.---.-....................................................................
MDP0000322449  .....----.---.-....................................................................
MDP0000286494  .....----.---.-....................................................................
MDP0000150868  .....----.---.-....................................................................
MDP0000155608  .....----.---.-....................................................................
MDP0000168505  .....----.---.-....................................................................
MDP0000196888  .....----.---.-....................................................................
MDP0000154812  .....----.---.-....................................................................
MDP0000186080  .....----.---.-....................................................................
MDP0000220012  .....----.---.-....................................................................
MDP0000169409  .....VGWN.QGM.V....................................................................
MDP0000373095  .....----.---.-....................................................................
MDP0000235846  .....----.---.-....................................................................
MDP0000207126  .....----.---.-....................................................................
MDP0000268357  .....----.---.-....................................................................
MDP0000770761  .....----.---.-....................................................................
MDP0000149067  .....----.---.-....................................................................


                                                                                               130  
                                                                                                 |  
d1cf3a1          ..........................................................................GW....NWD
MDP0000813172  ..........................................................................--....---
MDP0000251581  ..........................................................................--....---
MDP0000188391  ..........................................................................--....---
MDP0000254144  ..........................................................................RSt...DEK
MDP0000321972  ..........................................................................--....DTD
MDP0000299806  ..........................................................................DV....PLG
MDP0000283451  ..........................................................................DV....SLG
MDP0000296714  ..........................................................................K-....---
MDP0000162193  ..........................................................................D-....---
MDP0000769741  ..........................................................................GV....AHK
MDP0000295277  ..........................................................................YVk...GYG
MDP0000897124  ..........................................................................YVk...GYG
MDP0000854208  ..........................................................................FDh...GED
MDP0000241767  ..........................................................................LP....NWN
MDP0000318858  ..........................................................................--....---
MDP0000248995  ..........................................................................YVq...DYN
MDP0000442206  ..........................................................................--....---
MDP0000181673  ..........................................................................YVq...DYS
MDP0000315409  ..........................................................................YVq...DYD
MDP0000053966  ..........................................................................YVq...DYD
MDP0000294615  ..........................................................................YVq...DYD
MDP0000306147  ..........................................................................LP....NWN
MDP0000180064  ..........................................................................WK....IFN
MDP0000261625  .........................................................................dVLft..SEG
MDP0000300208  ..........................................................................FFe...GEG
MDP0000247171  ..........................................................................--....---
MDP0000308095  ..........................................................................AFl...STN
MDP0000319421  ..........................................................................--....---
MDP0000232295  ..........................................................................GW....DKE
MDP0000188994  ..........................................................................--....---
MDP0000159189  ..........................................................................--....---
MDP0000656178  ..........................................................................ILt...GVG
MDP0000910523  ..........................................................................--....---
MDP0000119941  ..........................................................................YVk...GYG
MDP0000231799  ..........................................................................ILt...GVG
MDP0000255025  ..........................................................................IH....GIL
MDP0000231632  ..........................................................................DDd...TQE
MDP0000173300  ..........................................................................FF....GGS
MDP0000158474  ..........................................................................--....---
MDP0000276878  ..........................................................................DI....DRS
MDP0000154720  ..........................................................................--....---
MDP0000549646  ..........................................................................--....---
MDP0000158853  ..........................................................................GKl...SVG
MDP0000702799  ..........................................................................GKl...SVG
MDP0000233110  ..........................................................................LY....ASE
MDP0000260827  ..........................................................................V-....---
MDP0000941459  ..........................................................................GDf...EYS
MDP0000185338  ..........................................................................DW....DLQ
MDP0000451172  ..........................................................................--....---
MDP0000136847  ..........................................................................--....--N
MDP0000177641  ..........................................................................--....---
MDP0000413935  ..........................................................................V-....---
MDP0000206098  ..........................................................................GI....DYD
MDP0000845788  ..........................................................................VE....SID
MDP0000465595  ..........................................................................--....DKE
MDP0000137211  ..........................................................................--....---
MDP0000130099  ..........................................................................EW....NMD
MDP0000425135  ..........................................................................--....DWD
MDP0000200780  ..........................................................................ILle..TLA
MDP0000142434  ..........................................................................--....---
MDP0000248951  ..........................................................................--....--N
MDP0000869086  ..........................................................................DWf...GLR
MDP0000318256  ..........................................................................--....---
MDP0000231634  ..........................................................................DDd...TQE
MDP0000626995  ..........................................................................--....---
MDP0000123832  ..........................................................................--....---
MDP0000236092  ..........................................................................--....---
MDP0000199159  ..........................................................................DWf...GLR
MDP0000162755  ..........................................................................--....---
MDP0000173666  ..........................................................................DDd...TQE
MDP0000262982  ..........................................................................QSa...RYD
MDP0000184832  ..........................................................................--....---
MDP0000598927  ..........................................................................FDh...GED
MDP0000561228  ..........................................................................-W....DIN
MDP0000175650  ..........................................................................HF....SQY
MDP0000233802  ..........................................................................--....KVD
MDP0000321186  ..........................................................................--....---
MDP0000161955  ..........................................................................I-....---
MDP0000213381  ..........................................................................TKl...SYP
MDP0000168437  ..........................................................................--....---
MDP0000823251  ..........................................................................--....KVD
MDP0000191389  ..........................................................................TKl...SYP
MDP0000199319  ..........................................................................TKl...SYP
MDP0000857446  ..........................................................................TKl...SY-
MDP0000266638  ..........................................................................TKl...SYP
MDP0000208936  ..........................................................................LY....ASE
MDP0000202883  ..........................................................................--....---
MDP0000288439  ..........................................................................--....---
MDP0000295839  ..........................................................................--....---
MDP0000903805  ..........................................................................--....---
MDP0000202123  ..........................................................................LIe...GRG
MDP0000227773  ..........................................................................DWf...GLR
MDP0000317524  ..........................................................................DWf...GLR
MDP0000320748  ..........................................................................TKl...SY-
MDP0000634676  ..........................................................................TKl...SY-
MDP0000235846  ..........................................................................--....KVD
MDP0000251344  ..........................................................................--....KVD
MDP0000501957  ..........................................................................TKl...SYP
MDP0000209681  ..........................................................................SA....FFD
MDP0000293482  ..........................................................................--....---
MDP0000233995  ..........................................................................SA....FFD
MDP0000257243  ..........................................................................--....---
MDP0000160099  ..........................................................................DWf...GLR
MDP0000193196  ..........................................................................TKl...SYP
MDP0000208234  ..........................................................................SA....EYD
MDP0000251783  ..........................................................................--....---
MDP0000686885  ..........................................................................--....---
MDP0000138851  ..........................................................................SA....QYD
MDP0000194930  .....................................................................skvlnN-....---
MDP0000169201  ..........................................................................GE....PFS
MDP0000399642  ..........................................................................GE....PFS
MDP0000582079  ..........................................................................LL....G--
MDP0000129765  ..........................................................................--....---
MDP0000272655  ..........................................................................--....---
MDP0000686821  ..........................................................................SA....XYD
MDP0000170414  ..........................................................................GE....PFS
MDP0000320804  ..........................................................................GE....PFS
MDP0000189790  ..........................................................................--....---
MDP0000847111  ..........................................................................LLg...AQE
MDP0000289536  ..........................................................................--....---
MDP0000123987  ..........................................................................GE....PFS
MDP0000245245  ..........................................................................GE....PFS
MDP0000188553  ......................................................vlqwyicrmeawfaadadviSLk...NWD
MDP0000296599  ..........................................................................SWvd..GPA
MDP0000746652  ..........................................................................--....---
MDP0000259265  ..........................................................................SA....VCD
MDP0000151331  ..........................................................................GI....EWD
MDP0000309775  ..........................................................................--....---
MDP0000232736  ..........................................................................--....---
MDP0000320539  ..........................................................................LVl...GTR
MDP0000239909  ..........................................................................REf...GVA
MDP0000259264  ..........................................................................SA....VCD
MDP0000293613  ..........................................................................--....---
MDP0000253362  ..........................................................................--....---
MDP0000182973  ..........................................................................--....---
MDP0000138005  ..........................................................................--....---
MDP0000261301  rffklvqqhlaasagddggsesskiseedlespfadflkrmrlppkiksiilyaisladddqdslevcktvlktRE....GMQ
MDP0000771633  ..........................................................................--....---
MDP0000851102  ..........................................................................--....---
MDP0000159873  ..........................................................................--....---
MDP0000140206  ..........................................................................LLl...STE
MDP0000261201  ..........................................................................--....---
MDP0000252244  ..........................................................................--....---
MDP0000261821  ..........................................................................LIl...STE
MDP0000124454  ..........................................................................--....---
MDP0000234830  ..........................................................................--....-MT
MDP0000297861  ..........................................................................--....---
MDP0000152184  ..........................................................................LVi...GTQ
MDP0000157871  ..........................................................................LLl...STE
MDP0000250932  ..........................................................................KI....---
MDP0000219521  ..........................................................................SL....SPA
MDP0000239289  ..........................................................................--....---
MDP0000258995  ..........................................................................--....---
MDP0000167343  ..........................................................................SL....SXA
MDP0000222306  ..........................................................................SL....SXA
MDP0000829384  ........hlaasagddggnesakiseedlespfadflkrmrlppkikssilyaisladddqdnsevcktvlktR-....-EG
MDP0000145663  ..........................................................................--....---
MDP0000288439  ..........................................................................--....---
MDP0000267350  ..........................................................................--....---
MDP0000155608  ..........................................................................--....---
MDP0000194622  ..........................................................................--....---
MDP0000134271  ..........................................................................--....---
MDP0000312748  ..........................................................................LSp...ASK
MDP0000197715  ..........................................................................F-....CWG
MDP0000220943  ..........................................................................SIsg..EYG
MDP0000320539  ..........................................................................--....---
MDP0000140206  ..........................................................................--....---
MDP0000215521  ..........................................................................SIsg..EYG
MDP0000203847  ..........................................................................AVs...EYA
MDP0000201011  ..........................................................................GVhavsEYA
MDP0000204596  ..........................................................................--....---
MDP0000148978  ..........................................................................VWf...KVQ
MDP0000130369  ..........................................................................LTa...AVI
MDP0000314606  ..........................................................................--....---
MDP0000263146  ..........................................................................--....---
MDP0000250583  ..........................................................................HYg...PTQ
MDP0000208233  ..........................................................................SA....EYD
MDP0000158720  ..........................................................................LK....TED
MDP0000152184  ..........................................................................--....---
MDP0000182702  ..........................................................................--....---
MDP0000261638  ..........................................................................VQ....DYD
MDP0000130370  ..........................................................................QC....S--
MDP0000272119  ..........................................................................--....---
MDP0000305861  ..........................................................................--....---
MDP0000255696  ..........................................................................CL....---
MDP0000214280  ..........................................................................GI....EWD
MDP0000210966  ..........................................................................--....---
MDP0000610999  ..........................................................................--....---
MDP0000242546  ..........................................................................--....---
MDP0000320742  ..........................................................................IYp...GFA
MDP0000654164  ..........................................................................--....---
MDP0000256300  ..........................................................................-I....EWD
MDP0000235080  ..........................................................................--....---
MDP0000284363  ..........................................................................AAnkxvSLR
MDP0000125043  ..........................................................................--....---
MDP0000192359  ..........................................................................SDay..KWV
MDP0000440005  ..........................................................................IA....SRA
MDP0000609131  ..........................................................................VEt...AVN
MDP0000362000  ..........................................................................--....---
MDP0000150210  ..........................................................................LG....NFC
MDP0000158790  ..........................................................................--....---
MDP0000427950  ..........................................................................--....---
MDP0000569169  ..........................................................................--....---
MDP0000525742  ..........................................................................--....---
MDP0000559829  ..........................................................................--....---
MDP0000321788  ..........................................................................--....---
MDP0000919183  ..........................................................................--....---
MDP0000146158  ..........................................................................--....---
MDP0000832077  ..........................................................................--....---
MDP0000621365  ..........................................................................--....---
MDP0000875229  ..........................................................................--....---
MDP0000251344  ..........................................................................--....KVD
MDP0000168919  ..........................................................................--....---
MDP0000267855  ..........................................................................--....---
MDP0000195207  ..........................................................................CWis..KLE
MDP0000400145  ..........................................................................--....---
MDP0000919183  ..........................................................................--....---
MDP0000307336  ..........................................................................--....---
MDP0000263146  ..........................................................................--....---
MDP0000309730  ..........................................................................--....---
MDP0000163903  ..........................................................................--....---
MDP0000611628  ..........................................................................--....---
MDP0000119779  ..........................................................................--....---
MDP0000120904  ..........................................................................--....---
MDP0000150544  ..........................................................................--....---
MDP0000902209  ..........................................................................--....---
MDP0000269370  ..........................................................................--....---
MDP0000146158  ..........................................................................--....---
MDP0000124051  ..........................................................................DAy...KWV
MDP0000255696  ..........................................................................--....---
MDP0000305861  ..........................................................................--....---
MDP0000611628  ..........................................................................--....---
MDP0000309622  ..........................................................................--....---
MDP0000239909  ..........................................................................--....---
MDP0000126888  ..........................................................................--....---
MDP0000869086  ..........................................................................--....---
MDP0000317524  ..........................................................................DWf...GLR
MDP0000160099  ..........................................................................--....---
MDP0000251205  ..........................................................................--....---
MDP0000314335  ..........................................................................--....---
MDP0000638870  ..........................................................................--....---
MDP0000790657  ..........................................................................--....---
MDP0000748068  ..........................................................................--....---
MDP0000727481  ..........................................................................--....---
MDP0000301246  ..........................................................................--....---
MDP0000190684  ..........................................................................--....---
MDP0000456223  ..........................................................................--....---
MDP0000745172  ..........................................................................--....---
MDP0000407932  ..........................................................................--....---
MDP0000440896  ..........................................................................--....---
MDP0000694227  ..........................................................................--....---
MDP0000123987  ..........................................................................--....---
MDP0000138005  ......................................................vlqwyicrmeawfaadadviSLk...NWD
MDP0000258205  ..........................................................................--....---
MDP0000245245  ..........................................................................--....---
MDP0000306704  ..........................................................................--....DYS
MDP0000478654  ..........................................................................--....---
MDP0000728219  ..........................................................................--....---
MDP0000170414  ..........................................................................--....---
MDP0000284363  ..........................................................................--....---
MDP0000219560  ..........................................................................--....---
MDP0000235930  ..........................................................................IVas..TAA
MDP0000755938  ..........................................................................--....---
MDP0000138851  ..........................................................................--....---
MDP0000261638  ..........................................................................--....---
MDP0000317524  ..........................................................................--....---
MDP0000294615  ..........................................................................--....---
MDP0000208234  ..........................................................................--....---
MDP0000216129  ..........................................................................--....---
MDP0000219521  ..........................................................................--....---
MDP0000248995  ..........................................................................--....---
MDP0000256328  ..........................................................................--....---
MDP0000181673  ..........................................................................--....---
MDP0000169201  ..........................................................................--....---
MDP0000263530  ..........................................................................--....---
MDP0000295839  ..........................................................................--....---
MDP0000297466  ..........................................................................--....---
MDP0000281982  ..........................................................................-Vq...DYS
MDP0000053966  ..........................................................................--....---
MDP0000795740  ..........................................................................--....---
MDP0000212327  ..........................................................................--....---
MDP0000437365  ..........................................................................--....---
MDP0000135231  ..........................................................................--....---
MDP0000167343  ..........................................................................--....---
MDP0000222306  ..........................................................................--....---
MDP0000183517  ..........................................................................--....---
MDP0000686821  ..........................................................................VLp...SIT
MDP0000430157  ..........................................................................--....---
MDP0000373054  ..........................................................................--....---
MDP0000295306  ..........................................................................--....---
MDP0000233995  ..........................................................................VLp...SIT
MDP0000209681  ..........................................................................VLp...SIT
MDP0000876898  ..........................................................................--....---
MDP0000738522  ..........................................................................GI....EWD
MDP0000399642  ..........................................................................--....---
MDP0000215521  ..........................................................................--....---
MDP0000170521  ..........................................................................--....---
MDP0000262982  ..........................................................................--....---
MDP0000321186  ..........................................................................--....---
MDP0000266051  ..........................................................................--....---
MDP0000837610  ..........................................................................--....---
MDP0000582079  ..........................................................................--....---
MDP0000538071  ..........................................................................--....---
MDP0000241703  ..........................................................................--....---
MDP0000671114  ..........................................................................--....---
MDP0000315388  ..........................................................................--....---
MDP0000134271  ..........................................................................--....---
MDP0000297581  ..........................................................................--....---
MDP0000911003  ..........................................................................--....---
MDP0000576650  ..........................................................................--....---
MDP0000149205  ..........................................................................--....---
MDP0000315409  ..........................................................................--....---
MDP0000320804  ..........................................................................--....---
MDP0000474647  ..........................................................................--....---
MDP0000566648  ..........................................................................--....---
MDP0000171379  ..........................................................................--....---
MDP0000814529  ..........................................................................--....---
MDP0000218295  ..........................................................................--....---
MDP0000220943  ..........................................................................SIsg..EYG
MDP0000795437  ..........................................................................--....---
MDP0000919706  ..........................................................................--....---
MDP0000295675  ..........................................................................--....---
MDP0000147542  ..........................................................................--....---
MDP0000272126  ..........................................................................DQ....SYE
MDP0000196881  ..........................................................................--....---
MDP0000268346  ..........................................................................--....---
MDP0000147542  ..........................................................................--....---
MDP0000948298  ..........................................................................--....---
MDP0000220943  ..........................................................................--....---
MDP0000182589  ..........................................................................--....---
MDP0000557870  ..........................................................................--....---
MDP0000308870  ..........................................................................--....---
MDP0000322449  ..........................................................................--....---
MDP0000286494  ..........................................................................--....---
MDP0000150868  ..........................................................................--....---
MDP0000155608  ..........................................................................--....---
MDP0000168505  ..........................................................................--....---
MDP0000196888  ..........................................................................--....---
MDP0000154812  ..........................................................................--....---
MDP0000186080  ..........................................................................--....---
MDP0000220012  ..........................................................................--....---
MDP0000169409  ..........................................................................DQ....SYE
MDP0000373095  ..........................................................................--....---
MDP0000235846  ..........................................................................--....---
MDP0000207126  ..........................................................................--....---
MDP0000268357  ..........................................................................--....---
MDP0000770761  ..........................................................................--....---
MDP0000149067  ..........................................................................--....---


                           140                                   150              160               
                             |                                     |                |               
d1cf3a1          ....NVAA.YSLQAE............................RARAPNAKQIAAGHY.......FNA.SCHG......VNG.
MDP0000813172  ....----.-FSRTE............................DGRIYQ---------.......---.----......---.
MDP0000251581  ....----.-FSRTE............................DGRIYQ---------.......---.----......---.
MDP0000188391  ....----.-FSRTE............................DGRIYQ---------.......---.----......---.
MDP0000254144  ....QLLD.WHLANLeyan........................A--------------.......---.----......--Gc
MDP0000321972  ...gHQVP.QKMVVE............................VGDTF----------.......-KK.ILRE......TEKv
MDP0000299806  ....TALE.AFRRVYsvardtqermll................D--------------.......---.WH--......--La
MDP0000283451  ....TALE.AFQRVYsvaqdpqermll................DWHLAN---------.......---.----......LEYa
MDP0000296714  ....----.------............................---------------.......---.----......--Kn
MDP0000162193  ....----.------............................---------------.......---.----......--Gf
MDP0000769741  ....VLQW.YLCRME............................GWFAADADTISLKCW.......DQE.ELLP......---.
MDP0000295277  ....KFIS.PSEISVdtidg.......................ENKVVKGKNIIIATG.......SDVkSLPGit....IDEk
MDP0000897124  ....KFIS.PSEISVdaidg.......................ENTVVKGKNIIIATG.......SDVkSLPGit....IDEk
MDP0000854208  ....----.------............................---------------.......-GN.LHLA......REG.
MDP0000241767  ....Q---.------............................---------------.......-DD.VYGG......FGG.
MDP0000318858  ....----.------............................-----ENNAIVLAVGa......TKP.RDLP......VPGr
MDP0000248995  ....ETDP.KTHEGM............................NLTRVTTRDLIAKYG.......LDD.NTVD......FIGh
MDP0000442206  ....----.------............................-----ENNAIVLAVGa......TKP.RDLP......VPGr
MDP0000181673  ....ETDP.KTHEGM............................DLTRVTTRDLIAKYG.......LDD.NTVD......FIGh
MDP0000315409  ....ENDP.KSHEGL............................DLNKVTARELISKYG.......LDD.NTVD......FIGh
MDP0000053966  ....ENDP.KSHEGM............................DLNKVTARELILKYG.......LDD.NTVD......FIGh
MDP0000294615  ....ENDP.KSHEGM............................DLNKVTARELILKYG.......LDD.NTVD......FIGh
MDP0000306147  ....Q---.------............................---------------.......-DD.VYGG......FGG.
MDP0000180064  ....ALNS.LELKSL............................EEPIYLFGQFFQKPVecl....TLA.YYLP......QNA.
MDP0000261625  ....KLLD.SRLKFN............................KMFNLNX--------.......-YY.RYPXslnxxiL--.
MDP0000300208  ....KIVG.PNDVEVtqldg.......................TKLSYSAKHILIATG.......SRA.QRPA......IPGq
MDP0000247171  ....----.------............................---------------.......--A.ASNG......--Nd
MDP0000308095  ....QIKA.GFPIATm...........................TDFTANHHHCHISLF.......WIP.LLAE......LDF.
MDP0000319421  ....----.------............................---------------.......---.----......---.
MDP0000232295  ....MVTN.AYQWVE............................SRIVF----------.......---.----......---.
MDP0000188994  ....----.------............................---------------.......---.----......---.
MDP0000159189  ....----.------............................---------------.......---.----......---.
MDP0000656178  ....TILG.PQKVQIgs..........................SDKVVTAKDIIIATG.......SVP.FVPKgie...VDGk
MDP0000910523  ....----.VSLAAS............................NGND-----------.......---.----......---.
MDP0000119941  ....KFIS.PSEISVdtidg.......................ENKVVKGKNIIIATEtcgg...WSR.IYRP......RDG.
MDP0000231799  ....TILG.PQKVQIgs..........................SDKVXTAKDIIIATG.......SVP.FVPKgve...VDGk
MDP0000255025  ....AFLS.TNQIKA............................GFPFATT--------.......-TD.F---......---.
MDP0000231632  ....SVGG.FFQRHF............................GPEVVDYLI------.......-DP.FVAG......TSGg
MDP0000173300  ....EYLS.AMDTVC............................XRIGVTE--------.......---.----......---.
MDP0000158474  ....HVLK.LSSHFYggrl........................GSEIVRPNKFIKRVG.......WDA.KIVN......ESY.
MDP0000276878  ....ETLG.QFIKSR............................GYSELFQKA------.......---.YXVP......VCGs
MDP0000154720  ....----.------............................---------------.......---.----......---.
MDP0000549646  ....----.------............................---------------.......---.----......---.
MDP0000158853  ....SFLR.RGLDAY............................WVLTKNRDEQVNGNG.......NWS.RKLL......QEAi
MDP0000702799  ....SFLR.RGLDAY............................WVLTKNRDEQVNGNG.......NWS.RKLL......QEAi
MDP0000233110  ....DYQS.AMDIVC............................KRISVTE--------.......---.----......---.
MDP0000260827  ....----.------............................---------------.......---.----......---.
MDP0000941459  ....KLGD.XASRICasnddvg.....................KLSVGSFXRQGLDTYwvs....KKN.RDEQ......VSX.
MDP0000185338  ....MVNE.SYEWVE............................RAIVF----------.......---.----......---.
MDP0000451172  ....----.------............................---------------.......-NQ.RMVN......QSY.
MDP0000136847  ....LVNN.SYEWVE............................NTLVF----------.......---.----......---.
MDP0000177641  ....MVSD.AYKWVE............................SRNAF----------.......-KP.KLTP......WQY.
MDP0000413935  ....----.------............................---------------.......---.----......---.
MDP0000206098  ....EQDN.------............................---------------.......---.----......---.
MDP0000845788  ....VKTR.PFTVES............................SERKVKCNSLIFATG.......ATA.KRLR......IPRe
MDP0000465595  ....TVTN.AYQWVEsrvvfkpel...................TPWQYAAEFSFLEAG.......---.----......---.
MDP0000137211  ....----.------............................---------------.......-SG.IKLD......MNLv
MDP0000130099  ....LVNA.TYEWIE............................DTIVYKPNAFAWQTI.......TQQ.AFLE......---.
MDP0000425135  ...pRMVNeSYEWVE............................RAIV-----------.......---.----......---.
MDP0000200780  ....KELP.PGAIVI............................GCDGIRSP-------.......-IA.TWMG......FPE.
MDP0000142434  ....----.------............................---------------.......---.----......---.
MDP0000248951  ....LVNN.SYEWVE............................NTLVF----------.......---.----......---.
MDP0000869086  ....ELIR.FNTRVSyvgmldgdhvvgckdlkwvvksvekkteIFIEEVFDAVVVATGhy.....SKP.RLPS......IQGm
MDP0000318256  ....LVNN.SYEWVE............................NTVAF----------.......---.----......---.
MDP0000231634  ....SVGG.FFQRHF............................GQEVV----------.......-DY.LIDP......FVAf
MDP0000626995  ....----.------............................---------------.......---.----......---.
MDP0000123832  ....----.------............................---------------.......--A.ASNG......--Nd
MDP0000236092  ....----.------............................---------------.......---.----......---.
MDP0000199159  ....ELIR.FNTRVSyvgmlngdhvvgckdlkwvvksvenkteSFVEEVFDAVVVATGhy.....SKP.RLPS......IKG.
MDP0000162755  ....----.------............................-----HGDHE-----.......---.----......---.
MDP0000173666  ....SVGG.FFQRHF............................GXEM-----------.......---.----......---.
MDP0000262982  ....ETSG.FWRVKXvtstestr....................SEVEYICRWLIVATGen.....AEC.VVPE......INGl
MDP0000184832  ....IVSD.AYKWVE............................SRNAF----------.......-KP.KLTP......WPY.
MDP0000598927  ....----.------............................---------------.......-GN.LHLA......REG.
MDP0000561228  ....LVNA.TYEWIE............................DTIVYKPNAFAWQTV.......TQK.AFLE......AGVl
MDP0000175650  ....KLIS.LLLKQL............................ENLSF----------.......---.----......---.
MDP0000233802  ....FSTT.PFKIFA............................DERTVLADSVVVATG.......AVA.KRLP......FPGs
MDP0000321186  ....----.------............................---------------.......---.--LG......IPGe
MDP0000161955  ....----.------............................---------------.......---.----......---.
MDP0000213381  ....----.------............................-LETYSSDI------.......---.----......---.
MDP0000168437  ....----.------............................---------------.......---.----......V--.
MDP0000823251  ....FSTT.PFKIFA............................DERTVLADSVVVATG.......AVA.KRLP......FPGs
MDP0000191389  ....----.------............................-LEDYTSD-------.......---.----......I--.
MDP0000199319  ....----.------............................-LETYSSDI------.......---.----......---.
MDP0000857446  ....----.------............................PLETYSSDI------.......---.----......---.
MDP0000266638  ....----.------............................-LETYSSDI------.......---.----......---.
MDP0000208936  ....DYKS.AMDIVC............................KRIGVTE--------.......---.----......---.
MDP0000202883  ....----.------............................---------------.......--N.YTLD......I--.
MDP0000288439  ....-VSD.AYKWVE............................SRNAF----------.......-KP.KLTP......WQY.
MDP0000295839  ....----.-----Vetasyvgekkwcvrvhntlsd.......VQEMYLAKFLVVASGen.....SEG.YIPQ......VEGl
MDP0000903805  ....----.------............................---------------.......-SG.IKLD......MNLv
MDP0000202123  ....KIVD.PHTVDV............................DGKLYSARHILVSVG.......GRP.FIPE......IPGs
MDP0000227773  ....ELIR.FNTRVSyvgmldgdhvvgckdlkwvvrsmekkaeI--------------.......---.----......---.
MDP0000317524  ....ELIR.FNTRVSyvgmldgdhaggckdlkwvvrsvekkteIFVEEVFDAVVVASGhy.....SKP.RLPS......IKGm
MDP0000320748  ....----.------............................---------------.......---.----......-PL.
MDP0000634676  ....----.------............................PLETYSSDI------.......---.----......---.
MDP0000235846  ....FSTT.PFKIFA............................NERTVLADSVVVATG.......AVA.KRLQ......FPGs
MDP0000251344  ....FSTT.PFKIFA............................NERTVLADSVVVATG.......AVA.KRLQ......FPGs
MDP0000501957  ....----.------............................-LETYSSDI------.......---.----......---.
MDP0000209681  ....ANVE.KWRVTVenilsg......................EQEIYLGKFLVVASGen.....SVG.YIPH......VQGl
MDP0000293482  ....----.------............................---------------.......---.----......---.
MDP0000233995  ....ANVE.KWRVTVenilsg......................EQEIYLGKFLVVASGen.....SVG.YIPH......VQGl
MDP0000257243  ....----.------............................---------------.......-SG.IKLD......MNLv
MDP0000160099  ....ELIR.FNTRVS............................YVGMLDGDHVVGCK-.......---.----......---.
MDP0000193196  ....----.------............................-LETYSSDI------.......---.----......---.
MDP0000208234  ....QVSK.KWTVKAkniggsg.....................EMEEYFGGFLVVATGea.....TNP.YTPE......IEGl
MDP0000251783  ....----.------............................---------------.......---.----......---.
MDP0000686885  ....----.------............................---------------.......---.----......---.
MDP0000138851  ....QVSK.KWIVKAknvggsg.....................EMEEYFGGFLVLATGet.....TDP.YIPE......IEGl
MDP0000194930  ....----.WFESDV............................LKATLA---------.......-MD.SVIG......TTGs
MDP0000169201  ....SXGK.WKVAVEdkhsr.......................STEVYLVDFVILCIG.......RFS.DVPN......IPEf
MDP0000399642  ....SXGK.WKVAVEdkhsr.......................STEVYLVDFVILCIG.......RFS.DVPN......IPEf
MDP0000582079  ....----.------............................AQEEYLGKFLVVASGen.....SIG.YVPE......VQGl
MDP0000129765  ....----.------............................---------------.......-DA.YAKNda....IDG.
MDP0000272655  ....----.------............................---------------.......-SG.IKLD......MNLv
MDP0000686821  ...vDLEK.WYVKVEntlsg.......................AQEMYLGKFLVVASGen.....SVG.YIPQ......VRGl
MDP0000170414  ....SXGK.WKVAVEdkhsr.......................STEVYLVDFVILCIG.......RFS.DVPN......IPEf
MDP0000320804  ....SGGK.WKVVVEdkqsl.......................STKIHVVDFVILCIG.......RFS.DVPN......IPEf
MDP0000189790  ....----.------............................---------------.......---.----......---.
MDP0000847111  ....EY--.------............................-----LGKFLVVASGen.....SIG.YVPE......VQGl
MDP0000289536  ....----.------............................---------------.......---.----......---.
MDP0000123987  ....SKGK.WKVA-Vedkhsr......................STEVYLVDFVILCIG.......RFS.DVPN......IPEf
MDP0000245245  ....SKGK.WKVA-Vedkhsr......................STEVYLVDFVILCIG.......RFS.DVPN......IPEf
MDP0000188553  ....QAYK.LRVLVV............................KEHVLSGGHGLMVQG.......YDP.IIKA......LAKd
MDP0000296599  ....R---.------............................---------------.......-SP.RTIG......TAE.
MDP0000746652  ....----.------............................---------------.......---.----......---.
MDP0000259265  ....EDEE.IWKVKVtgpd........................QYEYYSSDFLVVATGen.....NQA.IIPAd.....LPGl
MDP0000151331  ...mDLVNkTYKWVE............................NTIVGRPNNS-----.......---.----......---.
MDP0000309775  ....----.------............................---------------.......-EG.ILVD......GK-.
MDP0000232736  ....----.------............................---------------.......---.----......---.
MDP0000320539  ...vKSVD.VRRKTLltg.........................SGETISYKILIIATG.......ARA.LKLE......EFGv
MDP0000239909  ....EMVR.LETEVV............................---V-----------.......-VD.AAEGint...WKGk
MDP0000259264  ....EDEE.IWKVKVtgpd........................QYEYYSSDFLVVATGen.....NQA.IIPAd.....LPGl
MDP0000293613  ....-CFD.WFEVVY............................YWMGLKM--------.......-YD.LVAG......LRL.
MDP0000253362  ....-CFD.WFEVVY............................YWMGLKM--------.......-YD.LVAG......LRL.
MDP0000182973  ....----.-----H............................NIPHKQIGKLIVATGss.....EIP.NLHN......LMHr
MDP0000138005  ....----.------............................---------------.......---.----......---.
MDP0000261301  ....R-LD.LYQKS-............................---------------.......-VX.RFPN......VPG.
MDP0000771633  ....----.------............................---------------.......---.----......---.
MDP0000851102  ....----.------............................---------------.......---.----......---.
MDP0000159873  ....----.------............................---------------.......---.----......---.
MDP0000140206  iveaDLHS.KILTSE............................TGGMFEFETLIIATG.......SRV.LRLT......EFGv
MDP0000261201  ....----.------............................---------------.......---.----......---.
MDP0000252244  ....----.------............................---------------.......---.----......---.
MDP0000261821  ivkaDLPG.KTLVSG............................TGESFKYETLVIATG.......STV.IRLSdfg...VKGa
MDP0000124454  ....----.------............................---------------.......---.----......---.
MDP0000234830  ....PCFD.WFEVVY............................YWMGLKMYDLV----.......---.----......---.
MDP0000297861  ....----.------............................---------------.......---.----......---.
MDP0000152184  ...vKSVD.VRRKTLlxg.........................SGETISYKVLIIATG.......ARA.LKLE......EFGv
MDP0000157871  iveaDLHS.KILTSA............................TGGMFEFETLIIATG.......SRV.IRLT......EFGv
MDP0000250932  ....----.-VER--............................---------------.......---.----......---.
MDP0000219521  ....GGQP.VWEVAVqtndse......................TIQWYAFEFIVVCIG.......KYG.DTPK......IPEf
MDP0000239289  ....----.------............................---------------.......---.----......---.
MDP0000258995  ....----.------............................---------------.......---.----......---.
MDP0000167343  ....GGQP.VWEVAVqtndse......................TIQWYAFEFIVVCIG.......KYG.DXPQ......IPEf
MDP0000222306  ....GGQP.VWEVAVqtndse......................TIQWYAFEFIVVCIG.......KYG.DXPQ......IPEf
MDP0000829384  ...mERLD.LYQKS-............................---------------.......-VG.RFPN......VPG.
MDP0000145663  ....----.------............................---------------.......---.----......---.
MDP0000288439  ....----.------............................----F----------.......-KP.KLTP......WPY.
MDP0000267350  ....DLPG.KTLVSG............................SGESFKYQTLVIATG.......STV.IRLTdfg...VKGa
MDP0000155608  ....----.------............................---------------.......---.----......---.
MDP0000194622  ....----.------............................---------------.......---.----......---.
MDP0000134271  ....----.-----Vqmcsnpn.....................TIQWYAFEFIVVCIGkyg....DIP.RMPN......FPRn
MDP0000312748  ....VLNN.WFEAEV............................LKATLATDAVIGTTGsvhtpgsGYV.LLHH......VMGe
MDP0000197715  ...rEYLS.AMDTVC............................ERIGVTE--------.......---.----......---.
MDP0000220943  ....NLLN.GHPVWEvavqmsnnpn..................MIQWYAFEFIVVCIGkyg....DIP.RMPS......FPRn
MDP0000320539  ....----.------............................---------------.......---.----......---.
MDP0000140206  ....----.------............................---------------.......---.----......---.
MDP0000215521  ....SLLS.GHPVWEvavqmsnipn..................IIQWYAFEFIVVCIGkyg....DIP.RMPS......FPRn
MDP0000203847  ...sDL--.------............................---------------.......-TP.VYLE......HQG.
MDP0000201011  ...sDL--.------............................---------------.......-TP.VYLE......RQG.
MDP0000204596  ....----.------............................---------------.......---.----......---.
MDP0000148978  ....TVPG.KFKVAV............................---------------.......--P.NILGvr....TPGf
MDP0000130369  ....DFDN.TDTAWR............................KYDAITARELFKQFGc......S--.----......---.
MDP0000314606  ....----.------............................---------------.......---.----......---.
MDP0000263146  ....----.NLGLKE............................AEFSVDYDYLIVAMG.......AKT.NTFN......TPGv
MDP0000250583  ....SSLG.GTVLLE............................SGLLVEYDWLVLALG.......AES.KLDV......VPGa
MDP0000208233  ....QVSK.KWIVKA............................KNIGGSSE-------.......-ME.EYFGg.....FFGg
MDP0000158720  ....D---.------............................---------------.......---.----......---.
MDP0000152184  ....----.------............................---------------.......---.----......---.
MDP0000182702  ....----.------............................---------------.......---.----......---.
MDP0000261638  ....ENDP.KSHEGM............................DLNKVTARELILKYG.......LDD.NTVD......FIG.
MDP0000130370  ....----.------............................---------------.......---.----......---.
MDP0000272119  ....----.------............................---------------.......---.----......---.
MDP0000305861  ....----.-----Idaqnnkiychsnlennldgq........EEFVVDYDYLIIAVG.......ANV.NTFN......TPGv
MDP0000255696  ....KIDA.QNKKIYcrsnlennlngq................EEFVVDYDYLIIAVG.......ANV.NTFN......TPGv
MDP0000214280  ...mDLVNkTYKWVE............................NTIVGRPNNS-----.......---.----......---.
MDP0000210966  ....----.------............................---------------.......-DG.RLVN......ESY.
MDP0000610999  ....----.------............................---------------.......---.----......---.
MDP0000242546  ....----.------............................---------------.......---.----......---.
MDP0000320742  ....ASEQ.IMKKYN............................LREKGHSQHQTYALG.......IKE.VWEI......DEGk
MDP0000654164  ....----.------............................-----KNKNIIIATG.......SDV.KSLP......---.
MDP0000256300  ..mySVYK.AYRWVE............................ETIV-----------.......---.----......---.
MDP0000235080  ....----.------............................---------------.......---.KFFD......LEQe
MDP0000284363  ....ANFD.XN---Lvgn.........................KEFSLEYDYLVIALG.......AQV.NTFN......TPG.
MDP0000125043  ....----.------............................---------------.......---.----......---.
MDP0000192359  ....ESRN.AFKPKL............................TPWQYVAELSFLEAG.......---.----......---.
MDP0000440005  ...iNVTD.TEVLTA............................EGRLIPYDYLVIATG.......HSD.RVPK......TKT.
MDP0000609131  ....KFCK.YYESFE............................TRPXFET--------.......-VD.EMLK......WAGl
MDP0000362000  ....----.-----Dgaeplkp.....................WKFEIAYDKLVIALG.......AMP.TTFG......IQG.
MDP0000150210  ....EFMD.P-----............................---------------.......---.----......---.
MDP0000158790  ....----.------............................---------------.......---.----......---.
MDP0000427950  ....----.------............................---------------.......---.----......---.
MDP0000569169  ....----.------............................------M--------.......---.----......---.
MDP0000525742  ....----.------............................---------------.......---.----......---.
MDP0000559829  ....----.------............................---------------.......---.----......---.
MDP0000321788  ....----.------............................---------------.......---.----......---.
MDP0000919183  ....----.------............................---------------.......---.----......---.
MDP0000146158  ....----.------............................---------------.......---.----......---.
MDP0000832077  ....----.------............................---------------.......---.----......---.
MDP0000621365  ....----.------............................---------------.......---.----......---.
MDP0000875229  ....----.------............................---------------.......---.----......---.
MDP0000251344  ....FSAT.PFKIST............................EEKTVLADSVVVATG.......TVA.RRLH......FTGt
MDP0000168919  ....----.------............................---------------.......---.----......---.
MDP0000267855  ....----.------............................---------------.......---.----......---.
MDP0000195207  ....PFNG.MWHLSEn...........................GKPYGKFDAIVIAHN.......---.----......---.
MDP0000400145  ....----.------............................---------------.......---.----......---.
MDP0000919183  ....----.------............................YRFKVAYDKLVIAAG.......AEP.LTFG......IKGv
MDP0000307336  ....----.------............................---------------.......---.----......---.
MDP0000263146  ....----.------............................---------------.......---.----......---.
MDP0000309730  ....----.------............................---------------.......---.----......---.
MDP0000163903  ....----.------............................---------------.......---.----......---.
MDP0000611628  ....----.------............................---------------.......---.----......---.
MDP0000119779  ....----.------............................---------------.......---.----......---.
MDP0000120904  ....----.------............................---------------.......---.----......---.
MDP0000150544  ....----.------............................---------------.......---.----......---.
MDP0000902209  ....----.------............................---------------.......---.----......---.
MDP0000269370  ....----.------............................---------------.......---.----......---.
MDP0000146158  ....----.------............................-RFKVAYDKLXIAAG.......AEP.LTFG......IKGv
MDP0000124051  ....EYRN.AFKPKL............................TPWLYVAELSFLEAG.......I--.----......---.
MDP0000255696  ....----.------............................---------------.......---.----......---.
MDP0000305861  ....----.------............................---------------.......---.----......---.
MDP0000611628  ....----.------............................--FKVAYDKLXIAAG.......AEP.LTFG......IKGv
MDP0000309622  ....----.------............................---------------.......---.----......---.
MDP0000239909  ....----.------............................---------------.......---.----......---.
MDP0000126888  ....----.------............................---------------.......---.----......---.
MDP0000869086  ....----.------............................---------------.......---.----......---.
MDP0000317524  ....ELIR.FNTRVSyvgmldgdhaggckdlkwvvrsvekkteIFVEEVFDAVVVASGhy.....SKP.RLPS......IKGm
MDP0000160099  ....----.------............................---------------.......---.----......---.
MDP0000251205  ....----.------............................---------------.......---.----......---.
MDP0000314335  ....----.------............................---------------.......---.----......---.
MDP0000638870  ....----.------............................---------------.......---.----......---.
MDP0000790657  ....----.------............................---------------.......---.----......---.
MDP0000748068  ....----.------............................---------------.......---.----......---.
MDP0000727481  ....----.------............................---------------.......---.----......---.
MDP0000301246  ....----.------............................---------------.......---.----......---.
MDP0000190684  ....----.------............................---------------.......---.----......---.
MDP0000456223  ....----.------............................---------------.......---.----......---.
MDP0000745172  ....----.------............................---------------.......---.----......---.
MDP0000407932  ....----.------............................---------------.......---.----......---.
MDP0000440896  ....----.------............................---------------.......---.----......---.
MDP0000694227  ....----.------............................---------------.......---.----......---.
MDP0000123987  ....----.------............................---------------.......---.----......---.
MDP0000138005  ....QAYK.LRVLVV............................KEHVLSGGHGLMVQG.......YDP.IIKA......LAKd
MDP0000258205  ....----.------............................---------------.......---.----......---.
MDP0000245245  ....----.------............................---------------.......---.----......---.
MDP0000306704  ....ETDP.KTREGM............................DLTRVTTRDLIAKYG.......LDD.NTVD......FIGh
MDP0000478654  ....----.------............................---------------.......---.----......---.
MDP0000728219  ....----.------............................---------------.......---.----......-KGq
MDP0000170414  ....----.------............................---------------.......---.----......---.
MDP0000284363  ....----.------............................---------------.......---.----......---.
MDP0000219560  ....----.------............................---------IIIAKG.......---.----......---.
MDP0000235930  ....NITD.REVLTT............................DGRLLVYDYLVIATG.......HKD.SVPK......---.
MDP0000755938  ....----.------............................---------------.......---.----......---.
MDP0000138851  ....----.------............................---------------.......---.----......---.
MDP0000261638  ....----.------............................---------------.......---.----......---.
MDP0000317524  ....----.------............................---------------.......---.----......---.
MDP0000294615  ....----.------............................---------------.......---.----......---.
MDP0000208234  ....----.------............................---------------.......---.--RP......QEG.
MDP0000216129  ....----.------............................---------------.......---.----......---.
MDP0000219521  ....----.------............................---------------.......---.----......---.
MDP0000248995  ....----.------............................---------------.......---.----......---.
MDP0000256328  ....----.------............................YRFKVAYDKLVIAAG.......AEP.LTFG......IKG.
MDP0000181673  ....----.------............................---------------.......---.----......---.
MDP0000169201  ....----.------............................---------------.......---.----......---.
MDP0000263530  ....----.------............................---------------.......---.----......---.
MDP0000295839  ....----.------............................---------------.......---.----......---.
MDP0000297466  ....----.------............................---------------.......---.----......---.
MDP0000281982  ....ETDP.KTHEGM............................NLTRVTTRDLIAKYG.......LDD.NNVDf.....IRHa
MDP0000053966  ....----.------............................---------------.......---.----......---.
MDP0000795740  ....----.------............................---------------.......---.----......---.
MDP0000212327  ....----.------............................---------------.......--N.FHPD......VAGr
MDP0000437365  ....----.------............................---------------.......---.----......---.
MDP0000135231  ....----.------............................---------------.......---.----......---.
MDP0000167343  ....----.------............................---------------.......---.----......---.
MDP0000222306  ....----.------............................---------------.......---.----......---.
MDP0000183517  ....DIKP.WVMHAEva..........................EKFLSCGNRIILAGN.......AAH.RFPP......---.
MDP0000686821  ....SIEG.NLIRFE............................NGIYNWYDAIIFATG.......YKS.SVLNw.....LKDd
MDP0000430157  ....----.------............................---------------.......---.----......---.
MDP0000373054  ....----.------............................---------------.......---.----......---.
MDP0000295306  ....----.------............................---------------.......---.----......---.
MDP0000233995  ....SIDG.NLIKFA............................NGNYNWYDAIIFATG.......YSS.SVLN......---.
MDP0000209681  ....SIDG.NLIKFA............................NGNYNWYDAIIFATG.......YSS.SVLN......---.
MDP0000876898  ....----.------............................---------------.......---.----......---.
MDP0000738522  ..meLVNN.TYEWVE............................DTIVYKPNSFPWQSV.......IRE.AFLE......AGGy
MDP0000399642  ....----.------............................---------------.......---.----......---.
MDP0000215521  ....----.------............................---------------.......---.----......---.
MDP0000170521  ....----.------............................---------------.......-SP.YKFG......YED.
MDP0000262982  ....----.------............................---------------.......---.----......---.
MDP0000321186  ....----.------............................---------------.......-SD.RVLG......IPGe
MDP0000266051  ....----.------............................---------------.......---.---G......FKGe
MDP0000837610  ....----.------............................---------------.......---.----......---.
MDP0000582079  ....----.------............................---------------.......---.----......---.
MDP0000538071  ....----.------............................---------------.......---.----......---.
MDP0000241703  ....----.------............................---------------.......---.----......---.
MDP0000671114  ....----.------............................---------------.......---.----......---.
MDP0000315388  ....----.------............................---------------.......---.----......---.
MDP0000134271  ....----.-----Vqmcsnpn.....................TIQWYAFEFIVVCIGkyg....DIP.RMPN......FPRn
MDP0000297581  ....----.------............................---------------.......---.----......---.
MDP0000911003  ....----.------............................---------------.......-NP.NRCG......FEGk
MDP0000576650  ....----.------............................---------------.......---.----......---.
MDP0000149205  ....----.------............................---------------.......---.----......---.
MDP0000315409  ....----.------............................---------------.......---.----......---.
MDP0000320804  ....----.------............................---------------.......---.----......---.
MDP0000474647  ....----.------............................---------------.......---.----......---.
MDP0000566648  ....----.------............................---------------.......---.----......---.
MDP0000171379  ....----.------............................---------------.......---.----......---.
MDP0000814529  ....----.------............................---------------.......---.----......---.
MDP0000218295  ....----.------............................---------------.......---.----......---.
MDP0000220943  ....NLLN.GHPVWEvavqmsnnpn..................MIQWYAFEFIVVCIGkyg....DIP.RMPS......FPRn
MDP0000795437  ....----.------............................---------------.......---.----......---.
MDP0000919706  ....----.------............................---------------.......---.----......---.
MDP0000295675  ....----.------............................---------------.......---.----......---.
MDP0000147542  ....----.------............................---------------.......---.----......---.
MDP0000272126  ....----.------............................---------------.......---.----......---.
MDP0000196881  ....----.------............................---------------.......---.----......---.
MDP0000268346  ....----.------............................---------------.......---.----......---.
MDP0000147542  ....----.------............................---------------.......---.----......---.
MDP0000948298  ....----.------............................---------------.......---.----......---.
MDP0000220943  ....----.------............................---------------.......---.----......---.
MDP0000182589  ....----.------............................---------------.......---.----......---.
MDP0000557870  ....----.------............................---------------.......---.----......---.
MDP0000308870  ....----.------............................---------------.......---.----......---.
MDP0000322449  ....----.------............................---------------.......---.----......---.
MDP0000286494  ....----.------............................---------------.......---.----......---.
MDP0000150868  ....----.------............................---------------.......---.----......---.
MDP0000155608  ....----.------............................---------------.......---.----......---.
MDP0000168505  ....----.------............................---------------.......---.----......---.
MDP0000196888  ....----.------............................---------------.......---.----......---.
MDP0000154812  ....----.------............................---------------.......---.----......---.
MDP0000186080  ....----.------............................---------------.......---.----......---.
MDP0000220012  ....----.------............................---------------.......---.----......---.
MDP0000169409  ....----.------............................---------------.......---.----......---.
MDP0000373095  ....----.------............................---------------.......---.----......---.
MDP0000235846  ....----.------............................---------------.......---.----......---.
MDP0000207126  ....----.------............................---------------.......---.----......---.
MDP0000268357  ....----.------............................---------------.......---.----......---.
MDP0000770761  ....----.------............................---------------.......---.----......---.
MDP0000149067  ....----.------............................---------------.......---.----......---.


                                 170                                     180         190          20
                                   |                                       |           |            
d1cf3a1          ................TVHAGPRDTG..............................DDYSPIVKALMS..AVED..RGVPT.K
MDP0000813172  ................----------..............................RAFGGQSLDFGK..GGQA..YRCAC.A
MDP0000251581  ................----------..............................RAFGGQSLDFGK..GGQA..YRCAC.A
MDP0000188391  ................----------..............................RAFGGQSLDFGK..GGQA..YRCAC.A
MDP0000254144  .........lsnlsaaYWDQD-----..............................------------..----..-----.-
MDP0000321972  ..........rnehtdDMSVSQAISVvmdrhpelrqngla................HEVLQWYICRME..AWFA..ADADV.I
MDP0000299806  nleyanaslmsnlsmaYWDQD-----..............................------------..----..-----.-
MDP0000283451  .....naslmsnlsmaYWDQD-----..............................------------..----..-----.-
MDP0000296714  ............idraKKSCQKLELL..............................SPLERRVMDWHF..ANLE..YGCAA.P
MDP0000162193  ......idakksidraEESCQKQEXL..............................SPLERRVMDWHF..ANLE..YGCAT.L
MDP0000769741  ................----------..............................------------..----..-----.-
MDP0000295277  ...............kIVSSTGALAL..............................QEIPKKLVVVGA..GYIG..LEMGS.V
MDP0000897124  ...............kIVSSTGALAL..............................QEIPKKLVVVGA..GYIG..LEMGS.V
MDP0000854208  ................GHSHR-----..............................------------..----..-----.-
MDP0000241767  ................----------..............................------------..----..-----.-
MDP0000318858  ............elsgVHFAMEFLRAntkslldsnledgnyi..............SAKGKKVVVIGG..GDTG..TDCIG.T
MDP0000248995  .......alalhrddrYLNEP-----..............................------------..---A..LDTVK.R
MDP0000442206  ............elsgV---HFAMEFlhantkslldsnledgnyi...........SAKGKKVVVIGG..GDTG..TDCIG.T
MDP0000181673  .......alalhrddrYLNEP-----..............................------------..---A..LDTVK.R
MDP0000315409  ........alalqqddNYLAEP----..............................------------..---A..MDFVK.R
MDP0000053966  ........alalhrddNYLAEP----..............................------------..---A..MAFVK.R
MDP0000294615  ........alalhrddNYLAEP----..............................------------..---A..MAFVK.R
MDP0000306147  ................----------..............................------------..----..-----.-
MDP0000180064  ................GDIARKYIQD..............................PQLLSFIDAECF..IVST..VKALQ.T
MDP0000261625  ................----------..............................----------WG..----..-----.-
MDP0000300208  ..............elGISSDEALSL..............................EELPKRAVVLGG..GYIA..VEFAS.I
MDP0000247171  .............pvxPRSV------..............................------------..----..-----.-
MDP0000308095  ................CYXISFITVQ..............................TYDKARNAVA--..----..-----.-
MDP0000319421  ................----------..............................------------..----..-----.-
MDP0000232295  ................---------K..............................PELTPWQYAAEF..SFLE..AGVFP.Y
MDP0000188994  ................----------..............................------------..----..-----.-
MDP0000159189  ................----------..............................------------..----..-----.-
MDP0000656178  ...............tVITSDHALKL..............................EFVPEWIAIVGS..GYIG..LEFSD.V
MDP0000910523  ................----------..............................------------..----..-----.-
MDP0000119941  ................-LGVG-----..............................------------..----..-----.-
MDP0000231799  ...............tVITSDHALKL..............................EFVPEWIAIVGS..GYIG..LEFSD.V
MDP0000255025  ................----------..............................------------..----..-----.-
MDP0000231632  .........dpeslsmRHSFP---DL..............................WNMEKRFGSVIS..GAIK..SKLSA.K
MDP0000173300  ................--------NC..............................VEEGFQNQVLRK..GCEN..LGLGV.D
MDP0000158474  ................PWIEKQIVHQ..............................PKLEPWQVAIRD..SLLS..VGVSP.F
MDP0000276878  ................IWSCP-----..............................----------SE..GVMS..FSAFS.V
MDP0000154720  ................----------..............................------------..----..-----.-
MDP0000549646  ................----------..............................------------..----..-----.-
MDP0000158853  ..............faM---------..............................------HENTQR..TYTS..AGDLL.T
MDP0000702799  ..............faM---------..............................------HENTQR..TYTS..AGDLL.T
MDP0000233110  ................--------GC..............................TEENFQNQILRK..GCEN..LGLKV.E
MDP0000260827  ................----------..............................------------..----..-----.-
MDP0000941459  ................YTNWSXXLLQ..............................EAIFAMHENIQR..TYTS..AGDLL.T
MDP0000185338  ................---------R..............................PELRTWQSAVRD..GLLE..AGVDP.Y
MDP0000451172  ................EWVEKVVAFE..............................PEILQWETAFRD..GLLE..VGVLP.H
MDP0000136847  ................---------R..............................PNLSHWQSVVKD..ALLE..AGVRP.D
MDP0000177641  ................----------..............................--------VAEL..SFLE..AGIFP.Y
MDP0000413935  ................----------..............................------------..----..-----.-
MDP0000206098  ................----------..............................------------..----..-----.-
MDP0000845788  .......defwsrgisACAICDGASP..............................LFKGQVLAVVGG..GDTA..TEEAL.Y
MDP0000465595  ................----------..............................------------..----..--VFP.Y
MDP0000137211  ................NKSYEWVEDTivfr..........................PNVSQWQSVVKD..ALLE..AGVRP.D
MDP0000130099  ................----------..............................------------..----..AGVLP.D
MDP0000425135  ................--------FR..............................PELRTWQSAVRD..GLLE..AGVDP.Y
MDP0000200780  ................PKYVGHCAFRglasypdgq.....................PFEPKLNQIYGK..GQ--..-----.-
MDP0000142434  ................----------..............................------------..----..-----.-
MDP0000248951  ................---------R..............................PNLSHWQSVVKD..ALLE..AGVRP.D
MDP0000869086  .........dawkrkqLHSHIYRVPE..............................PFRDEVVVVVGT..SLSG..QDISM.-
MDP0000318256  ................---------R..............................PNVTHWQSVVKD..AMLE..AGVRP.D
MDP0000231634  .....trcgypeslsmRHSFP---DL..............................WNMEKRFGSVIS..GAIK..SKLSA.K
MDP0000626995  ................----------..............................------------..----..-----.-
MDP0000123832  .............pvxPRSV------..............................------------..----..-----.-
MDP0000236092  ................----------..............................------------..----..-----.-
MDP0000199159  ................MDAWKRKQMH..............................SHIYRVVVVVGT..SLSG..QDI--.-
MDP0000162755  ................VRCV------..............................------------..----..-----.-
MDP0000173666  ................RHSFP---DL..............................WNMEKRFGSVIS..GAIK..SKXSA.K
MDP0000262982  .........sefgaevMHACEYKSGE..............................NFRGKKVLVVGC..GNSG..MEVSL.D
MDP0000184832  ................----------..............................------------..----..-----.-
MDP0000598927  ................GHSHH-----..............................------------..----..-----.-
MDP0000561228  .....pengfsldhvpE---------..............................------------..----..-----.-
MDP0000175650  ................----------..............................------------..----..-----.-
MDP0000233802  .......eeywnrgisACAVCDGAAP..............................IFRNKPLAVIGG..GDSA..MEEAN.F
MDP0000321186  dlsgvyaarefvwwynGHPNSRYLNPd.............................LKSSDTVIILGQ..GNVA..LDAAR.I
MDP0000161955  ................----------..............................------------..----..-----.-
MDP0000213381  ................----------..............................------------..----..-----.-
MDP0000168437  ................----------..............................------------..----..-----.-
MDP0000823251  .......eeywnrgisACAVCDGAAP..............................IFRNKPLAVIGG..GDSA..MEEAN.F
MDP0000191389  ................----------..............................------------..----..-----.-
MDP0000199319  ................----------..............................------------..----..-----.-
MDP0000857446  ................----------..............................------------..----..-----.-
MDP0000266638  ................----------..............................------------..----..-----.-
MDP0000208936  ................--------SC..............................TEENFPNQILRK..GCEN..LGLKG.T
MDP0000202883  ................----------..............................------------..----..-----.-
MDP0000288439  ................----------..............................--------VAEL..SFLE..AGIFP.Y
MDP0000295839  .........nsfkgefVHSSEYENGK..............................KYDGKNVLVVGS..GNSG..MEIAY.D
MDP0000903805  ................NNSYEWVENTvafr..........................PNLSHWQSVVKD..AMVE..AGVRP.D
MDP0000202123  ..............eyAIDSDAALDL..............................PTKPEKIAIVGG..GYIA..VEFAG.I
MDP0000227773  ................----------..............................------------..----..-----.-
MDP0000317524  .....dawkrkqmhshI---------..............................------------..----..-----.-
MDP0000320748  ................ETYSSEI---..............................------------..----..-----.-
MDP0000634676  ................----------..............................------------..----..-----.-
MDP0000235846  .......eeywnrgisACAVCDGAAP..............................IFRNKPLAVIGG..GDSA..MEEAN.F
MDP0000251344  .......eeywnrgisACAVCDGAAP..............................IFRNKPLAVIGG..GDSA..MEEAN.F
MDP0000501957  ................----------..............................------------..----..-----.-
MDP0000209681  .........dgfkgeaVHSSKYENGR..............................KYSGKNVLVVGS..GNSG..MEIAY.D
MDP0000293482  ................----------..............................------------..----..-----.-
MDP0000233995  .........dgfkgeaVHSSKYENGR..............................KYSGKNVLVVGS..GNSG..MEIAY.D
MDP0000257243  ............nnsyXWVENTVAFR..............................PNVTHWQSVVKD..AMLE..AGVRP.D
MDP0000160099  ................----------..............................------------..----..-----.-
MDP0000193196  ................----------..............................------------..----..-----.-
MDP0000208234  .........ssfngdvLHSTKYKSGK..............................EFENKKVLVVGA..GNSG..MEISL.D
MDP0000251783  ................----------..............................------------..----..-----.-
MDP0000686885  ................----------..............................------------..----..-----.-
MDP0000138851  .........ssfngdvLHSTKYKSGK..............................EFENKKVLVVGA..GNSG..MEISL.D
MDP0000194930  ......vhtpgsgyvlL---------..............................------------..----..-----.-
MDP0000169201  ...pfnkgpeafhgevIHSKDYAAMDyerarn........................FVKGKRVTVVGF..QKSA..LDIAM.E
MDP0000399642  ...pfnkgpeafhgevIHSKDYAAMDyerarn........................FVKGKRVTVVGF..QKSA..LDIAM.E
MDP0000582079  .........defkgeaIHSSNYENGK..............................KYGGKNVLVVGS..GNSG..MEIAY.D
MDP0000129765  ................EKKVKWTLTR..............................DE----------..----..-----.-
MDP0000272655  ................NNSYEWVENTvifr..........................PNVTRWQSVVKD..AMLE..AGVRP.D
MDP0000686821  .........dgfngqaIHSSKYENGK..............................KYGGKNVLVVGS..GNSG..MEIAY.D
MDP0000170414  ...pfnkgpeafhgevIHSKDYAAMDyerarn........................FVKGKRVTVVGF..QKSA..LDIAM.E
MDP0000320804  ...ppnkgpeafhgevIHSMNYADMDyesaak........................FVEGKQVTVVGF..QKFA..MDIAM.E
MDP0000189790  ................VVGVS-----..............................------------..----..-----.-
MDP0000847111  .........defkgeaIHSSNYENGK..............................KYGGKNVLVVGS..GNSG..MEIAY.D
MDP0000289536  ................----------..............................------------..----..---DQ.X
MDP0000123987  ...xfnkgpeafhgevIHSKDYAAMDyerarn........................FVKGKSVTVVGF..QKSA..LDIAM.E
MDP0000245245  ...lfnkgpeafhgevIHSKDYAAMDyerarn........................FVKGKSVTVVGF..QKSA..LDIAM.E
MDP0000188553  ...........idvrlNHSIGSPKRY..............................LTLESSIFRSGW..MYNTkgCTFLS.L
MDP0000296599  ................----------..............................------------..----..-----.-
MDP0000746652  ................----------..............................------------..----..-----.-
MDP0000259265  .........esftgkvVHACDYKNGE..............................SFKDKQVLVIGC..GNSG..MEISN.D
MDP0000151331  ................----------..............................------------..----..-----.-
MDP0000309775  ................----------..............................------------..----..-----.-
MDP0000232736  ................----------..............................------------..----..-----.-
MDP0000320539  ......kgsdsenvcyLRD------Ladanrlvnlme...................SSSGGNAIVIGG..GYIG..MECAA.S
MDP0000239909  ...............qFHSHNYRHPE..............................PFRDQVVILIGS..SASA..VDISR.E
MDP0000259264  .........esftgkvVHACDYKNGE..............................SFKDKQVLVIGC..GNSG..MEISN.D
MDP0000293613  ................LHVSR-----..............................---------YYS..AQES..VELFP.T
MDP0000253362  ................LHVSR-----..............................---------YYS..AQES..VELFP.T
MDP0000182973  ......giqngvdglvMMEGSEAMRM..............................------------..----..-----.-
MDP0000138005  ................----------..............................------------..----..-----.-
MDP0000261301  ................----------..............................------------..----..-----.-
MDP0000771633  ................----------..............................------------..----..-----.-
MDP0000851102  ................----------..............................------------..----..-----.-
MDP0000159873  ................----------..............................------------..----..-----.-
MDP0000140206  ......qgadaknifyLREISDADKLveaik.........................AKKNGKVVIIGG..GYIG..LEVGA.A
MDP0000261201  ................----------..............................------------..----..-----.-
MDP0000252244  ................----------..............................------------..----..-----.-
MDP0000261821  .........daknifyLREIDDADKLneaik.........................AKKNGKAVIVGG..GYIG..LELGA.X
MDP0000124454  ................----------..............................------------..----..-----.-
MDP0000234830  ................---------A..............................ALRLLHVSRYYS..AQES..VELFP.T
MDP0000297861  ................----------..............................------------..----..-----.-
MDP0000152184  ......kgsdsgnvcyL--------Rdladanrlvdlme.................SSSGGNAXVIGG..GYIG..MECAA.S
MDP0000157871  ......qgdhaknifyLRE------Isdadklveair...................AKKNGKVVIVGG..GYIG..LEVGA.A
MDP0000250932  ................----------..............................------------..----..-----.-
MDP0000219521  ...phnkgpevfqgqaL--------Haldyckldkdaasq................LLKDKKVVVVGY..KKSA..IDLAV.-
MDP0000239289  ................----------..............................------------..----..-----.-
MDP0000258995  ................----------..............................------------..----..-----.-
MDP0000167343  ...plnkgpevfqgqaLHTLDYCKLDkdaase........................LLKDKEVVVVGY..KKSA..IDLAV.E
MDP0000222306  ...plnkgpevfqgqaLHTLDYCKLDkdaase........................LLKDKEVVVVGY..KKSA..IDLAV.E
MDP0000829384  ................----------..............................------------..----..-----.-
MDP0000145663  ................----------..............................------------..----..-----.-
MDP0000288439  ................VAELS-----..............................------------..-LLE..AGIFP.Y
MDP0000267350  .........daknifyLREIDDADKLyeaik.........................AKKNGKAVIVGG..GYIG..LELGA.V
MDP0000155608  ................----------..............................------------..----..-----.-
MDP0000194622  ................----------..............................------------..----..-----.-
MDP0000134271  ......kgqevfqgkvLHSMD-YSKLdqqaare.......................LLKGKKVAVIGY..KKSA..IDMAV.-
MDP0000312748  ...........tdgerG---------..............................------------..----..-----.-
MDP0000197715  ................--------NC..............................IEEGFQNQVLRK..GCEN..LGFEV.D
MDP0000220943  ......kgqevfqgkvLHSLD----Yskldqraare....................LLKGKKVAVIGY..----..-----.-
MDP0000320539  ................----------..............................-------IVIGG..GYIG..MECAA.S
MDP0000140206  ................----------..............................-----KVVIIGG..GYIG..LEVGA.A
MDP0000215521  ......kgqevfqgkvL-HSMDYSKLdqraare.......................LLKGKKVAVIGY..KKSA..IDVAV.E
MDP0000203847  ................FSSV------..............................----PKSVAYGY..TASG..YGFVQdM
MDP0000201011  ................----------..............................FSSIPKSVAYGY..TASG..YGFVQdM
MDP0000204596  ................----------..............................------------..----..-----.-
MDP0000148978  ................PASVF---IV..............................IFCPRWIYIIYT..LLNE..TGFGA.Y
MDP0000130369  ................----------..............................------------..----..-----.-
MDP0000314606  ................----------..............................------------..----..-----.-
MDP0000263146  ...eqyahflkgiedaV--------Rirqtvidcferaslpsaseee.........KKKLLSFVCVGG..GPAG..VEFAA.E
MDP0000250583  ....vefalpfstledA--------Hkvdrklrtlerknfr...............KESLIRVVVVGC..GYSG..VELAA.T
MDP0000208233  ...............gYRGSN---RP..............................EFENKKVLVVGA..GNSG..MEISL.D
MDP0000158720  ................----------..............................------------..----..-----.-
MDP0000152184  ................----------..............................--------VIGG..GYIG..MECAA.S
MDP0000182702  ................----------..............................------------..--KY..IQDPQ.L
MDP0000261638  ................----------..............................------------..----..-----.-
MDP0000130370  ................----------..............................------------..----..--AAA.T
MDP0000272119  ................----------..............................------------..----..-----.-
MDP0000305861  ..........menchfL-------KEvedaqkirrtvidcfekaslptvsdee...KKRILHFAVVGG..GPTG..VEFAA.E
MDP0000255696  ..........menchfL-------KEvedaqkirktvidcferaslptvsdee...KKRILHFAVVGG..GPTG..VEFAA.E
MDP0000214280  ................----------..............................------------..----..-----.-
MDP0000210966  ................QWVEHLVAFR..............................PPIQAWQSAVRN..GLME..AGVMP.Y
MDP0000610999  ................----------..............................------------..----..-----.-
MDP0000242546  ................----------..............................------------..----..-----.-
MDP0000320742  ..........hepgavLHTLGWPLDP..............................KTYGGS------..----..-----.-
MDP0000654164  ................--------GI..............................TIDEKKLVVVGA..RYIG..LEMGS.V
MDP0000256300  ................--------FP..............................PTMDRWQSAVAK..AFME..ADVGP.D
MDP0000235080  ................GLISK-----..............................------------..----..-----.-
MDP0000284363  ................VKENCHFLKAspevedaqkirmsvidcfemavlpglseeeRRRNLHFVIVGG..GPTG..VEFAA.E
MDP0000125043  ................----------..............................------------..----..-----.-
MDP0000192359  ................----------..............................------------..----..--IFP.Y
MDP0000440005  ................ARLNQFQEENqk............................IRSANSILIVGG..GPTG..VELAG.E
MDP0000609131  ..............ynLTTATLAVELada...........................GLSPLLIQELVTviTRIN..YGQSV.S
MDP0000362000  ................VHEHAIFLREvshaqeirrklllnlmlsdvpgvseee...KSRLLHCVVVGG..GPTG..VEFSG.E
MDP0000150210  ................----------..............................------------..----..-----.-
MDP0000158790  ................----------..............................------------..----..-----.-
MDP0000427950  ................----------..............................------------..----..-----.-
MDP0000569169  ................----------..............................------------..----..-----.-
MDP0000525742  ................----------..............................------------..----..-----.-
MDP0000559829  ................----------..............................------------..----..-----.-
MDP0000321788  ................----------..............................------------..--KY..IQDPQ.L
MDP0000919183  ................----------..............................------CVVIGG..GPTG..VEFSG.E
MDP0000146158  ................----------..............................------CVVIGG..GPTG..VEFSG.E
MDP0000832077  ................----------..............................------------..----..-----.-
MDP0000621365  ................----------..............................------------..----..-----.-
MDP0000875229  ................-ITSDHALKL..............................EFVPEWIAIVGS..GYIG..LEFSD.V
MDP0000251344  .........aglirpaLHCVQ-----..............................------------..----..-----.-
MDP0000168919  ................----------..............................------------..----..-----.-
MDP0000267855  ................----------..............................------------..----..-----.-
MDP0000195207  ................----------..............................------------..----..-----.-
MDP0000400145  ................----------..............................------------..----..-----.-
MDP0000919183  ..........kehaffL-------REvnhaqeirkklllnlmlsehpgileee...RKRILHCVVIGG..GPTG..VEFSG.E
MDP0000307336  ................----------..............................------------..----..-----.-
MDP0000263146  ................----------..............................-----SFVCVGG..GPAG..VEFAA.E
MDP0000309730  ................----------..............................------------..----..-----.-
MDP0000163903  ................----------..............................------ILIVGG..GPTG..VELAG.E
MDP0000611628  ................----------..............................------------..----..-----.-
MDP0000119779  ................----------..............................------ILIVGG..GPTG..VELAG.E
MDP0000120904  ................----------..............................------------..----..-----.-
MDP0000150544  ................----------..............................------------..----..-----.-
MDP0000902209  ................----------..............................------------..----..-----.-
MDP0000269370  ................----------..............................------------..----..-----.-
MDP0000146158  ..........kehaffL-------REvnhaqeirkklllnlmlsehpgiseee...RKRVLHCVVIGG..GPTG..VEFSG.E
MDP0000124051  ................---------F..............................PYNGFSLDHIGG..TKIG..V----.-
MDP0000255696  ................----------..............................-----HFAVVGG..GPTG..VEFAA.E
MDP0000305861  ................----------..............................-----HFAVVGG..GPTG..VEFAA.E
MDP0000611628  ..........kehaffLR-------Evnhaqeirkklllnlmlsehpgiseee...RKRVLHCVVIGG..GPTG..VEFSG.E
MDP0000309622  ................----------..............................------------..----..-----.-
MDP0000239909  ................----------..............................------------..----..-----.-
MDP0000126888  ................----------..............................------------..----..-----.-
MDP0000869086  ................----------..............................------------..----..-----.-
MDP0000317524  .....dawkrkqmhshIYRVPEPFRDearqyi........................VNCEIVVVVVGN..SVSG..QDISM.E
MDP0000160099  ................----------..............................------------..----..-----.-
MDP0000251205  ................----------..............................------------..----..-----.-
MDP0000314335  ................-------ASP..............................LFKGQVLAVVGG..GDTA..TEEAL.Y
MDP0000638870  ................----------..............................------------..----..-----.-
MDP0000790657  ................----------..............................------------..----..-----.-
MDP0000748068  ................----------..............................------------..----..-----.-
MDP0000727481  ................----------..............................------------..----..-----.-
MDP0000301246  ................----------..............................------------..----..-----.-
MDP0000190684  ................----------..............................------------..----..-----.-
MDP0000456223  ................----------..............................------------..----..-----.-
MDP0000745172  ................----------..............................------------..----..-----.-
MDP0000407932  ................----------..............................------------..----..-----.-
MDP0000440896  ................----------..............................------------..----..-----.-
MDP0000694227  ................----------..............................------------..----..-----.-
MDP0000123987  ................----------..............................------------..----..-----.-
MDP0000138005  ...........idvrlNHSIGSPKRY..............................LTLESSIFRSGW..MYNTkgCTFLS.L
MDP0000258205  ................----------..............................------------..----..-----.-
MDP0000245245  ................----------..............................------------..----..-----.-
MDP0000306704  ..............alALHRD-----..............................------------..----..-----.-
MDP0000478654  ................----------..............................------------..----..-----.-
MDP0000728219  ...............yFHSRQYKHPD..............................GFEGKRILVIGM..GNSG..SDIAV.E
MDP0000170414  ................----------..............................------------..----..-----.-
MDP0000284363  ................----------..............................------FVIVGG..GPTG..VEFAA.E
MDP0000219560  ................----------..............................------------..----..-----.-
MDP0000235930  ................----------..............................------------..----..-----.-
MDP0000755938  ................----------..............................------------..----..-----.-
MDP0000138851  ................----------..............................------------..----..-----.-
MDP0000261638  ................----------..............................------------..----..-----.-
MDP0000317524  ................----------..............................------------..----..-----.-
MDP0000294615  ................----------..............................------------..----..-----.-
MDP0000208234  ................P---------..............................------------..----..-----.-
MDP0000216129  ................----------..............................------------..----..-----.-
MDP0000219521  ................----------..............................------------..----..-----.-
MDP0000248995  ................----------..............................------------..----..-----.-
MDP0000256328  ................VKEHA-----..............................------------..----..-----.-
MDP0000181673  ................----------..............................------------..----..-----.-
MDP0000169201  ................----------..............................------------..----..-----.-
MDP0000263530  ................----------..............................------------..----..-----.-
MDP0000295839  ................----------..............................------------..----..-----.-
MDP0000297466  ................----------..............................------------..----..-----.-
MDP0000281982  ...............lA---------..............................------------..----..-----.-
MDP0000053966  ................----------..............................------------..----..-----.-
MDP0000795740  ................----------..............................------------..----..-----.-
MDP0000212327  ...........sfhhgXFIQRMREKA..............................SSLP--------..----..-----.-
MDP0000437365  ................----------..............................------------..----..-----.-
MDP0000135231  ................----------..............................------------..----..-----.-
MDP0000167343  ................----------..............................------------..----..-----.-
MDP0000222306  ................----------..............................------------..----..-----.-
MDP0000183517  ................----------..............................------------..----..-----.-
MDP0000686821  ...............nCYFND-----..............................------------..----..-----.-
MDP0000430157  ................----------..............................------------..----..-----.-
MDP0000373054  ................----------..............................------------..----..-----.-
MDP0000295306  ................----------..............................------------..----..-----.-
MDP0000233995  ................----------..............................------------..----..-----.-
MDP0000209681  ................----------..............................------------..----..-----.-
MDP0000876898  ................----------..............................------------..----..-----.-
MDP0000738522  ............dpdnG---------..............................------------..----..-----.-
MDP0000399642  ................----------..............................------------..----..-----.-
MDP0000215521  ................----------..............................------------..----..-----.-
MDP0000170521  ................WLAAQ-----..............................------------..----..-----.-
MDP0000262982  ................----------..............................----KKVLVVGC..GNSG..MEVSL.D
MDP0000321186  dlsgvyaarefvwwynGHPNSRYLNPd.............................LKSSDTVIILGQ..GNVA..LDAAR.I
MDP0000266051  ...............aIHSSKYENGT..............................KYGGKIVLVVGP..GNSG..MEIAY.D
MDP0000837610  ................----------..............................------------..----..-----.-
MDP0000582079  ................----------..............................------------..----..-----.-
MDP0000538071  ................----------..............................------------..----..-----.-
MDP0000241703  ................----------..............................------------..----..-----.-
MDP0000671114  ................----------..............................------------..----..-----.-
MDP0000315388  ................----------..............................------------..----..-----.-
MDP0000134271  ......kgqevfqgkvL-HSMDYSKLdqqaare.......................LLKGKKVAVIGY..KKSA..IDMAV.E
MDP0000297581  ................----------..............................------------..----..-----.-
MDP0000911003  ...............gDIWVE-----..............................------------..----..-----.-
MDP0000576650  ................----------..............................------------..----..-----.-
MDP0000149205  ................----------..............................------------..----..-----.-
MDP0000315409  ................----------..............................------------..----..-----.-
MDP0000320804  ................----------..............................------------..----..-----.-
MDP0000474647  ................----------..............................------------..----..-----.-
MDP0000566648  ................----------..............................------------..----..-----.-
MDP0000171379  ................----------..............................------------..----..-----.-
MDP0000814529  ................----------..............................------------..----..-----.-
MDP0000218295  ................----------..............................------------..----..-----.-
MDP0000220943  ......kgqevfqgkvLHS------Ldyskldqraare..................LLKGKKVAVIGY..KKSA..IDVAV.E
MDP0000795437  ................----------..............................------------..----..-----.-
MDP0000919706  ................----------..............................------------..----..-----.-
MDP0000295675  ................----------..............................------------..----..-----.-
MDP0000147542  ................----------..............................------------..----..-----.-
MDP0000272126  ................----------..............................------------..----..-----.-
MDP0000196881  ................----------..............................------------..----..-----.-
MDP0000268346  ................----------..............................------------..----..-----.-
MDP0000147542  ................----------..............................------------..----..-----.-
MDP0000948298  ................----------..............................------------..----..-----.-
MDP0000220943  ................----------..............................------------..----..-----.-
MDP0000182589  ................----------..............................------------..----..-----.-
MDP0000557870  ................----------..............................------------..----..-----.-
MDP0000308870  ................----------..............................------------..----..-----.-
MDP0000322449  ................----------..............................------------..--KY..IQDPQ.L
MDP0000286494  ................----------..............................------------..----..-----.-
MDP0000150868  ................----------..............................------------..----..-----.-
MDP0000155608  ................----------..............................------------..----..-----.-
MDP0000168505  ................----------..............................------------..----..-----.-
MDP0000196888  ................----------..............................------------..----..-----.-
MDP0000154812  ................----------..............................------------..----..-----.-
MDP0000186080  ................----------..............................------------..----..-----.-
MDP0000220012  ................----------..............................------------..----..-----.-
MDP0000169409  ................----------..............................------------..----..-----.-
MDP0000373095  ................----------..............................------------..----..-----.-
MDP0000235846  ................----------..............................------------..----..-----.-
MDP0000207126  ................----------..............................----DMMQSIKE..FYHS..REVAG.I
MDP0000268357  ................----------..............................------------..----..-----.-
MDP0000770761  ................----------..............................------------..----..-----.-
MDP0000149067  ................----------..............................------------..----..-----.-


                 0                                    210          220        230                   
                 |                                      |            |          |                   
d1cf3a1          KDFG...C..........................GDPHGVSMFPNTL...HEDQV.RSDAAREW...................
MDP0000813172  ADRT...-..........................-------------...-----.-GHALLHT...................
MDP0000251581  ADRT...-..........................-------------...-----.-GHALLHT...................
MDP0000188391  ADRT...-..........................-------------...-----.-GHALLHT...................
MDP0000254144  ----...-..........................---DPYEMGGDHCf..LAGG-.-NGRLIRA...................
MDP0000321972  SLKN...W..........................DQEHVLSGGHGL-...-----.----MVQG...................
MDP0000299806  ----...-..........................---DPYEMGGDHCf..IPGG-.-NETFVRS...................
MDP0000283451  ----...-..........................---DPYEMGGDHCf..IPGG-.-NETFVRS...................
MDP0000296714  LKEV...Slpnwn.....................QDDVYGGFGGAHCm..IKGG-.-YSTVVES...................
MDP0000162193  LKEV...Slpnwn.....................QDDVYGGFGGAHCm..IKGG-.-YSTVIES...................
MDP0000769741  ----...-..........................-------------...--GG-.-HGLMVRG...................
MDP0000295277  WGRL...G..........................SEVTVVEFGPDIVp..SMDS-.E---IRKQ...................
MDP0000897124  WGRL...G..........................SEVTVVEFGPDIVp..SMDS-.E---IRKQ...................
MDP0000854208  ----...-..........................----------RIVh..AADM-.TGREIERA...................
MDP0000241767  ----...-..........................----------AHCx..IKGG-.-YSTVVES...................
MDP0000318858  SVRH...GctsiinlellpepprtrapgnpwpqwPRVFRVDYGHQEVaa.KFGK-.DPRTYEVL...................
MDP0000248995  MKLY...A..........................ESLARFQGGSPYIy..PLYG-.-LGELPQA...................
MDP0000442206  SVRH...GctniinlellpepprkrapgnpwpqwPRVFRVDYGHQEVaa.KFGK-.DPRTYEVL...................
MDP0000181673  MKLY...A..........................ESFARFQGGSPYIy..PLYG-.-LGELPQA...................
MDP0000315409  MKLY...A..........................ESLARFQGGSPYIy..PLYG-.-LGELPQA...................
MDP0000053966  MKLY...A..........................ESLARFQGGSPYIy..PLYG-.-LGELPQA...................
MDP0000294615  MKLY...A..........................ESLARFQGGSPYIy..PLYG-.-LGELPQA...................
MDP0000306147  ----...-..........................----------AHCx..IKGG-.-YSTVVES...................
MDP0000180064  PMIN...A..........................SMVMCDRHYGGINy..PVGG-.-VGGIAKS...................
MDP0000261625  ----...-..........................----------GFL...GTSHVtFYGXIXIF...................
MDP0000300208  WRGM...G..........................ASVDLFFRKELPLr..GFDD-.E---LRAV...................
MDP0000247171  ----...-..........................-------------...-----.NRKALLKT...................
MDP0000308095  ----...-..........................-------------...-----.-------Lalspvvkalvxpdgalqdv
MDP0000319421  ----...-..........................----------RVLk..RT---.D---LVSV...................
MDP0000232295  NGFS...X..........................DHIEGTKIGASVF...DEQG-.-RRHTSAD...................
MDP0000188994  ----...-..........................-------------...-----.KRRLLLEA...................
MDP0000159189  ----...-..........................-------------...-----.KRRLLLEA...................
MDP0000656178  YTAL...G..........................SEVTFIEALDQLMp..GFDP-.E---IGKL...................
MDP0000910523  ----...-..........................-----------LVg..PRSV-.HRKALLKA...................
MDP0000119941  --RL...G..........................SEVTVVEFGPDIVp..SMDS-.E---IRKQ...................
MDP0000231799  YTAL...G..........................SEVTFIEALDQLMp..GFDP-.E---IGKL...................
MDP0000255025  ----...T..........................ANHHHCHISLFWIp..TYDK-.-ARNAVALalspvvkalvnpdgalqdv
MDP0000231632  KEKS...Gqtk.......................GSVEKGKRQRGSFs..FHGG-.-MQTLTDT...................
MDP0000173300  FVPRn..S..........................SENHYCGSCGYGC...RKGE-.KKGTDSTW...................
MDP0000158474  NGFT...Y..........................DHVYGTKVGGTIYd..RFGRR.H---TSAE...................
MDP0000276878  LSFCr..N..........................HHLLQLFGRPQWL...TVRW-.RSHCYVKK...................
MDP0000154720  ----...-..........................-------------...-----.--------...................
MDP0000549646  ----...-..........................-------------...-----.-ALFTSTI...................
MDP0000158853  LDYN...A..........................ESEYRMFPGEEIT...IAKG-.-YLSIVQS...................
MDP0000702799  LDYN...A..........................ESEYRMFPGEEIT...IAKG-.-YLSIVQS...................
MDP0000233110  SVPRn..S..........................SADHYCGFCNYGC...PTGD-.KKGTDSTW...................
MDP0000260827  ----...-..........................----------SGRs..FHNG-.R---FIQR...................
MDP0000941459  LDYN...A..........................ESEYRMFPGEEIX...IAKG-.-YLSIVQS...................
MDP0000185338  NGFN...L..........................DHVVGTKIGGSTFd..TLGRR.H---SAAD...................
MDP0000451172  NRFT...Y..........................EHLYGTKVGGSIF...DADGHrH---TAAD...................
MDP0000136847  NGLT...L..........................DHIQGTKITGTIFd..DRGR-.-RHGAV-E...................
MDP0000177641  NGFS...L..........................DHIXGTKIGATTF...DEQG-.-RRHTSAD...................
MDP0000413935  ----...-..........................----------SGRs..FHNG-.R---FIQR...................
MDP0000206098  ----...-..........................----------YVV...IKHA-.-ALFTSTI...................
MDP0000845788  LTKY...A..........................RHIHLLVRRDQLRa..SRAMQ.DRLVAYRE...................
MDP0000465595  NGFS...L..........................DHIKGTKVGASVF...DEQG-.-RRQTSAD...................
MDP0000137211  NGFT...L..........................DSVEGTKISGALFd..NRGR-.-RYGAVEL...................
MDP0000130099  NGFS...L..........................DHVLGTRITGSTF...DNNGTrH---AADE...................
MDP0000425135  NGFD...L..........................EHAVGTKIGGSTFd..TSGRR.H---SAAD...................
MDP0000200780  ----...-..........................-------------...-----.--------...................
MDP0000142434  ----...-..........................-------------...----EaRCLKRSDL...................
MDP0000248951  NGLT...L..........................DHIQGTKITGTIFd..DRGR-.-RHGAV-E...................
MDP0000869086  ----...-..........................-------------...-----.--------...................
MDP0000318256  NGLT...L..........................DHILGSKVTATLFd..DRGK-.-RH-GAVE...................
MDP0000231634  KEKS...Gqtk.......................GSVEKGKRQRGSFs..FHGG-.-MQTLTDT...................
MDP0000626995  ----...-..........................-------------...-----.-ALFTSTI...................
MDP0000123832  ----...-..........................-------------...-----.NRKALLKT...................
MDP0000236092  ----...-..........................-------------...-----.-ALFTSTI...................
MDP0000199159  ----...-..........................-------------...-----.--------...................
MDP0000162755  ----...-..........................-------------...-----.KRNLLLEA...................
MDP0000173666  KEKS...Gqtk.......................GSVEKGKRQRGSFs..FHGG-.-MQTLTDT...................
MDP0000262982  LCNH...N..........................A------------...-----.--------...................
MDP0000184832  ----...-..........................-------------...----VaELSLLEAG...................
MDP0000598927  ----...-..........................----------RIVh..AADM-.TGREIERA...................
MDP0000561228  ----...-..........................-----TRITGSTF...DNSG-.-TRHAADE...................
MDP0000175650  ----...-..........................----------KFC...TSDG-.-LEGLNHG...................
MDP0000233802  LTKY...G..........................SEVHIIHRRDTFR...-----.----ASKI...................
MDP0000321186  LLRP...T..........................-------------...-----.--------...................
MDP0000161955  ----...-..........................----------AGRs..FHNG-.R---FIQK...................
MDP0000213381  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000168437  ----...-..........................----------AGRs..F----.HHGRFIQR...................
MDP0000823251  LTKY...G..........................SEVHIIHRRDTFR...-----.----ASKI...................
MDP0000191389  ----...-..........................----------AGRs..FHNG-.R---FIQK...................
MDP0000199319  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000857446  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000266638  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000208936  ----...-..........................-------------...-----.RKGTDSTW...................
MDP0000202883  ----...-..........................----------AGRx..FHNG-.R---FIQK...................
MDP0000288439  NGFS...L..........................DHIEGTKIGATTF...DEQG-.-RRHTSAD...................
MDP0000295839  LTNW...G..........................ANTSIVVRSP---...-----.--------...................
MDP0000903805  NGLT...V..........................DHILGSKVTATLFd..DRGK-.-RHGAVEH...................
MDP0000202123  FNGL...T..........................SDVHVFIRQKKVLr..GFDE-.E---VRDF...................
MDP0000227773  ----...-..........................-------------...-----.--------...................
MDP0000317524  ----...-..........................-------------...-----.--------...................
MDP0000320748  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000634676  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000235846  LTKF...G..........................SEVHIIHRRDTFR...-----.-ASKIMQ-...................
MDP0000251344  LTKF...G..........................SEVHIIHRRDTFR...-----.-ASKIMQ-...................
MDP0000501957  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000209681  LSNS...G..........................ANTSIVVRSP---...-----.--------...................
MDP0000293482  ----...-..........................-------------...-----.HWADLHAL...................
MDP0000233995  LSNS...G..........................ANTSIVVRSP---...-----.--------...................
MDP0000257243  NGLT...L..........................DHILGSKVSATLFd..DRGK-.-RHGAVEH...................
MDP0000160099  ----...-..........................-------------...-----.DLKWVVRS...................
MDP0000193196  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000208234  LANH...G..........................AKTSIIVRSPV--...-----.--------...................
MDP0000251783  ----...-..........................----------GTIfd.NRGR-.-RHGAV-E...................
MDP0000686885  --EF...S..........................GRVMIPEDWVGVVt..EHGGViKPTKAVSM...................
MDP0000138851  LANH...G..........................AKTSIIVRSP---...-----.--------...................
MDP0000194930  --HH...V..........................MGETDGER--GIWsf.VEGG-.-MGSVSLA...................
MDP0000169201  CSNA...Ngie.......................HPCTVIYKTEHWT...-----.--------...................
MDP0000399642  CSNX...Ngie.......................HPCTVIYKTEHWT...-----.--------...................
MDP0000582079  LSNS...G..........................ANTSIVIRSP---...-----.--------...................
MDP0000129765  ----...-..........................----------ELN...CRAG-.HWGDLHAL...................
MDP0000272655  NGLT...L..........................DHILGSKVTGTLLd..NRGK-.-RHGAVEH...................
MDP0000686821  LSNS...G..........................ANTSIVVRSP---...-----.--------...................
MDP0000170414  CSNA...Ngie.......................HPCTVIYKTEHWTl..P----.--------...................
MDP0000320804  CSNTngvA..........................NPCTVLYKTEHWN...-----.--------...................
MDP0000189790  ----...-..........................-------------...FH---.-HGRFIQR...................
MDP0000847111  LSNS...G..........................ANTSIVIRSP---...-----.--------...................
MDP0000289536  DQEF...S..........................GRVMIPEDWVGVVt..EHGGViKPTKAVSM...................
MDP0000123987  CSNT...Ngie.......................HPCTVIYKTEHW-...-----.--------...................
MDP0000245245  CSNT...Ngie.......................HPCTVIYKTEHWT...-----.--------...................
MDP0000188553  HXNL...N..........................CHCLFLVTI----...-----.-TSEVVWF...................
MDP0000296599  ----...-..........................-------------...TTA-QvHPYLFTRT...................
MDP0000746652  ----...-..........................-------------...YKNG-.NATKLSYP...................
MDP0000259265  LADN...G..........................AHASLVIR-----...-----.--------...................
MDP0000151331  ----...-..........................-------------...-VGG-.-WQSVAQKafleaggydpnngfvldhi
MDP0000309775  ----...-..........................----------PHL...GTD--.RLVPLLRN...................
MDP0000232736  ----...-..........................-------------...-----.--------...................
MDP0000320539  LVIS...R..........................MNVTMVF------...-----.--------...................
MDP0000239909  IAGV...A..........................KEVHIASRS----...-----.--------...................
MDP0000259264  LADN...G..........................AHASLVIRS----...-----.--------...................
MDP0000293613  LARK...Gnnks......................LKGTVVYY--DGQ...MNDA-.R---LNVG...................
MDP0000253362  LARK...Gnnks......................LKGTVVYY--DGQ...MNDA-.R---LNVG...................
MDP0000182973  ----...-..........................-------------...-----.-------Epelaclkallsplsgivdt
MDP0000138005  ----...-..........................-------------...-----.--------...................
MDP0000261301  ----...-..........................----------ALLy..PLYG-.-HGEMSQG...................
MDP0000771633  ----...-..........................-------------...-----.RREVLDSY...................
MDP0000851102  ----...-..........................-------------...-----.RREVLDSY...................
MDP0000159873  ----...-..........................-----------PHe..YIGMV.RREVLDQY...................
MDP0000140206  MRIN...K..........................FDVTMVSRDPWC-...-----.--------...................
MDP0000261201  ----...-..........................-----------PHe..YIGMV.RREVLDQY...................
MDP0000252244  ----...-..........................-----------PHe..YIGMV.RREVLDQY...................
MDP0000261821  LRIN...N..........................LDVKMVYPEPWCM...PRLFTsD---IAAF...................
MDP0000124454  ----...-..........................-------------...-----.--------...................
MDP0000234830  LARK...Gnnks......................LKGTVVYY--DGQ...MNDA-.R---LNVG...................
MDP0000297861  ----...-..........................----------AGRs..FHNG-.R---FIQR...................
MDP0000152184  LVIN...R..........................MNVTMVFP-----...-----.--------...................
MDP0000157871  IRIN...K..........................FDVTMVFPEPWCM...PRLF-.-TKEIAAF...................
MDP0000250932  ----...-..........................----------QVN...YKNG-.-LRTXXQV...................
MDP0000219521  ----...-..........................-------------...-----.--------...................
MDP0000239289  ----...-..........................-------------...-----.--------...................
MDP0000258995  ----...-..........................-------------...-----.--------...................
MDP0000167343  CAEA...Nqgpeg.....................KPCTMVVRTLHWIv..PH---.--------...................
MDP0000222306  CAEA...Nqgpeg.....................KPCTMVVRTLHWIv..PH---.--------...................
MDP0000829384  ----...-..........................----------ALLy..PLYG-.-HGEILQG...................
MDP0000145663  ----...-..........................-------------...PYGRV.SRKKLKTL...................
MDP0000288439  NGFS...L..........................DHIEGTKIGATIY...DEQG-.-RRHXSAD...................
MDP0000267350  LKIN...N..........................LDVKMVYPEPWCM...PRLF-.-TSGIAAF...................
MDP0000155608  ----...-..........................-------------...-----.--------...................
MDP0000194622  ----...-..........................-------------...PYGRV.NRKQLKSK...................
MDP0000134271  ----...-..........................-------------...-----.--------...................
MDP0000312748  ----...-..........................-----------IWsy.VEGG-.-MGSVSLA...................
MDP0000197715  IVPRn..S..........................SEKHYCGSCGYGC...KKGE-.KKGTDSTW...................
MDP0000220943  ----...-..........................-------------...-----.--------...................
MDP0000320539  LVIS...R..........................MNVTMVFPEEHCMarlFTPK-.----IASF...................
MDP0000140206  MRIN...K..........................FDVTMVSRDPWCM...PRLF-.-TKEIAAF...................
MDP0000215521  CAEA...Nqgpdg.....................EACTMVIRTP---...-----.--------...................
MDP0000203847  PYAY...I..........................HEFTRTSMAGKIRr..FKGG-.----YTSF...................
MDP0000201011  PYAY...I..........................HEFTRTSMAGKIRr..FNGG-.-YTSLWEK...................
MDP0000204596  ----...-..........................-------FGGAHCi..IKGG-.-YSTVVES...................
MDP0000148978  PN--...-..........................-------------...-----.-------Iqnlfgelgindrlqwkehs
MDP0000130369  ----...-..........................-------------...-----.-------Enlyqnvlspliqvglsapa
MDP0000314606  ----...-..........................-------------...MNDA-.R---LNVG...................
MDP0000263146  LHDF...Vkddlaklypsvtgy............VKITVIEASDHIL...-----.--------...................
MDP0000250583  VSER...Lqdr.......................GIVQAINVETTIC...PNAP-.--PGNREA...................
MDP0000208233  LANH...S..........................AKTSIIVRSPVHFl..SRGMV.-YL----Alvllkhfplsmidsllvll
MDP0000158720  ----...-..........................----------GRVf..PVSN-.SSSTIIDC...................
MDP0000152184  LVIN...R..........................MNVTMVFPEEHCMarlFTP--.K---IASF...................
MDP0000182702  LSFI...D..........................AEVMCDRHYGGINy..PIGG-.-VGGIXKS...................
MDP0000261638  ----...-..........................-------------...-----.--------...................
MDP0000130370  LGLL...S..........................YIFAHQKNFDLVL...CRGT-.SRERIFKP...................
MDP0000272119  ----...-..........................-------------...-----.--------...................
MDP0000305861  LHDF...Vnedlvklypgvkdl............VRITILEAGDHIL...-----.--------...................
MDP0000255696  LHDY...Vnedlvklypgvkel............VKITLLEAGDHIL...-----.--------...................
MDP0000214280  ----...-..........................-------------...-VGG-.-WQSVAQKafleaggydpnngfvldhi
MDP0000210966  NGFT...Y..........................DHIYGTKVGGTIF...DLEGHrH---TAAD...................
MDP0000610999  ----...-..........................-------------...-----.--------...................
MDP0000242546  ----...-..........................-------------...-----.--------...................
MDP0000320742  ----...-..........................-------------...-----.--------...................
MDP0000654164  WGRL...G..........................FEVTVVEFGPDIVp..SMDS-.--------...................
MDP0000256300  NGLN...L..........................DHIKGTKIGGSTFd..NNGK-.-RHGAVEL...................
MDP0000235080  ----...-..........................----------RYV...GMPG-.-MNSICR-...................
MDP0000284363  LHDY...Fqedlvklypmvkdl............VKITVIQSGDHILn..MF---.--------...................
MDP0000125043  ----...-..........................-------------...-----.--------...................
MDP0000192359  NGFS...L..........................DHIKGTKIGATTF...DEQG-.-RRHTSAD...................
MDP0000440005  IAVDfp.D..........................KKVTLVHTGTRLLe..FVGP-.K---AADK...................
MDP0000609131  MSGL...A..........................GAVSLAGSGGGLWa..IKGG-.----NWQM...................
MDP0000362000  LSDF...Iqrdvqeryahvkny............IHVTLIEANEILS...SFDD-.R---LRHY...................
MDP0000150210  ----...-..........................-------------...-----.--------...................
MDP0000158790  ----...-..........................----------RVC...-----.-RDMLHEE...................
MDP0000427950  ----...-..........................-------------...-----.--------...................
MDP0000569169  ----...-..........................-------------...-----.--------...................
MDP0000525742  ----...-..........................-------------...-----.--------...................
MDP0000559829  ----...-..........................-------------...FNNR-.R---FIQR...................
MDP0000321788  LSFI...D..........................AEVMCDRHYGGINy..PIGG-.-VGGIXKS...................
MDP0000919183  LSDF...Imkdvqerythvkdy............IXVTLIEANEILS...SFDV-.G---LRQY...................
MDP0000146158  LSDF...Imkdvqerfshvkdy............IKVTLIEANEILS...-----.---SFDXG...................
MDP0000832077  ----...-..........................-------------...-----.--------...................
MDP0000621365  ----...-..........................-------------...-----.--------...................
MDP0000875229  YTAL...G..........................SEVTFIEALDQLVp..GFDP-.E---IGKL...................
MDP0000251344  ----...-..........................-------------...-----.--------...................
MDP0000168919  ----...-..........................-------------...-----.--------...................
MDP0000267855  ----...-..........................-------------...-----.--------...................
MDP0000195207  ----...-..........................-------------...-----.--------...................
MDP0000400145  ----...-..........................-------------...-----.--------...................
MDP0000919183  L---...-..........................-------------...-----.--------...................
MDP0000307336  ----...-..........................-------------...-----.--------...................
MDP0000263146  LHDF...Vkddlaklypsvtgy............VKITVIEASDHILn..MFDK-.R---ITAF...................
MDP0000309730  ----...-..........................-------------...-----.--------...................
MDP0000163903  IAIDfp.E..........................KKVTLVHRGSRLLe..FIGL-.K---ASQK...................
MDP0000611628  ----...-..........................-------------...-----.--------...................
MDP0000119779  IAIDfp.E..........................KKVTLVHRGSRLLe..FIGL-.K---ASQK...................
MDP0000120904  ----...-..........................-------------...-----.--------...................
MDP0000150544  ----...-..........................-------------...-----.--------...................
MDP0000902209  ----...-..........................-------------...-----.--------...................
MDP0000269370  ----...-..........................-------------...-----.--------...................
MDP0000146158  LSDF...Imkdvqerfshvkdy............IKVTLIEANEILS...-----.---SFDXG...................
MDP0000124051  ----...-..........................----------TTR...DERG-.RRNTSADF...................
MDP0000255696  LHDY...Vnedlvklypgvkel............VKITLLEAGDHILn..MFDK-.R---ITAF...................
MDP0000305861  LHDF...Vnedlvklypgvkdl............VRITILEAGDHILn..MFDK-.R---ITSF...................
MDP0000611628  LSDF...-..........................-------------...-----.--------...................
MDP0000309622  ----...-..........................-------------...-----.--------...................
MDP0000239909  ----...-..........................-------------...-----.--------...................
MDP0000126888  ----...-..........................-------------...-----.--------...................
MDP0000869086  ----...-..........................-------------...-----.--------...................
MDP0000317524  LVDV...A..........................KAIYLSA------...-----.KSLDISEG...................
MDP0000160099  ----...-..........................-------------...-----.--------...................
MDP0000251205  ----...-..........................-------------...-----.--------...................
MDP0000314335  LKKY...A..........................RHIHLLVRRDQLR...-----.--------...................
MDP0000638870  ----...-..........................-------------...-----.--------...................
MDP0000790657  ----...-..........................-------------...-----.--------...................
MDP0000748068  ----...-..........................-------------...-----.--------...................
MDP0000727481  ----...-..........................-------------...-----.--------...................
MDP0000301246  ----...-..........................-------------...-----.--------...................
MDP0000190684  ----...-..........................-------------...-----.--------...................
MDP0000456223  ----...-..........................-------------...-----.--------...................
MDP0000745172  ----...-..........................-------------...-----.--------...................
MDP0000407932  ----...-..........................-------------...-----.--------...................
MDP0000440896  ----...-..........................-------------...-----.--------...................
MDP0000694227  ----...-..........................-------------...-----.--------...................
MDP0000123987  ----...-..........................-------------...-----.--------...................
MDP0000138005  HXNL...N..........................CHCLFLVTI----...-----.-TSEVVWF...................
MDP0000258205  ----...-..........................-------------...-----.SRKKLKTL...................
MDP0000245245  ----...-..........................-------------...-----.--------...................
MDP0000306704  ----...-..........................-------------...--DC-.Y---LNEP...................
MDP0000478654  ----...-..........................-------------...-----.--------...................
MDP0000728219  LSKN...A..........................AQ-----------...-----.--------...................
MDP0000170414  ----...-..........................-------------...-----.--------...................
MDP0000284363  LHDY...Fqedlvklypmvkdl............VKITVIQSGDHILn..MFDD-.R---ISTF...................
MDP0000219560  ----...-..........................-------------...-----.-YLSIVQS...................
MDP0000235930  ----...-..........................-------------...-----.--------...................
MDP0000755938  ----...-..........................-------------...-----.--------...................
MDP0000138851  ----...-..........................-------------...--YG-.KYPIIDVG...................
MDP0000261638  ----...-..........................-------------...-----.--------...................
MDP0000317524  ----...-..........................-------------...-----.--------...................
MDP0000294615  ----...-..........................-------------...-----.--------...................
MDP0000208234  ----...-..........................----------FYMk..VKYG-.KYPAIDVG...................
MDP0000216129  ----...-..........................-------------...-----.--------...................
MDP0000219521  ----...-..........................-------------...-----.--------...................
MDP0000248995  ----...-..........................-------------...-----.--------...................
MDP0000256328  ----...-..........................-------------...-----.--------...................
MDP0000181673  ----...-..........................-------------...-----.--------...................
MDP0000169201  ----...-..........................-------------...-----.--------...................
MDP0000263530  ----...-..........................-------------...-----.--------...................
MDP0000295839  ----...-..........................-------------...-----.-------Kylplkvldnivvilgklkf
MDP0000297466  ----...-..........................-------------...-----.TTFLLVLC...................
MDP0000281982  ----...-..........................------------Lh..RDDC-.Y---LNEP...................
MDP0000053966  ----...-..........................-------------...-----.--------...................
MDP0000795740  ----...-..........................-------------...-----.--------...................
MDP0000212327  ----...-..........................-------------...-----.----KVSF...................
MDP0000437365  ----...-..........................-------------...-----.--------...................
MDP0000135231  ----...-..........................-------------...-----.--------...................
MDP0000167343  ----...-..........................-------------...-----.--------...................
MDP0000222306  ----...-..........................-------------...-----.--------...................
MDP0000183517  ----...-..........................-------------...-----.--------...................
MDP0000686821  ----...-..........................-------------...-----.--------...................
MDP0000430157  ----...-..........................-------------...-----.--------...................
MDP0000373054  ----...-..........................-------------...-----.NGRFIHKM...................
MDP0000295306  ----...-..........................-------------...-----.--------...................
MDP0000233995  ----...-..........................-------------...-----.--------...................
MDP0000209681  ----...-..........................-------------...-----.--------...................
MDP0000876898  ----...L..........................-------------...-----.--------...................
MDP0000738522  --FS...L..........................DHIKGTRVTGSTF...DNYG-.-TRHGADE...................
MDP0000399642  ----...-..........................-------------...-----.--------...................
MDP0000215521  ----...-..........................-------------...-----.--------...................
MDP0000170521  ----...-..........................-------------...-----.--------...................
MDP0000262982  LCNH...N..........................AFPSMVVRSSVHVm..PREI-.-FGKSTFElavfllkwlpvwladklll
MDP0000321186  LLRP...-..........................-------------...-----.--------...................
MDP0000266051  LSNS...G..........................AYTSIVVQSP---...-----.--------...................
MDP0000837610  ----...-..........................-------------...-----.--------...................
MDP0000582079  ----...-..........................-------------...-----.--------...................
MDP0000538071  ----...-..........................-------------...-----.--------...................
MDP0000241703  ----...-..........................-------------...-----.--------...................
MDP0000671114  ----...-..........................-------------...-----.--------...................
MDP0000315388  ----...-..........................-------------...-----.--------...................
MDP0000134271  CAEA...Nqgpdg.....................QACTMVIRTLHWTv..PSYWI.-------Wglpfflffstrssqflher
MDP0000297581  ----...-..........................-------------...-----.--------...................
MDP0000911003  ----...-..........................----------DIL...NLGV-.SPAKLIEV...................
MDP0000576650  ----...-..........................-------------...-----.--------...................
MDP0000149205  ----...-..........................-------------...-----.--------...................
MDP0000315409  ----...-..........................-------------...-----.--------...................
MDP0000320804  ----...-..........................-------------...-----.--------...................
MDP0000474647  ----...-..........................-------------...-----.--------...................
MDP0000566648  ----...-..........................-------------...-----.--------...................
MDP0000171379  ----...-..........................-------------...-----.--------...................
MDP0000814529  ----...-..........................-------------...-----.--------...................
MDP0000218295  ----...-..........................-------------...-----.--------...................
MDP0000220943  CAEA...Nqgdsygqpsgn...............CQCEMTRWAGMYNg..DKDSTlDS-----Silldlgasifplffdkvfs
MDP0000795437  ----...-..........................-------------...-----.--------...................
MDP0000919706  ----...-..........................-------------...-----.--------...................
MDP0000295675  ----...-..........................-------------...-----.--------...................
MDP0000147542  ----...-..........................-------------...-----.--------...................
MDP0000272126  ----...-..........................-------------...-----.--------...................
MDP0000196881  ----...-..........................-------------...-----.--------...................
MDP0000268346  ----...-..........................-------------...-----.--------...................
MDP0000147542  ----...-..........................-------------...-----.--------...................
MDP0000948298  ----...-..........................-------------...-----.--------...................
MDP0000220943  ----...-..........................-------------...-----.--------...................
MDP0000182589  ----...-..........................-------------...-----.--------...................
MDP0000557870  ----...-..........................-------------...-----.--------...................
MDP0000308870  ----...-..........................-------------...-----.--------...................
MDP0000322449  LSFI...D..........................AEVMCDRHYGGINy..PIGG-.-VGGIAKS...................
MDP0000286494  ----...-..........................-------------...-----.--------...................
MDP0000150868  ----...-..........................-------------...-----.--------...................
MDP0000155608  ----...-..........................-------------...-----.--------...................
MDP0000168505  ----...-..........................-------------...-----.--------...................
MDP0000196888  ----...-..........................-------------...-----.--------...................
MDP0000154812  ----...-..........................-------------...-----.--------...................
MDP0000186080  ----...-..........................-------------...-----.--------...................
MDP0000220012  ----...-..........................-------------...-----.--------...................
MDP0000169409  ----...-..........................-------------...-----.--------...................
MDP0000373095  ----...-..........................-------------...-----.--------...................
MDP0000235846  ----...-..........................-------------...-----.--------...................
MDP0000207126  PKHD...T..........................HGIGDFEYCDR--...-----.--------...................
MDP0000268357  ----...-..........................-------------...-----.--------...................
MDP0000770761  ----...-..........................-------------...-----.--------...................
MDP0000149067  ----...-..........................-------------...-----.--------...................


                                                                                                    
                                                                                                    
d1cf3a1          ...................................................................................
MDP0000813172  ...................................................................................
MDP0000251581  ...................................................................................
MDP0000188391  ...................................................................................
MDP0000254144  ...................................................................................
MDP0000321972  ...................................................................................
MDP0000299806  ...................................................................................
MDP0000283451  ...................................................................................
MDP0000296714  ...................................................................................
MDP0000162193  ...................................................................................
MDP0000769741  ...................................................................................
MDP0000295277  ...................................................................................
MDP0000897124  ...................................................................................
MDP0000854208  ...................................................................................
MDP0000241767  ...................................................................................
MDP0000318858  ...................................................................................
MDP0000248995  ...................................................................................
MDP0000442206  ...................................................................................
MDP0000181673  ...................................................................................
MDP0000315409  ...................................................................................
MDP0000053966  ...................................................................................
MDP0000294615  ...................................................................................
MDP0000306147  ...................................................................................
MDP0000180064  ...................................................................................
MDP0000261625  ...................................................................................
MDP0000300208  ...................................................................................
MDP0000247171  ...................................................................................
MDP0000308095  rnldsisfsdwflskggtrmsiqrmwdpvayalgfidcdnisarcmltiftlfatkteasllrmlkgspdvylsgp.......
MDP0000319421  ...................................................................................
MDP0000232295  ...................................................................................
MDP0000188994  ...................................................................................
MDP0000159189  ...................................................................................
MDP0000656178  ...................................................................................
MDP0000910523  ...................................................................................
MDP0000119941  ...................................................................................
MDP0000231799  ...................................................................................
MDP0000255025  rnldsisfsdwflskggtrmsiqrmwdpvayalgfidcdnisarcmltiftlfatkteasllrmlkgspdvylsgp.......
MDP0000231632  ...................................................................................
MDP0000173300  ...................................................................................
MDP0000158474  ...................................................................................
MDP0000276878  ...................................................................................
MDP0000154720  ...................................................................................
MDP0000549646  ...................................................................................
MDP0000158853  ...................................................................................
MDP0000702799  ...................................................................................
MDP0000233110  ...................................................................................
MDP0000260827  ...................................................................................
MDP0000941459  ...................................................................................
MDP0000185338  ...................................................................................
MDP0000451172  ...................................................................................
MDP0000136847  ...................................................................................
MDP0000177641  ...................................................................................
MDP0000413935  ...................................................................................
MDP0000206098  ...................................................................................
MDP0000845788  ...................................................................................
MDP0000465595  ...................................................................................
MDP0000137211  ...................................................................................
MDP0000130099  ...................................................................................
MDP0000425135  ...................................................................................
MDP0000200780  ...................................................................................
MDP0000142434  ...................................................................................
MDP0000248951  ...................................................................................
MDP0000869086  ...................................................................................
MDP0000318256  ...................................................................................
MDP0000231634  ...................................................................................
MDP0000626995  ...................................................................................
MDP0000123832  ...................................................................................
MDP0000236092  ...................................................................................
MDP0000199159  ...................................................................................
MDP0000162755  ...................................................................................
MDP0000173666  ...................................................................................
MDP0000262982  ...................................................................................
MDP0000184832  ...................................................................................
MDP0000598927  ...................................................................................
MDP0000561228  ...................................................................................
MDP0000175650  ...................................................................................
MDP0000233802  ...................................................................................
MDP0000321186  ...................................................................................
MDP0000161955  ...................................................................................
MDP0000213381  ...................................................................................
MDP0000168437  ...................................................................................
MDP0000823251  ...................................................................................
MDP0000191389  ...................................................................................
MDP0000199319  ...................................................................................
MDP0000857446  ...................................................................................
MDP0000266638  ...................................................................................
MDP0000208936  ...................................................................................
MDP0000202883  ...................................................................................
MDP0000288439  ...................................................................................
MDP0000295839  ...................................................................................
MDP0000903805  ...................................................................................
MDP0000202123  ...................................................................................
MDP0000227773  ...................................................................................
MDP0000317524  ...................................................................................
MDP0000320748  ...................................................................................
MDP0000634676  ...................................................................................
MDP0000235846  ...................................................................................
MDP0000251344  ...................................................................................
MDP0000501957  ...................................................................................
MDP0000209681  ...................................................................................
MDP0000293482  ...................................................................................
MDP0000233995  ...................................................................................
MDP0000257243  ...................................................................................
MDP0000160099  ...................................................................................
MDP0000193196  ...................................................................................
MDP0000208234  ...................................................................................
MDP0000251783  ...................................................................................
MDP0000686885  ...................................................................................
MDP0000138851  ...................................................................................
MDP0000194930  ...................................................................................
MDP0000169201  ...................................................................................
MDP0000399642  ...................................................................................
MDP0000582079  ...................................................................................
MDP0000129765  ...................................................................................
MDP0000272655  ...................................................................................
MDP0000686821  ...................................................................................
MDP0000170414  ...................................................................................
MDP0000320804  ...................................................................................
MDP0000189790  ...................................................................................
MDP0000847111  ...................................................................................
MDP0000289536  ...................................................................................
MDP0000123987  ...................................................................................
MDP0000245245  ...................................................................................
MDP0000188553  ...................................................................................
MDP0000296599  ...................................................................................
MDP0000746652  ...................................................................................
MDP0000259265  ...................................................................................
MDP0000151331  egtrftgde..........................................................................
MDP0000309775  ...................................................................................
MDP0000232736  ...................................................................................
MDP0000320539  ...................................................................................
MDP0000239909  ...................................................................................
MDP0000259264  ...................................................................................
MDP0000293613  ...................................................................................
MDP0000253362  ...................................................................................
MDP0000182973  hslmlslvylsplipiw..................................................................
MDP0000138005  ...................................................................................
MDP0000261301  ...................................................................................
MDP0000771633  ...................................................................................
MDP0000851102  ...................................................................................
MDP0000159873  ...................................................................................
MDP0000140206  ...................................................................................
MDP0000261201  ...................................................................................
MDP0000252244  ...................................................................................
MDP0000261821  ...................................................................................
MDP0000124454  ...................................................................................
MDP0000234830  ...................................................................................
MDP0000297861  ...................................................................................
MDP0000152184  ...................................................................................
MDP0000157871  ...................................................................................
MDP0000250932  ...................................................................................
MDP0000219521  ...................................................................................
MDP0000239289  ...................................................................................
MDP0000258995  ...................................................................................
MDP0000167343  ...................................................................................
MDP0000222306  ...................................................................................
MDP0000829384  ...................................................................................
MDP0000145663  ...................................................................................
MDP0000288439  ...................................................................................
MDP0000267350  ...................................................................................
MDP0000155608  ...................................................................................
MDP0000194622  ...................................................................................
MDP0000134271  ...................................................................................
MDP0000312748  ...................................................................................
MDP0000197715  ...................................................................................
MDP0000220943  ...................................................................................
MDP0000320539  ...................................................................................
MDP0000140206  ...................................................................................
MDP0000215521  ...................................................................................
MDP0000203847  ...................................................................................
MDP0000201011  ...................................................................................
MDP0000204596  ...................................................................................
MDP0000148978  mifampnkpgefsrfdflevlpapingkyyshllkiesslftnaensfcswegiwailknnemltwpekikfaigllpailgg
MDP0000130369  eqcsaaatlgllsyifahqknfdlvlcrgtsrerifkp.............................................
MDP0000314606  ...................................................................................
MDP0000263146  ...................................................................................
MDP0000250583  ...................................................................................
MDP0000208233  sklvygnlasygierpqegpfymkgkygkypaidvg...............................................
MDP0000158720  ...................................................................................
MDP0000152184  ...................................................................................
MDP0000182702  ...................................................................................
MDP0000261638  ...................................................................................
MDP0000130370  ...................................................................................
MDP0000272119  ...................................................................................
MDP0000305861  ...................................................................................
MDP0000255696  ...................................................................................
MDP0000214280  egtrftgde..........................................................................
MDP0000210966  ...................................................................................
MDP0000610999  ...................................................................................
MDP0000242546  ...................................................................................
MDP0000320742  ...................................................................................
MDP0000654164  ...................................................................................
MDP0000256300  ...................................................................................
MDP0000235080  ...................................................................................
MDP0000284363  ...................................................................................
MDP0000125043  ...................................................................................
MDP0000192359  ...................................................................................
MDP0000440005  ...................................................................................
MDP0000609131  ...................................................................................
MDP0000362000  ...................................................................................
MDP0000150210  ...................................................................................
MDP0000158790  ...................................................................................
MDP0000427950  ...................................................................................
MDP0000569169  ...................................................................................
MDP0000525742  ...................................................................................
MDP0000559829  ...................................................................................
MDP0000321788  ...................................................................................
MDP0000919183  ...................................................................................
MDP0000146158  ...................................................................................
MDP0000832077  ...................................................................................
MDP0000621365  ...................................................................................
MDP0000875229  ...................................................................................
MDP0000251344  ...................................................................................
MDP0000168919  ...................................................................................
MDP0000267855  ...................................................................................
MDP0000195207  ...................................................................................
MDP0000400145  ...................................................................................
MDP0000919183  ...................................................................................
MDP0000307336  ...................................................................................
MDP0000263146  ...................................................................................
MDP0000309730  ...................................................................................
MDP0000163903  ...................................................................................
MDP0000611628  ...................................................................................
MDP0000119779  ...................................................................................
MDP0000120904  ...................................................................................
MDP0000150544  ...................................................................................
MDP0000902209  ...................................................................................
MDP0000269370  ...................................................................................
MDP0000146158  ...................................................................................
MDP0000124051  ...................................................................................
MDP0000255696  ...................................................................................
MDP0000305861  ...................................................................................
MDP0000611628  ...................................................................................
MDP0000309622  ...................................................................................
MDP0000239909  ...................................................................................
MDP0000126888  ...................................................................................
MDP0000869086  ...................................................................................
MDP0000317524  ...................................................................................
MDP0000160099  ...................................................................................
MDP0000251205  ...................................................................................
MDP0000314335  ...................................................................................
MDP0000638870  ...................................................................................
MDP0000790657  ...................................................................................
MDP0000748068  ...................................................................................
MDP0000727481  ...................................................................................
MDP0000301246  ...................................................................................
MDP0000190684  ...................................................................................
MDP0000456223  ...................................................................................
MDP0000745172  ...................................................................................
MDP0000407932  ...................................................................................
MDP0000440896  ...................................................................................
MDP0000694227  ...................................................................................
MDP0000123987  ...................................................................................
MDP0000138005  ...................................................................................
MDP0000258205  ...................................................................................
MDP0000245245  ...................................................................................
MDP0000306704  ...................................................................................
MDP0000478654  ...................................................................................
MDP0000728219  ...................................................................................
MDP0000170414  ...................................................................................
MDP0000284363  ...................................................................................
MDP0000219560  ...................................................................................
MDP0000235930  ...................................................................................
MDP0000755938  ...................................................................................
MDP0000138851  ...................................................................................
MDP0000261638  ...................................................................................
MDP0000317524  ...................................................................................
MDP0000294615  ...................................................................................
MDP0000208234  ...................................................................................
MDP0000216129  ...................................................................................
MDP0000219521  ...................................................................................
MDP0000248995  ...................................................................................
MDP0000256328  ...................................................................................
MDP0000181673  ...................................................................................
MDP0000169201  ...................................................................................
MDP0000263530  ...................................................................................
MDP0000295839  gdlskygltrpklgpfflkenegqapiidvg....................................................
MDP0000297466  ...................................................................................
MDP0000281982  ...................................................................................
MDP0000053966  ...................................................................................
MDP0000795740  ...................................................................................
MDP0000212327  ...................................................................................
MDP0000437365  ...................................................................................
MDP0000135231  ...................................................................................
MDP0000167343  ...................................................................................
MDP0000222306  ...................................................................................
MDP0000183517  ...................................................................................
MDP0000686821  ...................................................................................
MDP0000430157  ...................................................................................
MDP0000373054  ...................................................................................
MDP0000295306  ...................................................................................
MDP0000233995  ...................................................................................
MDP0000209681  ...................................................................................
MDP0000876898  ...................................................................................
MDP0000738522  ...................................................................................
MDP0000399642  ...................................................................................
MDP0000215521  ...................................................................................
MDP0000170521  ...................................................................................
MDP0000262982  mxswlvlgsiekyglkrpsmgpmemknvegktpvlxig.............................................
MDP0000321186  ...................................................................................
MDP0000266051  ...................................................................................
MDP0000837610  ...................................................................................
MDP0000582079  ...................................................................................
MDP0000538071  ...................................................................................
MDP0000241703  ...................................................................................
MDP0000671114  ...................................................................................
MDP0000315388  ...................................................................................
MDP0000134271  pnqslfralfcllsspmrmaiskfiesylkwklplvkyglkpdhpfledyascqmailpenf.....................
MDP0000297581  ...................................................................................
MDP0000911003  ...................................................................................
MDP0000576650  ...................................................................................
MDP0000149205  ...................................................................................
MDP0000315409  ...................................................................................
MDP0000320804  ...................................................................................
MDP0000474647  ...................................................................................
MDP0000566648  ...................................................................................
MDP0000171379  ...................................................................................
MDP0000814529  ...................................................................................
MDP0000218295  ...................................................................................
MDP0000220943  ipprkakpelipslvlpsfiaygkfhrmviskfiesylewklplvkyglkpdhpfledyascqmailpen.............
MDP0000795437  ...................................................................................
MDP0000919706  ...................................................................................
MDP0000295675  ...................................................................................
MDP0000147542  ...................................................................................
MDP0000272126  ...................................................................................
MDP0000196881  ...................................................................................
MDP0000268346  ...................................................................................
MDP0000147542  ...................................................................................
MDP0000948298  ...................................................................................
MDP0000220943  ...................................................................................
MDP0000182589  ...................................................................................
MDP0000557870  ...................................................................................
MDP0000308870  ...................................................................................
MDP0000322449  ...................................................................................
MDP0000286494  ...................................................................................
MDP0000150868  ...................................................................................
MDP0000155608  ...................................................................................
MDP0000168505  ...................................................................................
MDP0000196888  ...................................................................................
MDP0000154812  ...................................................................................
MDP0000186080  ...................................................................................
MDP0000220012  ...................................................................................
MDP0000169409  ...................................................................................
MDP0000373095  ...................................................................................
MDP0000235846  ...................................................................................
MDP0000207126  ...................................................................................
MDP0000268357  ...................................................................................
MDP0000770761  ...................................................................................
MDP0000149067  ...................................................................................


                                                                                                    
                                                                                                    
d1cf3a1          ................................................................................LLP
MDP0000813172  ................................................................................LYG
MDP0000251581  ................................................................................LYG
MDP0000188391  ................................................................................LYG
MDP0000254144  ................................................................................LCE
MDP0000321972  ................................................................................YDP
MDP0000299806  ................................................................................LA-
MDP0000283451  ................................................................................LA-
MDP0000296714  ................................................................................LG-
MDP0000162193  ................................................................................LG-
MDP0000769741  ................................................................................YLP
MDP0000295277  ................................................................................FQR
MDP0000897124  ................................................................................FQR
MDP0000854208  ................................................................................LLK
MDP0000241767  ................................................................................LGE
MDP0000318858  ................................................................................TKR
MDP0000248995  ................................................................................FAR
MDP0000442206  ................................................................................TKR
MDP0000181673  ................................................................................FAR
MDP0000315409  ................................................................................FAR
MDP0000053966  ................................................................................FAR
MDP0000294615  ................................................................................FAR
MDP0000306147  ................................................................................LGE
MDP0000180064  ................................................................................LAK
MDP0000261625  ................................................................................TVI
MDP0000300208  ................................................................................VAR
MDP0000247171  ................................................................................LAD
MDP0000308095  ................................................................................IRD
MDP0000319421  ................................................................................LAD
MDP0000232295  ................................................................................LLE
MDP0000188994  ................................................................................LAD
MDP0000159189  ................................................................................LAD
MDP0000656178  ................................................................................AQR
MDP0000910523  ................................................................................LAD
MDP0000119941  ................................................................................FQR
MDP0000231799  ................................................................................AQR
MDP0000255025  ................................................................................IRD
MDP0000231632  ................................................................................LCN
MDP0000173300  ................................................................................LMD
MDP0000158474  ................................................................................LLS
MDP0000276878  ................................................................................VRE
MDP0000154720  ................................................................................---
MDP0000549646  ................................................................................MSK
MDP0000158853  ................................................................................LAS
MDP0000702799  ................................................................................LAS
MDP0000233110  ................................................................................LVD
MDP0000260827  ................................................................................MRE
MDP0000941459  ................................................................................LAS
MDP0000185338  ................................................................................LLN
MDP0000451172  ................................................................................LLQ
MDP0000136847  ................................................................................LLN
MDP0000177641  ................................................................................LLT
MDP0000413935  ................................................................................MRE
MDP0000206098  ................................................................................MSK
MDP0000845788  ................................................................................CFR
MDP0000465595  ................................................................................LLE
MDP0000137211  ................................................................................-LN
MDP0000130099  ................................................................................LLN
MDP0000425135  ................................................................................LLK
MDP0000200780  ................................................................................---
MDP0000142434  ................................................................................ITT
MDP0000248951  ................................................................................LLN
MDP0000869086  ................................................................................---
MDP0000318256  ................................................................................LLN
MDP0000231634  ................................................................................LCN
MDP0000626995  ................................................................................MSK
MDP0000123832  ................................................................................LAD
MDP0000236092  ................................................................................MSK
MDP0000199159  ................................................................................---
MDP0000162755  ................................................................................LAN
MDP0000173666  ................................................................................LCN
MDP0000262982  ................................................................................---
MDP0000184832  ................................................................................IFP
MDP0000598927  ................................................................................LLE
MDP0000561228  ................................................................................LLN
MDP0000175650  ................................................................................TFQ
MDP0000233802  ................................................................................MQN
MDP0000321186  ................................................................................---
MDP0000161955  ................................................................................MRE
MDP0000213381  ................................................................................MRE
MDP0000168437  ................................................................................MRE
MDP0000823251  ................................................................................MQN
MDP0000191389  ................................................................................MRE
MDP0000199319  ................................................................................MRE
MDP0000857446  ................................................................................MRE
MDP0000266638  ................................................................................MRE
MDP0000208936  ................................................................................LVD
MDP0000202883  ................................................................................LRE
MDP0000288439  ................................................................................LLT
MDP0000295839  ................................................................................---
MDP0000903805  ................................................................................LNK
MDP0000202123  ................................................................................VQE
MDP0000227773  ................................................................................---
MDP0000317524  ................................................................................---
MDP0000320748  ................................................................................MRE
MDP0000634676  ................................................................................MRE
MDP0000235846  ................................................................................-HR
MDP0000251344  ................................................................................-HR
MDP0000501957  ................................................................................MRG
MDP0000209681  ................................................................................---
MDP0000293482  ................................................................................LYN
MDP0000233995  ................................................................................---
MDP0000257243  ................................................................................-LN
MDP0000160099  ................................................................................MEK
MDP0000193196  ................................................................................MRG
MDP0000208234  ................................................................................---
MDP0000251783  ................................................................................LLN
MDP0000686885  ................................................................................FQT
MDP0000138851  ................................................................................---
MDP0000194930  ................................................................................IAN
MDP0000169201  ................................................................................---
MDP0000399642  ................................................................................---
MDP0000582079  ................................................................................---
MDP0000129765  ................................................................................LYN
MDP0000272655  ................................................................................LNK
MDP0000686821  ................................................................................---
MDP0000170414  ................................................................................---
MDP0000320804  ................................................................................---
MDP0000189790  ................................................................................MRD
MDP0000847111  ................................................................................---
MDP0000289536  ................................................................................FQT
MDP0000123987  ................................................................................---
MDP0000245245  ................................................................................---
MDP0000188553  ................................................................................YSQ
MDP0000296599  ................................................................................LIS
MDP0000746652  ................................................................................LEN
MDP0000259265  ................................................................................---
MDP0000151331  ................................................................................LLN
MDP0000309775  ................................................................................FRQ
MDP0000232736  ................................................................................---
MDP0000320539  ................................................................................---
MDP0000239909  ................................................................................---
MDP0000259264  ................................................................................---
MDP0000293613  ................................................................................LAC
MDP0000253362  ................................................................................LAC
MDP0000182973  ................................................................................VQG
MDP0000138005  ................................................................................---
MDP0000261301  ................................................................................FSR
MDP0000771633  ................................................................................LRT
MDP0000851102  ................................................................................LRT
MDP0000159873  ................................................................................LRN
MDP0000140206  ................................................................................---
MDP0000261201  ................................................................................LRN
MDP0000252244  ................................................................................LRN
MDP0000261821  ................................................................................YEG
MDP0000124454  ................................................................................---
MDP0000234830  ................................................................................LAC
MDP0000297861  ................................................................................MRE
MDP0000152184  ................................................................................---
MDP0000157871  ................................................................................YEG
MDP0000250932  ................................................................................SFS
MDP0000219521  ................................................................................---
MDP0000239289  ................................................................................---
MDP0000258995  ................................................................................---
MDP0000167343  ................................................................................---
MDP0000222306  ................................................................................---
MDP0000829384  ................................................................................FTR
MDP0000145663  ................................................................................LLE
MDP0000288439  ................................................................................LLM
MDP0000267350  ................................................................................YEG
MDP0000155608  ................................................................................---
MDP0000194622  ................................................................................MLQ
MDP0000134271  ................................................................................---
MDP0000312748  ................................................................................IAN
MDP0000197715  ................................................................................LVD
MDP0000220943  ................................................................................---
MDP0000320539  ................................................................................YEE
MDP0000140206  ................................................................................YEG
MDP0000215521  ................................................................................---
MDP0000203847  ................................................................................WEK
MDP0000201011  ................................................................................ISK
MDP0000204596  ................................................................................LG-
MDP0000148978  qayveaqdglsvkdwmrkqgipdrvttevfiamskalnfinpdelsmqcilialnrflqekhgskmafldgspperlcapIVD
MDP0000130369  ................................................................................WME
MDP0000314606  ................................................................................LAC
MDP0000263146  ................................................................................---
MDP0000250583  ................................................................................AIK
MDP0000208233  ................................................................................AYR
MDP0000158720  ................................................................................LMS
MDP0000152184  ................................................................................YEE
MDP0000182702  ................................................................................LAK
MDP0000261638  ................................................................................---
MDP0000130370  ................................................................................WME
MDP0000272119  ................................................................................---
MDP0000305861  ................................................................................---
MDP0000255696  ................................................................................---
MDP0000214280  ................................................................................LLN
MDP0000210966  ................................................................................LLE
MDP0000610999  ................................................................................---
MDP0000242546  ................................................................................---
MDP0000320742  ................................................................................---
MDP0000654164  ................................................................................---
MDP0000256300  ................................................................................LNK
MDP0000235080  ................................................................................--A
MDP0000284363  ................................................................................---
MDP0000125043  ................................................................................---
MDP0000192359  ................................................................................LLT
MDP0000440005  ................................................................................ALK
MDP0000609131  ................................................................................AAG
MDP0000362000  ................................................................................ATK
MDP0000150210  ................................................................................---
MDP0000158790  ................................................................................LLR
MDP0000427950  ................................................................................---
MDP0000569169  ................................................................................---
MDP0000525742  ................................................................................---
MDP0000559829  ................................................................................MRE
MDP0000321788  ................................................................................LAK
MDP0000919183  ................................................................................ATN
MDP0000146158  ................................................................................LRQ
MDP0000832077  ................................................................................---
MDP0000621365  ................................................................................---
MDP0000875229  ................................................................................AHR
MDP0000251344  ................................................................................---
MDP0000168919  ................................................................................---
MDP0000267855  ................................................................................---
MDP0000195207  ................................................................................---
MDP0000400145  ................................................................................---
MDP0000919183  ................................................................................---
MDP0000307336  ................................................................................---
MDP0000263146  ................................................................................AEG
MDP0000309730  ................................................................................---
MDP0000163903  ................................................................................ALD
MDP0000611628  ................................................................................---
MDP0000119779  ................................................................................ALD
MDP0000120904  ................................................................................---
MDP0000150544  ................................................................................---
MDP0000902209  ................................................................................---
MDP0000269370  ................................................................................---
MDP0000146158  ................................................................................LRQ
MDP0000124051  ................................................................................LAA
MDP0000255696  ................................................................................AEE
MDP0000305861  ................................................................................AEE
MDP0000611628  ................................................................................---
MDP0000309622  ................................................................................---
MDP0000239909  ................................................................................---
MDP0000126888  ................................................................................---
MDP0000869086  ................................................................................---
MDP0000317524  ................................................................................LSK
MDP0000160099  ................................................................................---
MDP0000251205  ................................................................................---
MDP0000314335  ................................................................................---
MDP0000638870  ................................................................................---
MDP0000790657  ................................................................................---
MDP0000748068  ................................................................................---
MDP0000727481  ................................................................................---
MDP0000301246  ................................................................................---
MDP0000190684  ................................................................................---
MDP0000456223  ................................................................................---
MDP0000745172  ................................................................................---
MDP0000407932  ................................................................................---
MDP0000440896  ................................................................................---
MDP0000694227  ................................................................................---
MDP0000123987  ................................................................................---
MDP0000138005  ................................................................................YSQ
MDP0000258205  ................................................................................LLE
MDP0000245245  ................................................................................---
MDP0000306704  ................................................................................ALD
MDP0000478654  ................................................................................---
MDP0000728219  ................................................................................---
MDP0000170414  ................................................................................---
MDP0000284363  ................................................................................AEK
MDP0000219560  ................................................................................LAS
MDP0000235930  ................................................................................---
MDP0000755938  ................................................................................---
MDP0000138851  ................................................................................TCR
MDP0000261638  ................................................................................---
MDP0000317524  ................................................................................---
MDP0000294615  ................................................................................---
MDP0000208234  ................................................................................AYR
MDP0000216129  ................................................................................---
MDP0000219521  ................................................................................---
MDP0000248995  ................................................................................---
MDP0000256328  ................................................................................---
MDP0000181673  ................................................................................---
MDP0000169201  ................................................................................---
MDP0000263530  ................................................................................---
MDP0000295839  ................................................................................SIN
MDP0000297466  ................................................................................LQA
MDP0000281982  ................................................................................ALD
MDP0000053966  ................................................................................---
MDP0000795740  ................................................................................---
MDP0000212327  ................................................................................VCH
MDP0000437365  ................................................................................---
MDP0000135231  ................................................................................---
MDP0000167343  ................................................................................---
MDP0000222306  ................................................................................---
MDP0000183517  ................................................................................---
MDP0000686821  ................................................................................---
MDP0000430157  ................................................................................---
MDP0000373054  ................................................................................HER
MDP0000295306  ................................................................................---
MDP0000233995  ................................................................................---
MDP0000209681  ................................................................................---
MDP0000876898  ................................................................................---
MDP0000738522  ................................................................................LLN
MDP0000399642  ................................................................................---
MDP0000215521  ................................................................................---
MDP0000170521  ................................................................................---
MDP0000262982  ................................................................................ALD
MDP0000321186  ................................................................................---
MDP0000266051  ................................................................................---
MDP0000837610  ................................................................................---
MDP0000582079  ................................................................................---
MDP0000538071  ................................................................................---
MDP0000241703  ................................................................................---
MDP0000671114  ................................................................................---
MDP0000315388  ................................................................................---
MDP0000134271  ................................................................................F-A
MDP0000297581  ................................................................................---
MDP0000911003  ................................................................................VKN
MDP0000576650  ................................................................................---
MDP0000149205  ................................................................................---
MDP0000315409  ................................................................................---
MDP0000320804  ................................................................................---
MDP0000474647  ................................................................................---
MDP0000566648  ................................................................................---
MDP0000171379  ................................................................................---
MDP0000814529  ................................................................................---
MDP0000218295  ................................................................................---
MDP0000220943  ................................................................................FFA
MDP0000795437  ................................................................................---
MDP0000919706  ................................................................................---
MDP0000295675  ................................................................................---
MDP0000147542  ................................................................................---
MDP0000272126  ................................................................................---
MDP0000196881  ................................................................................---
MDP0000268346  ................................................................................---
MDP0000147542  ................................................................................---
MDP0000948298  ................................................................................---
MDP0000220943  ................................................................................---
MDP0000182589  ................................................................................---
MDP0000557870  ................................................................................---
MDP0000308870  ................................................................................---
MDP0000322449  ................................................................................LAK
MDP0000286494  ................................................................................---
MDP0000150868  ................................................................................---
MDP0000155608  ................................................................................---
MDP0000168505  ................................................................................---
MDP0000196888  ................................................................................---
MDP0000154812  ................................................................................---
MDP0000186080  ................................................................................---
MDP0000220012  ................................................................................---
MDP0000169409  ................................................................................---
MDP0000373095  ................................................................................---
MDP0000235846  ................................................................................---
MDP0000207126  ................................................................................---
MDP0000268357  ................................................................................---
MDP0000770761  ................................................................................---
MDP0000149067  ................................................................................---


                         240       250                                                         260  
                           |         |                                                           |  
d1cf3a1          NYQ..RP.N.LQVLTGQYVGKVLLS......................................QN.GT.......T....PRA
MDP0000813172  QAM..KH.N.TQFFVEYFALDLLMD......................................SE.G-.......-....-GC
MDP0000251581  QAM..KH.N.TQFFVEYFALDLLMD......................................SE.G-.......-....-GC
MDP0000188391  QAM..KH.N.TQFFVEYFALDLLMDseglvlyadalvyy........................QG.--.......-....-TC
MDP0000254144  R--..--.-.VPIFYGKTVNTIRYG......................................DE.--.......-....---
MDP0000321972  IIKalAK.D.IDVRLNHRVTKXLNG......................................SN.--.......-....-KV
MDP0000299806  ---..-E.G.LPIFYERTVQSIRYG......................................SD.--.......-....---
MDP0000283451  ---..-E.G.LPIFYERTVQSIRYG......................................SD.--.......-....---
MDP0000296714  ---..-E.G.LHIHLNHVVTDISYVtkdagl................................N-.--.......T....NRC
MDP0000162193  ---..-E.G.LQIRLNHVVTDVSYGtkdaglntnp............................GN.--.......-....-K-
MDP0000769741  VINtlAK.G.LDVRLSHRVKKXTRR......................................YN.--.......-....---
MDP0000295277  SLE..KQ.G.MKFMLKTKVVGVDTS......................................GD.--.......-....---
MDP0000897124  SLE..KQ.G.MKFMLKTKVVGVDTS......................................GD.--.......-....---
MDP0000854208  AALk.DP.N.IFMFEHHLAIDLLTC......................................QD.GS.......D....TVC
MDP0000241767  ---..--.G.LXIHLNHVVTDISYXtkdagln...............................T-.--.......-....NRX
MDP0000318858  FVG..DE.N.GAVK-GLEVVRVKWE......................................KD.--.......-....-ET
MDP0000248995  LSA..VY.G.GTYMLNKPECKVEFN......................................EE.G-.......-....-KV
MDP0000442206  FVG..DE.N.GA-LKGLEVVRVKWE......................................KD.ET.......-....---
MDP0000181673  LSA..VY.G.GTYMLNKPECKVEFN......................................EE.G-.......-....-KV
MDP0000315409  LSA..VY.G.GTYMLSKPECKVEFE......................................NG.--.......-....-KA
MDP0000053966  LSA..VY.G.GTYMLSKPECKVEFE......................................NK.--.......-....-KA
MDP0000294615  LSA..VY.G.GTYMLSKPECKVEFE......................................NK.--.......-....-KA
MDP0000306147  XLX..--.-.--IHLNHVVTDISYXtkdagln...............................T-.--.......-....NRX
MDP0000180064  GLV..DQ.G.SEILYKANVTNIIVD......................................QG.--.......-....-RA
MDP0000261625  HLX..ED.D.SKLDLGQVVRELQHS......................................RN.--.......-....---
MDP0000300208  NLE..GR.G.IDLHPQTNLTELVKT......................................ED.--.......-....---
MDP0000247171  ELP..PN.-.-SIRFASKLTAIETQ......................................EH.EG.......S....-S-
MDP0000308095  YII..AK.G.GRFHLRWGCREILYD......................................KS.SD.......Ge...TYV
MDP0000319421  NLP..PN.-.-TVRFGCEVHSVKLN......................................PG.TS.......-....-SP
MDP0000232295  AGN..PN.H.ITVLLNATVTNVIFH......................................ER.GD.......Rne..TXA
MDP0000188994  EL-..-P.S.GTIRFSSKVVSIDES......................................GY.--.......-....--L
MDP0000159189  EL-..-P.S.GTIRFSSKVVSIDES......................................GY.--.......-....--L
MDP0000656178  VLIn.PR.K.IDYQTGVFASKITPA......................................KD.GK.......-....--P
MDP0000910523  ELP..PN.S.IRFASKLTAIEAQEH......................................EG.S-.......-....-SI
MDP0000119941  SLE..KQ.G.MKFMLKTKVVGVDTS......................................GD.--.......-....---
MDP0000231799  VLIn.PR.K.IDYQTGVFASKITPA......................................KD.GK.......P....V--
MDP0000255025  YII..AK.G.GRFHLRWGCREILYD......................................KS.SD.......Ge...TYV
MDP0000231632  ELG..KD.-.-EVKLNSKVLSLSYS......................................HD.GK.......SafenWSV
MDP0000173300  AVD..-Y.G.AVIITGCKAERFVLE......................................TN.KSxskr...K....KKC
MDP0000158474  SGN..PQ.K.LTVLVYATVQKIVFD......................................IS.GK.......K....PRA
MDP0000276878  VLE..SK.G.CHIRTSSEVHRVSTS......................................DE.--.......-....---
MDP0000154720  ---..--.-.---------------......................................--.--.......-....---
MDP0000549646  LLA..RP.N.VKLFNAVAAEDLIIK......................................GG.--.......-....-RV
MDP0000158853  VL-..-P.P.GLIQLGKKVTEIQWQpenhthsgyes...........................D-.--.......-....TRP
MDP0000702799  VL-..-P.P.GLIQLGKKVTEIQWQpenhthsgyes...........................D-.--.......-....TRP
MDP0000233110  AVE..-C.G.AVILTGCKAEKFILE......................................SD.ND.......Ggrr.KRC
MDP0000260827  KAAt.LP.N.VRLEQG-TVTSLLEE......................................KG.--.......-....-TI
MDP0000941459  VLP..--.P.GLIQLGKKVRKIQWQ......................................PD.NRknkgyesD....TRP
MDP0000185338  YAK..PL.N.IKVVTHASVERILLA......................................ST.GP.......SpasrQSA
MDP0000451172  YAD..PR.K.INVYLNARVQKIXFRhi....................................PG.RL.......R....PQA
MDP0000136847  KGH..PK.N.LRVAIHAAVERIIFS......................................SK.AS.......G....LSA
MDP0000177641  AGN..PN.X.ITLLLNATVTSIIFH......................................EK.GS.......Rye..TIV
MDP0000413935  KAA..TL.P.NVLLEQGTVTSLLEE......................................KG.--.......-....-TI
MDP0000206098  LLA..RP.N.VKLFNAVAAEDLIIK......................................GG.--.......-....-RV
MDP0000845788  VYN..NP.N.ITLHFNTEAVDIISN......................................TK.G-.......-....-QM
MDP0000465595  AGN..PN.N.ITVLLNATVKNVIFH......................................RK.GD.......Rne..TIA
MDP0000137211  KGH..PK.N.LRVAIHATVERIIFS......................................SK.AS.......D....PSA
MDP0000130099  KGD..LD.N.LRVAVHANVEKILIS......................................STfES.......N....LSA
MDP0000425135  YAN..PL.N.IKVVTHASVERILLAstmpspas..............................R-.--.......-....QSA
MDP0000200780  ---..--.-.---------------......................................--.--.......-....---
MDP0000142434  LAE..SL.PvGTIRLGCQAISVKLD......................................SL.T-.......-....---
MDP0000248951  KGH..PK.N.LRVAIHAAVERIIFS......................................SK.AS.......G....LSA
MDP0000869086  ---..--.-.---------------......................................--.--.......-....---
MDP0000318256  KGH..PK.N.LRVAIHATVERIIFS......................................SK.AS.......G....LSA
MDP0000231634  QLG..KD.-.-ELKLNSRVLSLSYS......................................HD.GK.......SafenWSV
MDP0000626995  LLA..RP.N.VKLFNAVAAEDLIIK......................................GG.--.......-....-RV
MDP0000123832  ELP..PN.-.-SIRFASKLTAIETQ......................................EH.EG.......S....-S-
MDP0000236092  LLA..RP.N.VKLFNAVAAEDLIIK......................................GG.--.......-....-RV
MDP0000199159  ---..--.-.---------------......................................--.--.......-....---
MDP0000162755  EL-..-P.N.GTIRFSSKVVSIDES......................................G-.--.......-....-LF
MDP0000173666  QLG..KD.-.-ELKLNSXVLSLSYS......................................HD.GK.......SafenWSV
MDP0000262982  ---..--.-.---------------......................................--.--.......-....---
MDP0000184832  YNG..NR.N.VTVVRGIRFIKSDGS......................................SS.--.......-....-QT
MDP0000598927  AVLk.DP.K.IFMFEHHLAIDLLTC......................................--.--.......-....---
MDP0000561228  RGD..LD.N.LRVAVHANVEKIVFS......................................SS.ES.......R....LSA
MDP0000175650  EK-..--.-.-QLLMGHECVSIKAS......................................DD.--.......-....-FV
MDP0000233802  RALs.NP.K.IRVVWNSEVVEAYGE......................................GK.G-.......-....-PL
MDP0000321186  ---..--.-.---------------......................................--.--.......-....---
MDP0000161955  RAT..ALkN.VTLEQG-TVTTLIEE......................................KG.--.......-....-TV
MDP0000213381  RAAt.LP.N.VKLEQGT-VTTLLEE......................................KG.--.......-....-TV
MDP0000168437  KASs.LP.N.VRLEQG-TVTSLLEE......................................KG.--.......-....-TV
MDP0000823251  RALs.NP.K.IRVVWNSEVVEAYGE......................................GK.G-.......-....-PL
MDP0000191389  RVAt.LK.N.VTLEQG-TVTTLIEE......................................KG.--.......-....-TV
MDP0000199319  RAAt.LP.N.VKLEQGT-VTTLLEE......................................KG.--.......-....-TV
MDP0000857446  RAAt.LS.N.VKLEQG-TVTTLIEE......................................KG.--.......-....-TI
MDP0000266638  RAXt.LP.N.VKLXQGT-VTTLLEE......................................KG.--.......-....-TV
MDP0000208936  AVK..-F.G.AVILTGCKAEKFILE......................................ND.NE.......Ggir.KQC
MDP0000202883  RVA..TLkN.VTLEQG-TVTTLIEE......................................KG.--.......-....-TV
MDP0000288439  AGN..PN.X.ITLLLNATVTSIIFH......................................EK.GS.......Rye..TIV
MDP0000295839  ---..--.-.---------------......................................--.--.......-....---
MDP0000903805  GHP..-K.N.LRVAILATVERIIFS......................................SK.AS.......G....LSA
MDP0000202123  QMA..LR.G.IEFHAEESPQAIVKA......................................AD.G-.......-....---
MDP0000227773  ---..--.-.---------------......................................--.--.......-....---
MDP0000317524  ---..--.-.---------------......................................--.--.......-....---
MDP0000320748  RAAa.LP.N.VKLEQGT-VTTLLEE......................................KG.--.......-....-TI
MDP0000634676  RAA..TLsN.VKMEQG-TVTTLIEE......................................NG.--.......-....-XI
MDP0000235846  ALN..NP.K.IQVVWNSVVVEAYGE......................................GK.G-.......-....-PL
MDP0000251344  ALN..NP.K.IQVVWNSVVVEAYGE......................................GK.G-.......-....-PL
MDP0000501957  RASt.LS.N.VKLEQG-TVTXLIEE......................................KG.--.......-....-TI
MDP0000209681  ---..--.-.---------------......................................--.--.......-....---
MDP0000293482  ALPp.NL.-.--FLWGHHFLSFSIS......................................SD.KS.......-....-SV
MDP0000233995  ---..--.-.---------------......................................--.--.......-....---
MDP0000257243  KAH..PK.N.LRVAILATVERIIFS......................................SK.AS.......G....LSA
MDP0000160099  KAE..--.-.---------------......................................--.--.......-....---
MDP0000193196  RASt.LS.N.VKLEQG-TVTXLIEE......................................KG.--.......-....-TI
MDP0000208234  ---..--.-.---------------......................................--.--.......-....---
MDP0000251783  KGH..PK.N.LRVAIHAAVERILFS......................................SK.AS.......G....LSA
MDP0000686885  LAL..QN.G.AVLRDNMEVKGVERD......................................GV.RG.......-....---
MDP0000138851  ---..--.-.---------------......................................--.--.......-....---
MDP0000194930  AAK..EA.G.AHIVTCAEVQQLLIN......................................DS.G-.......-....-TA
MDP0000169201  ---..--.-.---------------......................................--.--.......-....---
MDP0000399642  ---..--.-.---------------......................................--.--.......-....---
MDP0000582079  ---..--.-.---------------......................................--.--.......-....---
MDP0000129765  ALPp.NL.-.--FLWGHRFLSFSIS......................................SD.KS.......-....-SV
MDP0000272655  GHP..-K.N.LRVAIHATVERIIFS......................................SK.AS.......G....LSA
MDP0000686821  ---..--.-.---------------......................................--.--.......-....---
MDP0000170414  ---..--.-.---------------......................................--.--.......-....---
MDP0000320804  ---..--.-.---------------......................................--.--.......-....---
MDP0000189790  KAS..SL.P.SVELEQGTVTSLLEE......................................KG.--.......-....-TI
MDP0000847111  ---..--.-.---------------......................................--.--.......-....---
MDP0000289536  LAL..QN.G.AVLRDNMEVKGVERD......................................--.--.......-....-RV
MDP0000123987  ---..--.-.---------------......................................--.--.......-....---
MDP0000245245  ---..--.-.---------------......................................--.--.......-....---
MDP0000188553  GATs.YK.N.LCFLSSQKVTKILYG......................................SN.--.......-....---
MDP0000296599  KAVe.DY.G.VDVVIG-KLETVGVE......................................NG.--.......-....-RV
MDP0000746652  YTSd.IA.G.RSFHNGRFIQRMRER......................................KK.G-.......-....-TI
MDP0000259265  ---..--.-.---------------......................................--.--.......-....---
MDP0000151331  KGD..PN.N.LRVAVHATVEKIIFStls...................................KK.ST.......X....LSA
MDP0000309775  HLQ..QL.G.VTIKFGTRVDDLLVD......................................NA.--.......-....-QV
MDP0000232736  ---..--.-.---------------......................................--.--.......-....---
MDP0000320539  ---..--.-.---------------......................................--.--.......-....---
MDP0000239909  ---..--.-.---------------......................................--.--.......-....---
MDP0000259264  ---..--.-.---------------......................................--.--.......-....---
MDP0000293613  TAA..VA.G.AAVLNHAEVVALLKD......................................EA.SN.......-....-RT
MDP0000253362  TAA..VA.G.AAVLNHAEVVALLKD......................................EA.SN.......-....-RT
MDP0000182973  EAE..NH.G.TTFSYNTTVIGGHIQ......................................QN.HX.......C....LHV
MDP0000138005  ---..--.-.---------------......................................--.--.......-....---
MDP0000261301  CAA..VK.G.CIQVLRMPVTALLMD......................................KE.NG.......-....-QY
MDP0000771633  RAQ..SR.G.ANLISG-LVTDLEVP......................................TS.VD.......A....P--
MDP0000851102  RAQ..SR.G.ANLISG-LVTDLEVP......................................TS.VD.......A....P--
MDP0000159873  RAS..EN.G.ATVING-LFLKMDKP......................................GD.GE.......A....PYV
MDP0000140206  ---..--.-.---------------......................................--.--.......-....---
MDP0000261201  RAS..EN.G.ATVING-LFLKMDKP......................................GD.GE.......A....PYV
MDP0000252244  RAS..EN.G.ATVING-LFLKMDKP......................................GD.GE.......A....PYV
MDP0000261821  YYK..NK.G.VQIIKGTVATGFTAD......................................SN.G-.......-....-EV
MDP0000124454  ---..--.-.---------------......................................--.--.......-....---
MDP0000234830  TAA..LA.G.AAVLNHAEVVDLLKD......................................EA.SN.......-....-RT
MDP0000297861  KVAq.LP.N.VQLEQG-TVTSLLEE......................................NG.--.......-....-TI
MDP0000152184  ---..--.-.---------------......................................--.--.......-....---
MDP0000157871  YYA..NE.G.VQMIKGTTAVGFDVD......................................TN.G-.......-....-EV
MDP0000250932  SLN..XP.N.LSIRE-AMVTDILLG......................................KN.D-.......-....-NI
MDP0000219521  ---..--.-.---------------......................................--.--.......-....---
MDP0000239289  ---..--.-.---------------......................................--.--.......-....---
MDP0000258995  ---..--.-.---------------......................................--.--.......-....---
MDP0000167343  ---..--.-.---------------......................................--.--.......-....---
MDP0000222306  ---..--.-.---------------......................................--.--.......-....---
MDP0000829384  RAA..VK.G.CIQVLRMPLTALLMD......................................KQ.TG.......-....-QY
MDP0000145663  RCL..XN.G.VQFH-RAKVWKIEHE......................................EF.ES.......-....---
MDP0000288439  AGN..PN.N.ITLLLNATVTSIIFH......................................KK.GN.......Rnv..TVV
MDP0000267350  YYQ..NK.G.VKIIKGTVATGFTAD......................................SN.G-.......-....-EV
MDP0000155608  ---..--.-.---------------......................................--.--.......-....---
MDP0000194622  KCI..SN.G.VKFH-QAKVTKVIHE......................................EE.K-.......-....---
MDP0000134271  ---..--.-.---------------......................................--.--.......-....---
MDP0000312748  AAK..EA.G.AHIVTCAEVFMSLKElglvhvsvlxlfasivclxdfvdyvfnlvlqvqqllinDS.G-.......-....-TA
MDP0000197715  AVD..-H.G.AVILTGCKAEKFVLE......................................TG.KSeskr...K....KKC
MDP0000220943  ---..--.-.---------------......................................--.--.......-....---
MDP0000320539  FYK..SK.G.VKFVKGTILSSFDID......................................SD.G-.......-....-KV
MDP0000140206  YYA..NK.G.VKIIKGTPAVSLDAD......................................TN.G-.......-....-DV
MDP0000215521  ---..--.-.---------------......................................--.--.......-....---
MDP0000203847  ISK..SL.-.PMVHCNTEVLEIRRY......................................SD.--.......-....-SV
MDP0000201011  SLP..--.-.-MVHCNTEVLAIRRY......................................SD.--.......-....-SV
MDP0000204596  ---..-E.G.LQIHLNHVVTDISYGtkdagl................................NT.--.......-....NRY
MDP0000148978  HIQ..SL.G.GEVRTNSRIQKIDLN......................................ND.G-.......-....-TV
MDP0000130369  SLT..TK.G.CKFEKGMQLTDFVLN......................................EE.TG.......-....-SI
MDP0000314606  TAA..VA.G.AAVXNHAEVVALLKD......................................EA.SN.......-....-RT
MDP0000263146  ---..--.-.---------------......................................--.--.......-....---
MDP0000250583  VLT..SR.K.VELLLGYVVRCIRKAvdaehd................................SE.--.......-....-KY
MDP0000208233  KIK..SG.E.IQVLPA-EIGSIRGG......................................--.--.......-....---
MDP0000158720  EST..RL.G.VSLQTGKAVVTASST......................................DG.GK.......-....-FL
MDP0000152184  FYK..SK.G.VKFVXGTILSXFDIA......................................SN.R-.......-....-KV
MDP0000182702  GLV..DQ.G.SQILYKANVTNIIVD......................................PG.--.......-....-RV
MDP0000261638  ---..--.-.---------------......................................--.--.......-....---
MDP0000130370  SLT..TK.G.CKFEKGMQLTDFVLN......................................EE.TG.......-....-SI
MDP0000272119  ---..--.-.---------------......................................--.--.......-....---
MDP0000305861  ---..--.-.---------------......................................--.--.......-....---
MDP0000255696  ---..--.-.---------------......................................--.--.......-....---
MDP0000214280  KGD..PN.N.LRVAVHATVEKIIFStls...................................KK.ST.......X....LSA
MDP0000210966  YAN..PT.G.LTVLLHAAVHKILF-......................................--.--.......-....---
MDP0000610999  ---..--.-.---------------......................................--.--.......-....---
MDP0000242546  ---..--.-.---------------......................................--.--.......-....---
MDP0000320742  ---..--.-.---------------......................................--.--.......-....---
MDP0000654164  ---..--.-.---------------......................................--.--.......-....---
MDP0000256300  GDL..-N.K.LRVAVQATVEKILFS......................................SK.AS.......S....SSA
MDP0000235080  LCQ..EP.G.VESKFGANVGRLEWL......................................ED.EN.......-....---
MDP0000284363  ---..--.-.---------------......................................--.--.......-....---
MDP0000125043  ---..--.-.---------------......................................--.--.......-....---
MDP0000192359  AGN..PN.S.ITLLLNATVTSIIFH......................................EK.GS.......Rye..TIV
MDP0000440005  WLK..SR.K.VEVILERSVDLDNIS......................................DG.--.......-....---
MDP0000609131  LID..XS.D.VELHLQEEIESISSN......................................GE.--.......-....---
MDP0000362000  QLT..KS.G.VRLVRG-IVKDVKDK......................................--.--.......-....---
MDP0000150210  ---..--.-.---------------......................................--.--.......-....---
MDP0000158790  KCV..ES.G.VSY-LDSRVESIVEA......................................SN.--.......-....---
MDP0000427950  ---..--.-.---------------......................................--.--.......-....---
MDP0000569169  ---..--.-.---------------......................................--.--.......-....---
MDP0000525742  ---..--.-.---------------......................................--.--.......-....---
MDP0000559829  RAAt.LP.N.VKLEQGT-VTTLLEE......................................KS.--.......-....-TI
MDP0000321788  GLV..DQ.G.SQILYKANVTNIIVD......................................PG.--.......-....-RV
MDP0000919183  HLT..KA.G.VRLMRG---------......................................--.--.......-....---
MDP0000146158  YATn.HL.-.---------------......................................--.--.......-....-TX
MDP0000832077  ---..--.-.---------------......................................--.--.......-....---
MDP0000621365  ---..--.-.---------------......................................--.--.......-....---
MDP0000875229  VLIn.PR.K.IDCQTGVFASKITLA......................................KD.GK.......Q....XT-
MDP0000251344  ---..--.-.---------------......................................--.--.......-....---
MDP0000168919  ---..--.-.-------TVTSLLEE......................................KG.--.......-....-TI
MDP0000267855  ---..--.-.---------------......................................--.--.......-....---
MDP0000195207  ---..--.-.---------------......................................--.--.......-....---
MDP0000400145  ---..--.-.---------------......................................--.--.......-....---
MDP0000919183  ---..--.-.---------------......................................--.--.......-....---
MDP0000307336  ---..--.-.---------------......................................--.--.......-....---
MDP0000263146  KFF..RD.G.IDVKTGSLVVKLTDK......................................--.--.......-....---
MDP0000309730  ---..--.-.---------------......................................--.--.......-....---
MDP0000163903  WLI..SK.N.VEVVLNESVNLNNVS......................................DG.--.......-....---
MDP0000611628  ---..--.-.---------------......................................--.--.......-....---
MDP0000119779  WLI..SK.N.VEVVLNESVNLNNVS......................................DG.--.......-....---
MDP0000120904  ---..--.-.-------TVTSLLEE......................................KG.--.......-....-TI
MDP0000150544  ---..--.-.---------------......................................--.--.......-....---
MDP0000902209  ---..--.-.---------------......................................--.--.......-....---
MDP0000269370  ---..--.-.---------------......................................--.--.......-....---
MDP0000146158  YATn.HL.-.---------------......................................--.--.......-....-TX
MDP0000124051  GNP..--.NyITPLLSAAVSSAIFH......................................KK.EA.......-....-VA
MDP0000255696  KFQ..RD.G.IDLKTGSMVVKVTDK......................................--.--.......-....-EI
MDP0000305861  KFQ..RE.G.IDLKTGSMVVKVTDK......................................E-.--.......-....--I
MDP0000611628  ---..--.-.---------------......................................--.--.......-....---
MDP0000309622  ---..--.-.---------------......................................--.--.......-....---
MDP0000239909  ---..--.-.--------------D......................................DG.--.......-....---
MDP0000126888  ---..--.-.---------------......................................--.--.......-....---
MDP0000869086  ---..--.-.---------------......................................--.--.......-....---
MDP0000317524  VISk.HE.N.LHLRPQ--IESLQED......................................GN.--.......-....---
MDP0000160099  ---..--.-.-------------QE......................................DG.--.......-....---
MDP0000251205  ---..--.-.---------------......................................--.--.......-....---
MDP0000314335  ---..--.-.---------------......................................--.--.......-....---
MDP0000638870  ---..--.-.---------------......................................--.--.......-....---
MDP0000790657  AAT..LP.N.VKLEQGT-VTTLLEE......................................KS.--.......-....-TI
MDP0000748068  ---..--.-.---------------......................................--.--.......-....---
MDP0000727481  ---..--.-.---------------......................................--.--.......-....---
MDP0000301246  ---..--.-.---------------......................................--.--.......-....---
MDP0000190684  ---..--.-.---------------......................................--.--.......-....---
MDP0000456223  ---..--.-.---------------......................................--.--.......-....---
MDP0000745172  ---..--.-.---------------......................................--.--.......-....---
MDP0000407932  ---..--.-.--------VTDILLG......................................KN.D-.......-....-NV
MDP0000440896  ---..--.D.ATTHFETTVQDVI--......................................--.--.......-....---
MDP0000694227  ---..--.-.-RLKFNKVVRELQHX......................................RN.--.......-....---
MDP0000123987  ---..--.-.-------------FD......................................QE.--.......-....---
MDP0000138005  GATs.YK.N.LCFLSSQKVTKILYG......................................SN.--.......-....-T-
MDP0000258205  RCL..SN.G.VQFH-KAKVWKIEHE......................................EF.ES.......-....---
MDP0000245245  ---..--.-.-------------FD......................................QE.--.......-....---
MDP0000306704  IVK..RM.-.----------KLEFN......................................EE.G-.......-....-KV
MDP0000478654  ---..--.-.---------------......................................--.--.......-....---
MDP0000728219  ---..--.-.---------------......................................--.--.......-....---
MDP0000170414  ---..--.-.---------------......................................--.--.......-....---
MDP0000284363  KFT..RD.G.IDVQTGCRVVSVSDK......................................EI.--.......-....---
MDP0000219560  VL-..-P.P.GLIQLGKKVRKIQWQ......................................PD.NRknkgyesD....TRL
MDP0000235930  ---..--.-.---------------......................................--.--.......-....---
MDP0000755938  ---..--.-.----------KWWFS......................................AD.--.......-....---
MDP0000138851  KIK..SG.E.IQVLP-AEIGSIRGG......................................--.--.......-....---
MDP0000261638  ---..--.D.ATTHFETTVQDVI--......................................--.--.......-....---
MDP0000317524  ---..--.-.------------QED......................................GN.--.......-....---
MDP0000294615  ---..--.D.ATTHFETTVQDVI--......................................--.--.......-....---
MDP0000208234  KIK..SG.E.IQVLPA-EIGSIRGG......................................--.--.......-....---
MDP0000216129  ---..--.-.---------------......................................--.--.......-....---
MDP0000219521  ---..--.-.GKIVFKRSTSKWWFS......................................AD.--.......-....---
MDP0000248995  ---..--.-.----F----------......................................--.--.......-....---
MDP0000256328  ---..--.-.---------------......................................--.--.......-....---
MDP0000181673  ---..--.-.-----E---------......................................--.--.......-....---
MDP0000169201  ---..--.-.---------------......................................--.--.......-....---
MDP0000263530  ---..--.-.---------------......................................--.--.......-....---
MDP0000295839  KII..AG.E.IKVVPS--ITKILRN......................................--.--.......-....---
MDP0000297466  LCV..ES.G.VS-YLDSRVESIVEA......................................SN.--.......-....---
MDP0000281982  TMK..RM.-.----------KVEFN......................................EE.G-.......-....-KV
MDP0000053966  ---..--.D.ATTHFETTVQDVI--......................................--.--.......-....---
MDP0000795740  ---..--.-.---------------......................................--.--.......-....-DV
MDP0000212327  FLNf.DI.N.VRLEQG-MVTSLLEE......................................KG.--.......-....-TV
MDP0000437365  ---..--.-.---------------......................................--.--.......-....---
MDP0000135231  ---..--.-.---------------......................................--.--.......-....---
MDP0000167343  ---..--.-.-KIVFKRSTSKWWFS......................................AD.--.......-....---
MDP0000222306  ---..--.-.-KIVFKRSTSKWWFS......................................AD.--.......-....---
MDP0000183517  ---..--.-.---------------......................................--.--.......-....---
MDP0000686821  ---..--.-.---------------......................................--.--.......-....---
MDP0000430157  ---..--.-.---------------......................................--.--.......-....---
MDP0000373054  GAT..HK.N.VTLEQGT-VTALIEE......................................KG.--.......-....-TI
MDP0000295306  ---..--.-.---H-----------......................................--.--.......-....---
MDP0000233995  ---..--.-.---------------......................................--.--.......-....---
MDP0000209681  ---..--.-.---------------......................................--.--.......-....---
MDP0000876898  ---..--.-.---------------......................................--.--.......-....---
MDP0000738522  KGN..PN.N.LRVAVHATVEKIIFS......................................SN.--.......-....---
MDP0000399642  ---..--.-.---------------......................................--.--.......-....---
MDP0000215521  ---..--.-.---------------......................................--.--.......-....---
MDP0000170521  ---..--.-.---------------......................................--.--.......-....---
MDP0000262982  KIK..SG.G.IKVVPGI--KRFXPX......................................--.--.......-....---
MDP0000321186  ---..--.-.---------------......................................--.--.......-....---
MDP0000266051  ---..--.-.---------------......................................--.--.......-....---
MDP0000837610  ---..--.-.---------------......................................--.--.......-....---
MDP0000582079  ---..--.-.---------------......................................--.--.......-....---
MDP0000538071  ---..--.-.---------------......................................--.--.......-....---
MDP0000241703  ---..--.-.---------------......................................--.--.......-....---
MDP0000671114  ---..--.-.---------------......................................--.--.......-....---
MDP0000315388  ---..--.-.---------------......................................-N.SE.......G....LSA
MDP0000134271  EA-..-D.K.GKILFKKSP-KWXFW......................................SG.--.......-....---
MDP0000297581  ---..--.-.-----------LXYD......................................ET.SG.......F....WRV
MDP0000911003  RFT..SL.G.GVMFEGYSVSGVSIY......................................ED.--.......-....---
MDP0000576650  ---..--.-.---------------......................................--.--.......-....---
MDP0000149205  ---..--.-.---------------......................................--.--.......-....---
MDP0000315409  ---..SY.D.ATTHFETTVQDVI--......................................--.--.......-....---
MDP0000320804  ---..--.-.---------------......................................--.--.......-....---
MDP0000474647  ---..--.-.---------------......................................--.--.......-....---
MDP0000566648  ---..--.-.---------------......................................--.--.......-....---
MDP0000171379  ---..--.-.---------------......................................--.--.......-....---
MDP0000814529  ---..--.-.---------------......................................--.--.......-....---
MDP0000218295  ---..--.-.---------------......................................--.--.......-....---
MDP0000220943  EAD..KG.-.-KILFK-RSSKWWFW......................................SG.--.......-....---
MDP0000795437  ---..--.-.---------------......................................--.--.......-....---
MDP0000919706  ---..--.-.---------------......................................--.--.......-....---
MDP0000295675  ---..--.-.---------------......................................--.--.......-....---
MDP0000147542  ---..--.-.---------------......................................--.--.......-....---
MDP0000272126  ---..--.-.---------------......................................--.--.......-....---
MDP0000196881  ---..--.-.---------------......................................--.--.......-....---
MDP0000268346  ---..--.-.---------------......................................--.--.......-....---
MDP0000147542  ---..--.-.---------------......................................--.--.......-....---
MDP0000948298  ---..--.-.---------------......................................--.--.......-....---
MDP0000220943  ---..--.-.---------------......................................SG.--.......-....---
MDP0000182589  ---..--.-.---------------......................................--.--.......-....---
MDP0000557870  ---..--.-.--------------N......................................SN.--.......-....---
MDP0000308870  ---..--.-.---------------......................................--.--.......-....---
MDP0000322449  ---..--.-.---------------......................................--.--.......-....---
MDP0000286494  ---..--.-.---------------......................................--.--.......-....---
MDP0000150868  ---..--.-.---------------......................................--.--.......-....---
MDP0000155608  ---..--.-.---------------......................................--.--.......-....---
MDP0000168505  ---..--.-.---------------......................................--.--.......-....---
MDP0000196888  ---..--.-.---------------......................................--.--.......-....---
MDP0000154812  ---..--.-.---------------......................................--.--.......-....---
MDP0000186080  ---..--.-.---------------......................................--.--.......-....---
MDP0000220012  ---..--.-.---------------......................................--.--.......-....---
MDP0000169409  ---..--.-.---------------......................................--.--.......-....---
MDP0000373095  ---..--.-.---------------......................................--.--.......-....---
MDP0000235846  ---..--.-.---------------......................................--.--.......-....---
MDP0000207126  ---..--.-.---------------......................................--.--.......-....---
MDP0000268357  ---..--.-.---------------......................................--.--.......-....---
MDP0000770761  ---..--.-.---------------......................................--.--.......-....---
MDP0000149067  ---..--.-.---------------......................................--.--.......-....---


                          270                                   280                                 
                            |                                     |                                 
d1cf3a1          V.GVEFGT...H.....................KGN.......THNVYAKH.....EVLLAAG.S..................
MDP0000813172  Q.GVIALNm..E.....................DGT.......LHRFQASS.....-TILATG.G..................
MDP0000251581  Q.GVIALNm..E.....................DGT.......LHRFQASS.....-TILATG.G..................
MDP0000188391  Q.GVIALNm..E.....................DGT.......LHRFQASS.....-TILATG.G..................
MDP0000254144  -.GVEVI-...A.....................GDQ.......--VFRGDM.....-VLCTVP.L..................
MDP0000321972  M.-VTI--...E.....................DGR.......--NFIADA.....-AIITVP.Hgilkakliefvpqlpewk
MDP0000299806  -.GVLVY-...A.....................NGQ.......--EFRGDM.....-VLCTVP.L..................
MDP0000283451  -.GVLVY-...A.....................NGQ.......--EFRGDM.....-VLCTVP.L..................
MDP0000296714  N.KVKVST...S.....................NGS.......--DFSGDA.....-ILITVP.L..................
MDP0000162193  -.-VKVST...S.....................NGN.......--DFSGDA.....-VLVTVP.L..................
MDP0000769741  -.GVKVTV...E.....................DGR.......--TFVADA.....-AVVAVP.L..................
MDP0000295277  -.GVKLTLepaS.....................GGD.......QTSFEADV.....-VLVSAG.R..................
MDP0000897124  -.GVKLTLepaS.....................GGD.......QTSFEADV.....-VLVSAG.R..................
MDP0000854208  L.GVDTLNt..E.....................TQE.......VIRFISKV.....-TLLASG.Gagqiyptttnppvatgdg
MDP0000241767  N.KVKVST...S.....................NGS.......--DFSGDA.....-ILITVP.L..................
MDP0000318858  G.RFQFKE...I.....................EGS.......EEILEADL.....-VLLAMG.F..................
MDP0000248995  V.GVT---...S.....................EGE.......--TAKCKK.....-VVCDPS.Y..................
MDP0000442206  G.RFQFNE...I.....................EGS.......EEILEADL.....-VLLAMG.F..................
MDP0000181673  I.GVT---...S.....................EGE.......--TAKCKK.....-VVCDPS.Y..................
MDP0000315409  I.GVT---...S.....................EGE.......--TAKCKK.....-VVC---.-..................
MDP0000053966  I.GVT---...S.....................EGE.......--TAKCKK.....-VVCD--.-..................
MDP0000294615  I.GVT---...S.....................EGE.......--TAKCKK.....-VVCD--.-..................
MDP0000306147  N.KVKVST...S.....................NGS.......--DFSGDA.....-ILITVP.L..................
MDP0000180064  V.GVRL--...S.....................DGR.......--EFFAKT.....-IISNAT.R..................
MDP0000261625  -.GVTVMT...E.....................DGC.......--VFQANY.....-MILSVS.I..................
MDP0000300208  -.GIKVRT...D.....................HGE.......--ELIADV.....-VLFATG.R..................
MDP0000247171  -.-ISVIHm..G.....................DGT.......--IIKAKI.....-LIGCDG.I..................
MDP0000308095  T.GFSMSRa..T.....................NKK.......--IVTADA.....-YVAACD.V..................
MDP0000319421  V.-LQL--...Q.....................DGT.......--ILNPKV.....-VIGCDG.V..................
MDP0000232295  R.GIRFIK...Sngnsseiyeahlnqpenscs.GGD.......--------.....-VILAAG.A..................
MDP0000188994  K.LVHX--...A.....................DGT.......--ILKAKV.....-LVGCDG.V..................
MDP0000159189  K.LVHX--...A.....................DGT.......--ILKAKV.....-LVGCDG.V..................
MDP0000656178  V.TIELIDa..K.....................TKEp......KETLEVDA.....-ALIATG.R..................
MDP0000910523  S.VIHL--...G.....................DGT.......--IIKAKV.....-LIGCDG.I..................
MDP0000119941  -.GVKLTLepaS.....................GGD.......QTSFEADV.....-VLVSAG.R..................
MDP0000231799  -.TIDLIDa..K.....................TKEp......KETLEVDA.....-ALIATG.R..................
MDP0000255025  A.GFSMSKa..T.....................NKK.......--VVKADA.....-YVAACD.V..................
MDP0000231632  S.SAAK--...D.....................DKH.......SQSLSVDA.....-VVMTAP.L..................
MDP0000173300  L.GVMAKPl..S.....................NNItk.....RLQIEAKV.....-TISACG.A..................
MDP0000158474  V.GVIFKDe..K.....................GNQ.......HQALLADKpqs..EVILSTG.A..................
MDP0000276878  -.GCTVIS...G.....................DGL.......--EEVFNG.....-CIIAVH.X..................
MDP0000154720  -.------...-.....................---.......--------.....-------.-..................
MDP0000549646  G.GVVTNW...Alvsmnhdtqscm.........DPN.......--VMEAKV.....-VVSSCG.H..................
MDP0000158853  V.KLHF--...S.....................DGS.......--VLLAXH.....-VII---.-..................
MDP0000702799  V.KLHF--...S.....................DGS.......--VLLAXH.....-VII---.-..................
MDP0000233110  L.GVQATS...X.....................SKNikr....KLKIEAKV.....-TISACG.S..................
MDP0000260827  K.GVQYKT...K.....................TGE.......EMTAYAPL.....-TVVCDG.C..................
MDP0000941459  V.KLHF--...S.....................DGS.......--VLLADH.....-VIVTVS.L..................
MDP0000185338  V.GVVFRD...S.....................VGRyh.....HAVLREHG.....EVILSAG.A..................
MDP0000451172  Y.GVIYRD...A.....................HGI.......RHYAYLKMnskknEIILSAG.A..................
MDP0000136847  K.GIIYTD...S.....................NGRsh.....QALIRGKG.....EVILSAG.A..................
MDP0000177641  R.GIRFIK...SdgsssqtheaylntqnnsrssTGD.......--------.....-VILAAG.A..................
MDP0000413935  K.GVQYKT...K.....................TGE.......EMTAYAPL.....-TIVCDG.C..................
MDP0000206098  G.GVVTNW...Alvsmnhdtqscm.........DPN.......--VMEAKV.....-VVSSCG.H..................
MDP0000845788  S.GILIRKl..D.....................SGE.......KSVIEAKG.....-LFYGIG.H..................
MDP0000465595  G.GIRFIK...Sngnssetyeahlnqtenscs.RG-.......--------.....DVILAAA.A..................
MDP0000137211  K.GIIYND...S.....................NGRsh.....WASIRGKG.....EVILSAG.A..................
MDP0000130099  R.GVIFKD...S.....................NGI.......SHRSYVRNqg...EVILSAG.T..................
MDP0000425135  A.GVVFRD...R.....................VGRyh.....HAVLREHG.....EVILSAG.A..................
MDP0000200780  -.------...-.....................---.......--------.....-------.-..................
MDP0000142434  -.SYPTLQl..H.....................NGS.......--TIKAXV.....-VIGCDG.T..................
MDP0000248951  K.GIIYTD...S.....................YGRsh.....QALIRGKG.....EVILSAG.A..................
MDP0000869086  -.------...-.....................---.......--------.....-------.-..................
MDP0000318256  K.GIIYSD...S.....................NGRsh.....RALIRGKG.....EVILSAG.A..................
MDP0000231634  S.SAAK--...D.....................DKH.......SQSLSVDA.....-VVMTAP.L..................
MDP0000626995  G.GVVTNW...Alvsmnhdtqscm.........DPN.......--VMEAKV.....-VVSSCG.H..................
MDP0000123832  -.-ISVIHm..G.....................DGT.......--IIKAKI.....-LIGCDG.I..................
MDP0000236092  G.GVVTNW...Alvsmnhdtqscm.........DPN.......--VMEAKV.....-VVSSCG.H..................
MDP0000199159  -.------...-.....................---.......--------.....-------.-..................
MDP0000162755  K.LVHL--...A.....................DGT.......--VLKAKV.....-LVGCDG.V..................
MDP0000173666  S.SAAK--...D.....................DKH.......SQSLSVDA.....-VVMTAP.L..................
MDP0000262982  -.------...-.....................---.......--------.....-------.-..................
MDP0000184832  H.EAYLNT...Q.....................NNS.......--RSSTGD.....-VILAAG.A..................
MDP0000598927  -.QVAT--...G.....................DGI.......AMAHRAQA.....-VISNME.F..................
MDP0000561228  T.GVIYKD...S.....................NGI.......SHRAYVRDqg...EVILSAG.T..................
MDP0000175650  S.-VTASFl..K.....................DGKrm.....ERNIRCNI.....-LVGTDG.A..................
MDP0000233802  A.GLKVKNv..V.....................TGE.......VSDFKVSG.....-LFFAIG.H..................
MDP0000321186  -.------...-.....................---.......--------.....-------.-..................
MDP0000161955  K.GVMYKN...K.....................AGD.......EMRSYAPL.....-TIVCDG.C..................
MDP0000213381  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000168437  K.GVQYK-...S.....................KGXdl.....ELSAHAPL.....-TIVCDG.C..................
MDP0000823251  A.GLKVKNv..V.....................TGE.......VSDFKVSG.....-LFFAIG.H..................
MDP0000191389  K.GVMYKN...R.....................AGE.......EMRSYAPL.....-TIVCDG.C..................
MDP0000199319  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000857446  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000266638  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000208936  L.GVQATS...L.....................SKNikr....KLQIEANV.....-TISACG.S..................
MDP0000202883  K.GVLYKN...R.....................AGK.......EMRSYAPL.....-TIVCDG.C..................
MDP0000288439  R.GIRFIK...SdgsssqtheaylntqnnsrssTGD.......--------.....-VILAAG.A..................
MDP0000295839  -.------...-.....................---.......--------.....-------.-..................
MDP0000903805  K.GIIYSD...S.....................NGRsh.....RALIRGKG.....EVILSAG.A..................
MDP0000202123  -.SLSLKT...N.....................KGT.......--IEGFSH.....-IMFATG.R..................
MDP0000227773  -.--FV--...-.....................---.......--EEVFDA.....-VVVASG.H..................
MDP0000317524  -.------...-.....................---.......--------.....-------.-..................
MDP0000320748  Q.GVMYKN...K.....................AGE.......EMXTYAPL.....-TIVCDG.C..................
MDP0000634676  R.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000235846  A.GLKVKNv..V.....................TGE.......VSDLKVSG.....-LFFAIG.H..................
MDP0000251344  A.GLKVKNv..V.....................TGE.......VSDLKVSG.....-LFFAIG.H..................
MDP0000501957  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000209681  -.------...-.....................---.......--------.....-------.-..................
MDP0000293482  I.-VKASSh..Q.....................TNE.......IIEIVGDL.....-LVAADG.C..................
MDP0000233995  -.------...-.....................---.......--------.....-------.-..................
MDP0000257243  K.GIIYSD...S.....................NGRsh.....RALIRGKG.....EVILSAX.A..................
MDP0000160099  -.-IFV--...-.....................---.......--EEVFDA.....-VVVASG.H..................
MDP0000193196  K.GVMYKN...K.....................AGE.......EMRTYAPL.....-TIVCDG.C..................
MDP0000208234  -.------...-.....................---.......--------.....-------.-..................
MDP0000251783  K.GIIYSD...L.....................NGRsh.....RALIRGKG.....EVILSAG.A..................
MDP0000686885  -.GVWVST...A.....................KGK.......--RFWGKX.....-CVVTVG.A..................
MDP0000138851  -.------...-.....................---.......--------.....-------.-..................
MDP0000194930  D.GVLL--...T.....................DGS.......--QVHSSI.....-VLSNAT.P..................
MDP0000169201  -.------...-.....................---.......--------.....-------.-..................
MDP0000399642  -.------...-.....................---.......--------.....-------.-..................
MDP0000582079  -.------...-.....................---.......--------.....-------.-..................
MDP0000129765  I.-VKASSh..E.....................TNE.......XIEIIGDL.....-LIAADG.C..................
MDP0000272655  K.GIIYSD...S.....................NGRsh.....RALIRGKG.....EVILSAG.E..................
MDP0000686821  -.------...-.....................---.......--------.....-------.-..................
MDP0000170414  -.------...-.....................---.......--------.....-------.-..................
MDP0000320804  -.------...-.....................---.......--------.....-------.-..................
MDP0000189790  K.GVKFRR...K.....................GSQ.......EFTAHAPL.....-TIVCDG.C..................
MDP0000847111  -.------...-.....................---.......--------.....-------.-..................
MDP0000289536  RgGVWVCT...A.....................NGE.......--RFWGKK.....-CVVTVG.A..................
MDP0000123987  -.------...-.....................---.......--------.....-------.-..................
MDP0000245245  -.------...-.....................---.......--------.....-------.-..................
MDP0000188553  -.TVMXTI...E.....................DGR.......--NFIADA.....-AIITVP.Hgilkanliefepqlpewk
MDP0000296599  N.SVVL--...E.....................GGR.......--VIDSDA.....-VVLAMG.P..................
MDP0000746652  K.GVMYKN...K.....................AGE.......EMRSYAPL.....-TIVCDG.C..................
MDP0000259265  -.------...-.....................---.......--------.....-------.-..................
MDP0000151331  T.GVIYRD...S.....................NGRsh.....RALVHDKG.....EIILSSG.T..................
MDP0000309775  V.GVXVSD...S.....................ADN.......SQKWGYDA.....-VVLAVG.H..................
MDP0000232736  -.------...-.....................---.......--------.....-------.-..................
MDP0000320539  -.------...-.....................---.......--------.....-------.-..................
MDP0000239909  -.------...-.....................---.......--------.....-------.-..................
MDP0000259264  -.------...-.....................---.......--------.....-------.-..................
MDP0000293613  I.GARIRDn..L.....................SGK.......EFDIYAKV.....-VVNAAG.P..................
MDP0000253362  I.GARIRDn..L.....................SGK.......EFDIYAKV.....-VVNAAG.P..................
MDP0000182973  S.GTKTLEn..W.....................--NrkfplqpEMILIPKL.....-VVNSAG.L..................
MDP0000138005  -.------...-.....................---.......--------.....-------.-..................
MDP0000261301  K.GVRL--...A.....................SGE.......E-------.....-------.-..................
MDP0000771633  -.YVISYT...A.....................DNK.......RESLAVDV.....-VIGADG.A..................
MDP0000851102  -.YVISYT...A.....................DNK.......RESLAVDV.....-VIGADG.A..................
MDP0000159873  L.HYTE--...Y.....................DGKaggigv.KKTMEVDA.....-VIGADG.A..................
MDP0000140206  -.------...-.....................---.......--------.....-------.-..................
MDP0000261201  L.HYTE--...Y.....................DGKaggagv.KKTMEVDA.....-VIGADG.A..................
MDP0000252244  L.HYTE--...Y.....................DGKaggagv.KKTMEVDA.....-VIGADG.A..................
MDP0000261821  K.EVHL--...K.....................DGT.......--XLEADI.....-VVVGVX.G..................
MDP0000124454  -.------...-.....................---.......--------.....-------.-..................
MDP0000234830  I.GARIRDn..L.....................SGK.......EFNTYAKV.....-VVNAAG.P..................
MDP0000297861  K.GVQYKP...K.....................DGQ.......ELKVYAPL.....-TIVCDG.C..................
MDP0000152184  -.------...-.....................---.......--------.....-------.-..................
MDP0000157871  K.AVKL--...K.....................DGR.......--VLQADI.....-VVVGVG.A..................
MDP0000250932  E.GVQT--...F.....................FGM.......--NFYAPS.....-VILTTG.T..................
MDP0000219521  -.------...-.....................---.......--------.....-------.-..................
MDP0000239289  -.------...-.....................---.......--------.....-------.-..................
MDP0000258995  -.------...-.....................---.......--------.....-------.-..................
MDP0000167343  -.------...-.....................---.......--------.....-------.-..................
MDP0000222306  -.------...-.....................---.......--------.....-------.-..................
MDP0000829384  K.GVRL--...A.....................SGE.......--EIFSHQ.....-------.-..................
MDP0000145663  -.SILC--...D.....................DGN.......--ELKASL.....-IVDASG.Fassfieyekprnhgyqia
MDP0000288439  R.GIRFIK...SdgsssqtheaylntqnnsrssTGD.......--------.....-VILAAG.A..................
MDP0000267350  K.EVHL--...K.....................DGT.......--VLEADI.....-VVVGVG.G..................
MDP0000155608  -.------...I.....................DGN.......--SLYAKL.....-VVGADG.S..................
MDP0000194622  -.-SLLTC...N.....................DGV.......--TIQASV.....-VLDATG.Fsrclvqydkpynpgyqva
MDP0000134271  -.------...-.....................---.......--------.....-------.-..................
MDP0000312748  D.GVLL--...T.....................DGS.......--QVHSSI.....-VLSNAT.P..................
MDP0000197715  L.EVMAKA...L.....................SNIitk....RLQIEAKV.....-TVSACG.A..................
MDP0000220943  -.------...-.....................---.......--------.....-------.-..................
MDP0000320539  T.AVNL--...R.....................DGS.......--SLPADM.....-VVVGIG.I..................
MDP0000140206  K.AVKL--...K.....................DGR.......--VLQADI.....-VVVGVG.A..................
MDP0000215521  -.------...-.....................---.......--------.....-------.-..................
MDP0000203847  X.-VVVKS...C.....................DGE.......VKSMEFDK.....-IIISGS.F..................
MDP0000201011  S.-VDVKS...C.....................DGE.......VKALEFDK.....-IIISGS.F..................
MDP0000204596  N.KVKVST...S.....................NGS.......--DFSGDA.....-ILITVP.L..................
MDP0000148978  K.SFVL--...N.....................NGS.......--VIEADA.....-YVFATP.V..................
MDP0000130369  S.EVVC--...N.....................GG-.......--VYNADA.....-VVLAIG.I..................
MDP0000314606  I.GARIRDn..L.....................SGK.......EFDIYAKV.....-VVNAAG.P..................
MDP0000263146  -.------...-.....................---.......--------.....-------.-..................
MDP0000250583  I.-LELQPa..Qr....................GSQ.......SQTVEADL.....-VLWTVG.N..................
MDP0000208233  -.QVEL--...K.....................NGK.......--SYPFDA.....-IIFCTG.F..................
MDP0000158720  L.GVENRTf..S.....................SPE.......--YVEADY.....-LLIASG.N..................
MDP0000152184  T.AVNL--...R.....................DGS.......--SLPADV.....-VVVGIG.I..................
MDP0000182702  V.GVRL--...S.....................DGR.......--EFFAKT.....-IISNAT.R..................
MDP0000261638  -.------...-.....................---.......--------.....-------.-..................
MDP0000130370  S.EVVC--...N.....................GG-.......--VYNADA.....-VVLAIG.I..................
MDP0000272119  -.------...-.....................---.......--------.....-------.-..................
MDP0000305861  -.------...-.....................---.......--------.....-------.-..................
MDP0000255696  -.------...-.....................---.......--------.....-------.-..................
MDP0000214280  T.GVIYRD...S.....................NGRsh.....RALVHDKG.....EIILSSG.T..................
MDP0000210966  -.------...-.....................---.......--------.....-------.-..................
MDP0000610999  -.------...-.....................---.......--------.....-------.-..................
MDP0000242546  -.------...-.....................---.......--------.....-------.-..................
MDP0000320742  -.------...-.....................---.......--------.....-------.-..................
MDP0000654164  -.------...-.....................---.......--------.....-------.-..................
MDP0000256300  I.GIMYSD...S.....................NGRsh.....CAYVRRKW.....EAVLSAG.A..................
MDP0000235080  -.------...-.....................---.......--------.....-------.-..................
MDP0000284363  -.------...-.....................---.......--------.....-------.-..................
MDP0000125043  -.------...-.....................---.......--------.....-------.-..................
MDP0000192359  R.GIRFIK...SdgsssqtheaylntqnnsrssTGD.......--------.....-VILAAG.A..................
MDP0000440005  -.CKTYKT...S.....................EGE.......--TLTADC.....-HFLCTGkR..................
MDP0000609131  -.YYELNS...-.....................-TL.......RNSYTCDI.....-AVVASP.L..................
MDP0000362000  -.KIIL--...N.....................DGT.......--EVPYGL.....-LVWSTG.V..................
MDP0000150210  -.------...-.....................---.......--------.....-------.-..................
MDP0000158790  -.GISLV-...S.....................CGH.......NIVVSCRL.....-ATVASG.A..................
MDP0000427950  -.------...-.....................---.......--------.....-------.-..................
MDP0000569169  -.------...-.....................---.......--------.....-------.-..................
MDP0000525742  -.------...-.....................---.......--------.....-------.-..................
MDP0000559829  K.GVMYKN...K.....................TGE.......EMRTYAPL.....TIIEN--.-..................
MDP0000321788  V.GVRL--...S.....................DGR.......--EFFAKT.....-IISNAT.R..................
MDP0000919183  -.------...-.....................--V.......VKEVHPKK.....-IVLNDG.T..................
MDP0000146158  V.GVRL--...M.....................RGV.......VKEVHPKK.....-IVLNDG.T..................
MDP0000832077  -.------...-.....................---.......--------.....-------.-..................
MDP0000621365  -.------...-.....................---.......--------.....-------.-..................
MDP0000875229  -.-IELIDa..K.....................TKEp......KXTLEVDA.....-SLIATG.R..................
MDP0000251344  -.------...-.....................---.......--------.....-------.-..................
MDP0000168919  K.GVKFRR...K.....................GSQ.......XFTAHAPL.....-TIVCDG.C..................
MDP0000267855  -.------...-.....................---.......--------.....-------.-..................
MDP0000195207  -.------...-.....................---.......--------.....-------.-..................
MDP0000400145  -.------...-.....................---.......--------.....-------.-..................
MDP0000919183  -.------...-.....................---.......--------.....-------.-..................
MDP0000307336  -.------...-.....................---.......--------.....-------.-..................
MDP0000263146  -.EVSAKDr..D.....................TGK.......ISNIPYGM.....-VLWATG.I..................
MDP0000309730  -.------...-.....................---.......--------.....-------.-..................
MDP0000163903  -.FIQT--...S.....................SGE.......--VIAADC.....HFVCTAK.P..................
MDP0000611628  V.GVRL--...M.....................RGV.......VKEVHPKK.....-IVLNDG.T..................
MDP0000119779  -.FIQT--...S.....................SGE.......--VIAADC.....HFVCTAK.P..................
MDP0000120904  K.GVKFRR...K.....................GSQ.......EFTAHAPL.....-TIVCDG.C..................
MDP0000150544  -.------...-.....................---.......--------.....-------.-..................
MDP0000902209  -.------...-.....................---.......--------.....-------.-..................
MDP0000269370  -.------...-.....................---.......----FANA.....EVILSAG.T..................
MDP0000146158  V.GVRL--...M.....................RGV.......VKEVHPKK.....-IVLNDG.T..................
MDP0000124051  R.GIRFIK...SdgsssqtyeaylnprknsrssTGD.......--------.....-VILAAG.A..................
MDP0000255696  F.TKELK-...N.....................GGE.......VSAMPYGM.....-ALWSTG.I..................
MDP0000305861  F.TKEMK-...N.....................GGE.......VSAMPYGM.....-ALWSTG.I..................
MDP0000611628  -.------...-.....................---.......--------.....-------.-..................
MDP0000309622  -.------...-.....................---.......--------.....-------.-..................
MDP0000239909  -.SVVF--...K.....................DGS.......--VVLADT.....-ILHCTG.Y..................
MDP0000126888  -.------...-.....................---.......--------.....-------.-..................
MDP0000869086  -.-VLF--...V.....................DGS.......--WVIADT.....-IMYCTG.Y..................
MDP0000317524  -.-VLF--...V.....................DGS.......--WVIADT.....-IIYCTG.Y..................
MDP0000160099  -.KVLF--...V.....................DGS.......--WITADT.....-IIYCTG.Y..................
MDP0000251205  -.------...-.....................---.......--------.....-------.-..................
MDP0000314335  -.------...-.....................---.......--------.....-------.-..................
MDP0000638870  -.------...-.....................---.......--------.....-------.-..................
MDP0000790657  K.GVMYKN...K.....................TGX.......EMRTYAPL.....-TIVCDG.C..................
MDP0000748068  -.------...-.....................---.......--------.....-------.-..................
MDP0000727481  -.------...-.....................---.......--------.....-------.-..................
MDP0000301246  -.------...-.....................---.......--------.....-------.-..................
MDP0000190684  -.------...V.....................DGS.......--WIIADT.....-IIYCTG.Y..................
MDP0000456223  -.------...-.....................---.......--------.....-------.-..................
MDP0000745172  -.------...-.....................---.......--------.....-------.-..................
MDP0000407932  E.GVRT--...F.....................FGM.......--NFYSPS.....-VILTTG.T..................
MDP0000440896  -.------...-.....................---.......--------.....-------.-..................
MDP0000694227  -.GVTVMT...E.....................DGC.......--IFQANY.....-MILSVS.Igvlqsdliafnpplpesk
MDP0000123987  -.GILV--...-.....................EGE.......ASPLQTDL.....-VILATG.F..................
MDP0000138005  -.-VMATI...E.....................DGR.......--NFIADA.....-AIITVP.-..................
MDP0000258205  -.SILC--...D.....................DEN.......--EFKASL.....-IVDASG.F..................
MDP0000245245  -.GILV--...-.....................EGE.......ASPLQTDL.....-VILATG.F..................
MDP0000306704  I.GVTY--...-.....................EGE.......--TTKCKK.....-VVCD--.-..................
MDP0000478654  -.------...-.....................---.......--------.....-------.-..................
MDP0000728219  -.------...-.....................---.......--------.....-------.-..................
MDP0000170414  -.------...-.....................-GE.......VSPVKTDX.....-VILATG.F..................
MDP0000284363  T.-MKVK-...S.....................KGE.......VCSIPHGL.....-VVWSTG.X..................
MDP0000219560  V.KLHF--...S.....................DGS.......--VLLADH.....-VIVTVS.-..................
MDP0000235930  -.------...-.....................---.......--------.....-------.-..................
MDP0000755938  -.GIEF--...D.....................DNT.......--KIKADV.....-VVLATG.Y..................
MDP0000138851  -.QVEL--...K.....................NGK.......--SYQFDA.....-IIFCTG.F..................
MDP0000261638  -.------...-.....................---.......--------.....-------.-..................
MDP0000317524  -.-VLF--...V.....................DGS.......--WVIADT.....-IIYCTG.Y..................
MDP0000294615  -.------...-.....................---.......--------.....-------.-..................
MDP0000208234  -.QVEL--...K.....................NGK.......--SYQFDA.....-IILCTG.F..................
MDP0000216129  -.------...-.....................---.......--------.....-------.-..................
MDP0000219521  -.GIEF--...D.....................DNT.......--KIKADV.....-VVLATG.Y..................
MDP0000248995  -.------...-.....................---.......--------.....-------.-..................
MDP0000256328  -.------...-.....................---.......--------.....-------.-..................
MDP0000181673  -.------...-.....................---.......--------.....-------.-..................
MDP0000169201  -.------...-.....................-GE.......VSPVKTDV.....-MILATG.F..................
MDP0000263530  -.------...-.....................---.......--------.....-------.-..................
MDP0000295839  -.QIKF--...E.....................NGY.......--SNHYDA.....-IVFATG.Y..................
MDP0000297466  -.GISLV-...A.....................CGH.......IIVVSCRL.....-ATVASG.A..................
MDP0000281982  I.GVT---...S.....................EGE.......--TAKCKK.....-VVCDP-.-..................
MDP0000053966  -.------...-.....................---.......--------.....-------.-..................
MDP0000795740  V.AIKT--...S.....................RN-.......--TLHCKK.....AIVVAAG.C..................
MDP0000212327  K.GVQYKFk..G.....................SDL.......ELNAHAPL.....-TIVGDG.C..................
MDP0000437365  -.------...-.....................---.......--------.....-------.-..................
MDP0000135231  -.------...-.....................---.......--------.....-------.-..................
MDP0000167343  -.GIEF--...D.....................DNT.......--KIKADV.....-VVLATG.Y..................
MDP0000222306  -.GIEF--...D.....................DNT.......--KIKADV.....-VVLATG.Y..................
MDP0000183517  -.------...-.....................---.......--------.....-------.-..................
MDP0000686821  -.------...-.....................---.......--------.....-------.-..................
MDP0000430157  -.------...-.....................---.......--------.....-------.-..................
MDP0000373054  K.GVTYKN...K.....................AGE.......EMRSYVPL.....-TIVCDG.C..................
MDP0000295306  -.------...-.....................---.......--------.....-------.-..................
MDP0000233995  -.------...-.....................---.......--------.....-------.-..................
MDP0000209681  -.------...-.....................---.......--------.....-------.-..................
MDP0000876898  -.------...-.....................---.......--------.....-------.-..................
MDP0000738522  -.------...-.....................---.......--------.....-------.-..................
MDP0000399642  -.------...-.....................---.......--------.....-------.-..................
MDP0000215521  -.GIEF--...E.....................DNT.......--KLQADV.....-VXLATG.Y..................
MDP0000170521  -.------...-.....................---.......--------.....-------.-..................
MDP0000262982  -.QVEL--...V.....................NGE.......--TLEIDS.....-VVLATG.Y..................
MDP0000321186  -.------...-.....................---.......--------.....-------.-..................
MDP0000266051  -.------...-.....................---.......--------.....-------.-..................
MDP0000837610  -.------...-.....................---.......--------.....-------.-..................
MDP0000582079  -.------...-.....................---.......--------.....-------.-..................
MDP0000538071  -.------...-.....................---.......--------.....-------.-..................
MDP0000241703  -.------...-.....................---.......--------.....-------.-..................
MDP0000671114  -.------...-.....................---.......--------.....-------.-..................
MDP0000315388  I.GIMYSD...S.....................NGRsh.....CAFVRSKA.....EVLLSAS.A..................
MDP0000134271  -.GIEF--...E.....................DNT.......--KLEADV.....-VLLATG.Y..................
MDP0000297581  K.TVTSTE...S.....................TRS.......EVEYICRW.....-LIVAIG.E..................
MDP0000911003  -.AAVLQL...N.....................EEK.......--ILSSRL.....-IIDAMG.N..................
MDP0000576650  -.------...-.....................---.......--------.....-------.-..................
MDP0000149205  -.------...-.....................---.......--------.....-------.-..................
MDP0000315409  -.------...-.....................---.......--------.....-------.-..................
MDP0000320804  -.------...-.....................NGE.......SSPVKSDL.....-IILATG.F..................
MDP0000474647  -.------...-.....................---.......--------.....-------.-..................
MDP0000566648  -.------...-.....................---.......--------.....-------.-..................
MDP0000171379  -.------...-.....................---.......--------.....-------.-..................
MDP0000814529  -.------...-.....................---.......--------.....-------.-..................
MDP0000218295  -.------...-.....................---.......--------.....-------.-..................
MDP0000220943  -.GIEF--...E.....................DNT.......--KLQADV.....-VILATG.Y..................
MDP0000795437  -.------...-.....................---.......--------.....-------.-..................
MDP0000919706  -.------...-.....................---.......--------.....-------.-..................
MDP0000295675  -.------...-.....................---.......--------.....-------.-..................
MDP0000147542  -.------...-.....................---.......--------.....-------.-..................
MDP0000272126  -.------...-.....................---.......--------.....-------.-..................
MDP0000196881  -.------...-.....................---.......--------.....-------.-..................
MDP0000268346  -.------...-.....................---.......--------.....-------.-..................
MDP0000147542  -.------...-.....................---.......--------.....-------.-..................
MDP0000948298  -.------...-.....................---.......--------.....-------.-..................
MDP0000220943  -.GIEF--...E.....................DNT.......--KLQADV.....-VILATG.Y..................
MDP0000182589  -.------...-.....................---.......--------.....-------.-..................
MDP0000557870  -.SVEF--...N.....................NGA.......--RQSFDA.....-ILLATG.Y..................
MDP0000308870  -.------...-.....................---.......--------.....-------.-..................
MDP0000322449  -.------...-.....................---.......--------.....-------.-..................
MDP0000286494  -.------...-.....................---.......--------.....-------.-..................
MDP0000150868  -.------...-.....................---.......--------.....-------.-..................
MDP0000155608  -.---L--...I.....................DGN.......--SLYAKL.....-VVGADG.S..................
MDP0000168505  -.------...-.....................---.......--------.....-------.-..................
MDP0000196888  -.------...-.....................---.......--------.....-------.-..................
MDP0000154812  -.------...-.....................---.......--------.....-------.-..................
MDP0000186080  -.------...-.....................---.......--------.....-------.-..................
MDP0000220012  -.------...-.....................---.......--------.....-------.-..................
MDP0000169409  -.------...-.....................---.......--------.....-------.-..................
MDP0000373095  -.------...-.....................---.......--------.....-------.-..................
MDP0000235846  -.------...-.....................---.......--------.....-------.-..................
MDP0000207126  -.------...-.....................---.......--------.....-------.-..................
MDP0000268357  -.------...-.....................---.......--------.....-------.-..................
MDP0000770761  -.------...-.....................---.......--------.....-------.-..................
MDP0000149067  -.------...-.....................---.......--------.....-------.-..................


                                                                      290             300           
                                                                        |               |           
d1cf3a1          .......................................................AVSPTIL.....EYS.GI..........
MDP0000813172  .......................................................YGRAYFS.....ATS.AHtctgd.....
MDP0000251581  .......................................................YGRAYFS.....ATS.AHtctgd.....
MDP0000188391  .......................................................YGRAYFS.....ATS.AHtctgd.....
MDP0000254144  .......................................................-------.....---.--..........
MDP0000321972  ................................vaaisdlgvgnenkvalrfekxfWPNVELL.....G--.--..........
MDP0000299806  .......................................................-------.....---.--..........
MDP0000283451  .......................................................-------.....---.--..........
MDP0000296714  .......................................................G------.....---.--..........
MDP0000162193  .......................................................G------.....---.--..........
MDP0000769741  .......................................................-------.....---.--..........
MDP0000295277  .......................................................VPFTSGL.....DLD.KIgvemdkg...
MDP0000897124  .......................................................VPFTSGL.....DLD.KIgvemdkg...
MDP0000854208  ...................................................iamaH------.....---.--..........
MDP0000241767  .......................................................G------.....---.--..........
MDP0000318858  .......................................................LG-PEAT.....VAE.KLglerdqrs..
MDP0000248995  .......................................................-------.....---.--..........
MDP0000442206  .......................................................LG-PEAT.....VAE.KLglerdqrs..
MDP0000181673  .......................................................-------.....---.--..........
MDP0000315409  .......................................................-------.....---.--..........
MDP0000053966  .......................................................-------.....---.--..........
MDP0000294615  .......................................................-------.....---.--..........
MDP0000306147  .......................................................G------.....---.--..........
MDP0000180064  .......................................................WNTFGKL.....IKA.DQ..........
MDP0000261625  .......................................................G------.....---.--..........
MDP0000300208  .......................................................SPNTKRL.....NLA.AV..........
MDP0000247171  .......................................................HSVVARW.....LGL.AEpvysgrwavr
MDP0000308095  .......................................................PGIKRLL.....-PS.QW..........
MDP0000319421  .......................................................N------.....---.--..........
MDP0000232295  .......................................................LGSPQIL.....LLS.GI..........
MDP0000188994  .......................................................NSVVAKW.....LGF.KQpaftgrsair
MDP0000159189  .......................................................NSVVAKW.....LGF.KQpaftgrsair
MDP0000656178  .......................................................APFTQGL.....GLE.NV..........
MDP0000910523  .......................................................HSVVGRSl....GLA.EPvyagrsgvr.
MDP0000119941  .......................................................VPFTSGL.....DLD.KIgvemdkg...
MDP0000231799  .......................................................APFTQGL.....GLE.NV..........
MDP0000255025  .......................................................PGIKRLL.....-PS.QW..........
MDP0000231632  .......................................................C------.....---.--..........
MDP0000173300  .......................................................LLTPPLM.....LSS.GL..........
MDP0000158474  .......................................................IGSPQML.....LLS.GI..........
MDP0000276878  .......................................................PDAVRIL.....GDQ.AT..........
MDP0000154720  .......................................................-------.....---.--..........
MDP0000549646  .......................................................DG-----.....---.--..........
MDP0000158853  .......................................................-------.....---.--..........
MDP0000702799  .......................................................-------.....---.--..........
MDP0000233110  .......................................................LLTPPLM.....ISS.GL..........
MDP0000260827  .......................................................FSNLRRT.....LCD.--..........
MDP0000941459  .......................................................-------.....---.--..........
MDP0000185338  .......................................................IGSPQLL.....LLS.GI..........
MDP0000451172  .......................................................IGSPQLL.....MLS.GV..........
MDP0000136847  .......................................................IGSPQLL.....LLS.GV..........
MDP0000177641  .......................................................LGSPQIL.....LLS.GI..........
MDP0000413935  .......................................................FSNLRRS.....LCD.P-..........
MDP0000206098  .......................................................DG-----.....---.--..........
MDP0000845788  .......................................................SPNSQLLegqv.ELD.SS..........
MDP0000465595  .......................................................LGSPQIL.....LSS.AI..........
MDP0000137211  .......................................................IGSPQLL.....LLS.GV..........
MDP0000130099  .......................................................MGTPQLL.....LLS.GV..........
MDP0000425135  .......................................................IGSPQLL.....LLS.GI..........
MDP0000200780  .......................................................-------.....---.--..........
MDP0000142434  .......................................................KSVV---.....---.--..........
MDP0000248951  .......................................................IGSPQLL.....LLS.GV..........
MDP0000869086  .......................................................-------.....---.--..........
MDP0000318256  .......................................................IGSPQLL.....LLS.GV..........
MDP0000231634  .......................................................C------.....---.--..........
MDP0000626995  .......................................................D------.....---.--..........
MDP0000123832  .......................................................HSVVARW.....LGL.AEpvysgrwavr
MDP0000236092  .......................................................DG-----.....---.--..........
MDP0000199159  .......................................................-------.....---.--..........
MDP0000162755  .......................................................NSLVAKW.....LGF.--..........
MDP0000173666  .......................................................CN-----.....---.--..........
MDP0000262982  .......................................................-------.....---.--..........
MDP0000184832  .......................................................LGSPQIL.....LLS.GI..........
MDP0000598927  .......................................................VQFHPT-.....ALA.DE..........
MDP0000561228  .......................................................MGTPQLL.....LLS.GV..........
MDP0000175650  .......................................................GSTVRKL.....AGV.DM..........
MDP0000233802  .......................................................EPATKFLdghldL--.--..........
MDP0000321186  .......................................................-------.....---.--..........
MDP0000161955  .......................................................FSNLRR-.....---.--..........
MDP0000213381  .......................................................FSNLRRS.....---.--..........
MDP0000168437  .......................................................YSNLRHS.....LCN.PKvdipscfv..
MDP0000823251  .......................................................XXXTKFLdghldL--.--..........
MDP0000191389  .......................................................FSNLRR-.....---.--..........
MDP0000199319  .......................................................FSNLRR-.....---.--..........
MDP0000857446  .......................................................FSNLRR-.....---.--..........
MDP0000266638  .......................................................FSNLRR-.....---.--..........
MDP0000208936  .......................................................LLTPPLM.....ISS.GL..........
MDP0000202883  .......................................................FSNLRR-.....---.--..........
MDP0000288439  .......................................................LGSPQIL.....LLS.GI..........
MDP0000295839  .......................................................-------.....---.--..........
MDP0000903805  .......................................................LGSPQLL.....LLS.GV..........
MDP0000202123  .......................................................RPNTKNL.....GLE.AV..........
MDP0000227773  .......................................................YSNPRLP.....SIK.GM..........
MDP0000317524  .......................................................-------.....---.--..........
MDP0000320748  .......................................................FSNLRRS.....ISS.P-..........
MDP0000634676  .......................................................FSNLRR-.....---.--..........
MDP0000235846  .......................................................EPASKFLdg...QL-.--..........
MDP0000251344  .......................................................EPASKFLdg...QL-.--..........
MDP0000501957  .......................................................FSNLRR-.....---.--..........
MDP0000209681  .......................................................-------.....---.--..........
MDP0000293482  .......................................................LSSIRQS.....F--.--..........
MDP0000233995  .......................................................-------.....---.--..........
MDP0000257243  .......................................................IGSXQLL.....LLS.GV..........
MDP0000160099  .......................................................YSNPRLP.....SIK.GM..........
MDP0000193196  .......................................................FSNLRR-.....---.--..........
MDP0000208234  .......................................................-------.....---.--..........
MDP0000251783  .......................................................IGSPQLL.....LLS.GV..........
MDP0000686885  .......................................................WTTKLVK.....TVG.GI..........
MDP0000138851  .......................................................-------.....---.--..........
MDP0000194930  .......................................................YKTFKEL.....VPD.NA..........
MDP0000169201  .......................................................-------.....---.--..........
MDP0000399642  .......................................................-------.....---.--..........
MDP0000582079  .......................................................-------.....---.--..........
MDP0000129765  .......................................................LSSIRQS.....FVP.D-..........
MDP0000272655  .......................................................IGSPQLL.....LLS.GV..........
MDP0000686821  .......................................................-------.....---.--..........
MDP0000170414  .......................................................-------.....---.--..........
MDP0000320804  .......................................................-------.....---.--..........
MDP0000189790  .......................................................CSNLRRY.....LCN.PKvdipscfv..
MDP0000847111  .......................................................-------.....---.--..........
MDP0000289536  .......................................................WTTKLVK.....TVG.--..........
MDP0000123987  .......................................................-------.....---.--..........
MDP0000245245  .......................................................-------.....---.--..........
MDP0000188553  ................................vaaisdlgvgnenkialrfekvfWPNVELL.....GIV.APnsy.......
MDP0000296599  .......................................................WCG----.....---.--..........
MDP0000746652  .......................................................FSNLRR-.....---.--..........
MDP0000259265  .......................................................-------.....---.--..........
MDP0000151331  .......................................................IASPQLL.....LLS.GI..........
MDP0000309775  .......................................................SARDFYQ.....TLL.SH..........
MDP0000232736  .......................................................-------.....---.--..........
MDP0000320539  .......................................................-------.....---.--..........
MDP0000239909  .......................................................-------.....---.--..........
MDP0000259264  .......................................................-------.....---.--..........
MDP0000293613  .......................................................FC-----.....---.--..........
MDP0000253362  .......................................................FC-----.....---.--..........
MDP0000182973  .......................................................S------.....---.--..........
MDP0000138005  .......................................................-------.....---.--..........
MDP0000261301  .......................................................-------.....---.--..........
MDP0000771633  .......................................................NSRV---.....---.--..........
MDP0000851102  .......................................................NSRV---.....---.--..........
MDP0000159873  .......................................................NSR----.....---.--..........
MDP0000140206  .......................................................-------.....---.--..........
MDP0000261201  .......................................................NSRVA--.....---.--..........
MDP0000252244  .......................................................NSRVA--.....---.--..........
MDP0000261821  .......................................................RPLTTLFkgq..VEE.EK..........
MDP0000124454  .......................................................-------.....---.--..........
MDP0000234830  .......................................................FC-----.....---.--..........
MDP0000297861  .......................................................FSNLRCT.....LC-.--..........
MDP0000152184  .......................................................-------.....---.--..........
MDP0000157871  .......................................................KPLIDLFkgx..VGE.EK..........
MDP0000250932  .......................................................FMSGKIW.....VG-.--..........
MDP0000219521  .......................................................-------.....---.--..........
MDP0000239289  .......................................................-------.....---.--..........
MDP0000258995  .......................................................-------.....---.--..........
MDP0000167343  .......................................................-------.....---.--..........
MDP0000222306  .......................................................-------.....---.--..........
MDP0000829384  .......................................................-------.....---.--..........
MDP0000145663  ........................................hgilaeveehpfdldK------.....---.--..........
MDP0000288439  .......................................................LGSPQIL.....LLS.GI..........
MDP0000267350  .......................................................RPLTTLFkgq..VEE.EK..........
MDP0000155608  .......................................................KSRVREL.....---.--..........
MDP0000194622  ygilaeveehpfdvdkmlfmdwrdshlnnnielkerngriptflyampfssnrifL------.....---.--..........
MDP0000134271  .......................................................-------.....---.--..........
MDP0000312748  .......................................................YKTFKEL.....VPD.NA..........
MDP0000197715  .......................................................LLTPHLM.....LSS.GL..........
MDP0000220943  .......................................................-------.....---.--..........
MDP0000320539  .......................................................RPNTSLF.....EGQ.LTlek.......
MDP0000140206  .......................................................KPLTDLFkgq..VDE.EN..........
MDP0000215521  .......................................................-------.....---.--..........
MDP0000203847  .......................................................P------.....---.--..........
MDP0000201011  .......................................................P------.....---.--..........
MDP0000204596  .......................................................G------.....---.--..........
MDP0000148978  .......................................................D-ILKLL.....LPE.NW..........
MDP0000130369  .......................................................S------.....---.--..........
MDP0000314606  .......................................................FC-----.....---.--..........
MDP0000263146  .......................................................-------.....---.--..........
MDP0000250583  .......................................................KSLLPKL.....EPE.DR..........
MDP0000208233  .......................................................KRSTNLW.....LK-.GD..........
MDP0000158720  .......................................................-------.....---.--..........
MDP0000152184  .......................................................RPNKSLF.....EGQ.LTlek.......
MDP0000182702  .......................................................WNTF---.....---.--..........
MDP0000261638  .......................................................-------.....---.--..........
MDP0000130370  .......................................................STLQKII.....ENS.AV..........
MDP0000272119  .......................................................-------.....---.--..........
MDP0000305861  .......................................................-------.....---.--..........
MDP0000255696  .......................................................-------.....---.--..........
MDP0000214280  .......................................................IASP---.....---.--..........
MDP0000210966  .......................................................-------.....---.--..........
MDP0000610999  .......................................................-------.....---.--..........
MDP0000242546  .......................................................-------.....---.--..........
MDP0000320742  .......................................................-------.....---.--..........
MDP0000654164  .......................................................-------.....---.--..........
MDP0000256300  .......................................................IGSPQLL.....QLS.GI..........
MDP0000235080  .......................................................-------.....---.--..........
MDP0000284363  .......................................................-------.....---.--..........
MDP0000125043  .......................................................-------.....---.--..........
MDP0000192359  .......................................................LGSPQIL.....LLS.GI..........
MDP0000440005  .......................................................VGSAWLK.....E--.--..........
MDP0000609131  .......................................................-------.....---.--..........
MDP0000362000  .......................................................GPSPLVN.....SLP.--..........
MDP0000150210  .......................................................-------.....---.--..........
MDP0000158790  .......................................................A-SGKLL.....QYE.VG..........
MDP0000427950  .......................................................-------.....---.--..........
MDP0000569169  .......................................................-------.....---.--..........
MDP0000525742  .......................................................-------.....---.--..........
MDP0000559829  .......................................................-------.....---.--..........
MDP0000321788  .......................................................WN-----.....---.--..........
MDP0000919183  .......................................................DVPYGLL.....VWStGV..........
MDP0000146158  .......................................................DVPYGLL.....VWStGV..........
MDP0000832077  .......................................................-------.....---.--..........
MDP0000621365  .......................................................-------.....---.--..........
MDP0000875229  .......................................................APFTQGL.....GLE.--..........
MDP0000251344  .......................................................-------.....---.--..........
MDP0000168919  .......................................................CSNLRRY.....LCN.PKvdipscfv..
MDP0000267855  .......................................................-------.....---.--..........
MDP0000195207  .......................................................-------.....---.--..........
MDP0000400145  .......................................................-------.....---.--..........
MDP0000919183  .......................................................-------.....---.--..........
MDP0000307336  .......................................................-------.....---.--..........
MDP0000263146  .......................................................GPRPEI-.....---.--..........
MDP0000309730  .......................................................-------.....---.--..........
MDP0000163903  .......................................................MGSSWLR.....--E.S-..........
MDP0000611628  .......................................................DVPYGLL.....VWStGV..........
MDP0000119779  .......................................................MGSSWLR.....--E.S-..........
MDP0000120904  .......................................................CSNLRRY.....LCN.PKvdipscfv..
MDP0000150544  .......................................................-------.....---.--..........
MDP0000902209  .......................................................-------.....---.--..........
MDP0000269370  .......................................................LGTPQLL.....LXS.GI..........
MDP0000146158  .......................................................DVPYGLL.....VWStGV..........
MDP0000124051  .......................................................LGSPQIL.....LSS.GI..........
MDP0000255696  .......................................................GTRPFI-.....---.--..........
MDP0000305861  .......................................................GTRPFI-.....---.--..........
MDP0000611628  .......................................................-------.....---.--..........
MDP0000309622  .......................................................-------.....---.--..........
MDP0000239909  .......................................................KYHFPFL.....ETN.GTvtvddn....
MDP0000126888  .......................................................-------.....---.--..........
MDP0000869086  .......................................................SYTFPFL.....DTK.GIvtv.......
MDP0000317524  .......................................................SYTFPFL.....DTK.GI..........
MDP0000160099  .......................................................SYTFSFL.....DTK.GIvtvddnrvgp
MDP0000251205  .......................................................-------.....---.--..........
MDP0000314335  .......................................................-------.....---.--..........
MDP0000638870  .......................................................-------.....---.--..........
MDP0000790657  .......................................................FSNLR--.....---.--..........
MDP0000748068  .......................................................-------.....MLS.GV..........
MDP0000727481  .......................................................-------.....MLS.GV..........
MDP0000301246  .......................................................-------.....---.--..........
MDP0000190684  .......................................................SYTFPFL.....DTK.GIvavdddrv..
MDP0000456223  .......................................................-------.....---.--..........
MDP0000745172  .......................................................-------.....---.--..........
MDP0000407932  .......................................................FMSGKIW.....VGR.T-..........
MDP0000440896  .......................................................-------.....---.--..........
MDP0000694227  .................................................rveaqsD------.....---.--..........
MDP0000123987  .......................................................RG-----.....---.--..........
MDP0000138005  .......................................................-------.....---.--..........
MDP0000258205  .......................................................AS-----.....---.--..........
MDP0000245245  .......................................................RG-----.....---.--..........
MDP0000306704  .......................................................-------.....---.--..........
MDP0000478654  .......................................................-------.....---.--..........
MDP0000728219  .......................................................-------.....---.--..........
MDP0000170414  .......................................................RG-----.....---.--..........
MDP0000284363  .......................................................GTRPVV-.....---.--..........
MDP0000219560  .......................................................-------.....---.--..........
MDP0000235930  .......................................................-------.....---.--..........
MDP0000755938  .......................................................DG-----.....---.--..........
MDP0000138851  .......................................................KSSTNLW.....I--.--..........
MDP0000261638  .......................................................-------.....---.--..........
MDP0000317524  .......................................................SYTFPFL.....DTK.GI..........
MDP0000294615  .......................................................-------.....---.--..........
MDP0000208234  .......................................................KRLTNL-.....WLK.GD..........
MDP0000216129  .......................................................-------.....---.--..........
MDP0000219521  .......................................................DG-----.....---.--..........
MDP0000248995  .......................................................-------.....---.--..........
MDP0000256328  .......................................................-------.....---.--..........
MDP0000181673  .......................................................-------.....---.--..........
MDP0000169201  .......................................................RG-----.....---.--..........
MDP0000263530  .......................................................-------.....---.--..........
MDP0000295839  .......................................................KSTVLNW.....LKD.GD..........
MDP0000297466  .......................................................A-SGKLL.....QLA.TV..........
MDP0000281982  .......................................................-------.....---.--..........
MDP0000053966  .......................................................-------.....---.--..........
MDP0000795740  .......................................................WSG----.....---.--..........
MDP0000212327  .......................................................YSNLRH-.....---.--..........
MDP0000437365  .......................................................-------.....---.--..........
MDP0000135231  .......................................................-------.....---.--..........
MDP0000167343  .......................................................DG-----.....---.--..........
MDP0000222306  .......................................................DG-----.....---.--..........
MDP0000183517  .......................................................-------.....---.--..........
MDP0000686821  .......................................................-------.....---.--..........
MDP0000430157  .......................................................-------.....---.--..........
MDP0000373054  .......................................................FSYLR--.....---.--..........
MDP0000295306  .......................................................-------.....---.--..........
MDP0000233995  .......................................................-------.....---.--..........
MDP0000209681  .......................................................-------.....---.--..........
MDP0000876898  .......................................................-------.....---.--..........
MDP0000738522  .......................................................-------.....---.--..........
MDP0000399642  .......................................................-------.....---.--..........
MDP0000215521  .......................................................EG-----.....---.--..........
MDP0000170521  .......................................................-------.....---.--..........
MDP0000262982  .......................................................RSNVPSW.....LQE.GDffskn.....
MDP0000321186  .......................................................-------.....---.--..........
MDP0000266051  .......................................................-------.....---.--..........
MDP0000837610  .......................................................-------.....---.--..........
MDP0000582079  .......................................................-------.....---.--..........
MDP0000538071  .......................................................-------.....---.--..........
MDP0000241703  .......................................................-------.....---.--..........
MDP0000671114  .......................................................-------.....---.--..........
MDP0000315388  .......................................................IGSHQLL.....QLN.GI..........
MDP0000134271  .......................................................EG-----.....---.--..........
MDP0000297581  .......................................................N------.....---.--..........
MDP0000911003  .......................................................FSPIVKQ.....IRS.GR..........
MDP0000576650  .......................................................-------.....---.--..........
MDP0000149205  .......................................................-------.....---.--..........
MDP0000315409  .......................................................-------.....---.--..........
MDP0000320804  .......................................................RG-----.....---.--..........
MDP0000474647  .......................................................-------.....---.--..........
MDP0000566648  .......................................................-------.....---.--..........
MDP0000171379  .......................................................-------.....---.--..........
MDP0000814529  .......................................................-------.....---.--..........
MDP0000218295  .......................................................-------.....---.--..........
MDP0000220943  .......................................................E------.....---.--..........
MDP0000795437  .......................................................-------.....---.--..........
MDP0000919706  .......................................................-------.....---.--..........
MDP0000295675  .......................................................-------.....---.--..........
MDP0000147542  .......................................................-------.....---.--..........
MDP0000272126  .......................................................-------.....---.--..........
MDP0000196881  .......................................................-------.....---.--..........
MDP0000268346  .......................................................-------.....---.--..........
MDP0000147542  .......................................................-------.....---.--..........
MDP0000948298  .......................................................-------.....---.--..........
MDP0000220943  .......................................................EG-----.....---.--..........
MDP0000182589  .......................................................-------.....---.--..........
MDP0000557870  .......................................................KSVAHKW.....LKD.YK..........
MDP0000308870  .......................................................-------.....---.--..........
MDP0000322449  .......................................................-------.....---.--..........
MDP0000286494  .......................................................-------.....---.--..........
MDP0000150868  .......................................................-------.....---.--..........
MDP0000155608  .......................................................KSRVREL.....A--.--..........
MDP0000168505  .......................................................-------.....---.--..........
MDP0000196888  .......................................................-------.....---.--..........
MDP0000154812  .......................................................-------.....---.--..........
MDP0000186080  .......................................................-------.....---.--..........
MDP0000220012  .......................................................-------.....---.--..........
MDP0000169409  .......................................................-------.....---.--..........
MDP0000373095  .......................................................-------.....---.--..........
MDP0000235846  .......................................................-------.....---.--..........
MDP0000207126  .......................................................-------.....---.--..........
MDP0000268357  .......................................................-------.....---.--..........
MDP0000770761  .......................................................-------.....MLS.GV..........
MDP0000149067  .......................................................-------.....---.--..........


                        310                                                                         
                          |                                                                         
d1cf3a1          .GMKSILEPL.............GIDTVVD.....................................................
MDP0000813172  .G--------.............-------.....................................................
MDP0000251581  .G--------.............-------.....................................................
MDP0000188391  .G--------.............-------.....................................................
MDP0000254144  .---------.............-------.....................................................
MDP0000321972  .---------.............-------.....................................................
MDP0000299806  .---------.............-------.....................................................
MDP0000283451  .---------.............-------.....................................................
MDP0000296714  .---------.............-------.....................................................
MDP0000162193  .---------.............-------.....................................................
MDP0000769741  .---------.............-------.....................................................
MDP0000295277  .GRILVNERF.............STNVSGV.....................................................
MDP0000897124  .GRILVNERF.............STNVSGV.....................................................
MDP0000854208  .---------.............------Raqavisnmefvqfhptaladeglpiqpskarenafliteavrgdgailynldm
MDP0000241767  .---------.............-------.....................................................
MDP0000318858  .NYKADYGRF.............STNVDGV.....................................................
MDP0000248995  .---------.............-------.....................................................
MDP0000442206  .NYKADYGRF.............STNVDGV.....................................................
MDP0000181673  .---------.............-------.....................................................
MDP0000315409  .---------.............-------.....................................................
MDP0000053966  .---------.............-------.....................................................
MDP0000294615  .---------.............-------.....................................................
MDP0000306147  .---------.............-------.....................................................
MDP0000180064  .VPKQEEDFQ.............KVYVKAPsflsihmgvkaevlppetdchhfvleddwtrleepygsiflsiptvldsslap
MDP0000261625  .---------.............-------.....................................................
MDP0000300208  .GVEVDKTGAikvdeys......RTNVPSI.....................................................
MDP0000247171  .GLAVFPEGH.............RLD----.....................................................
MDP0000308095  .REWDFFNNVyelv.........GVPVVTV.....................................................
MDP0000319421  .--SIVSNVM.............GXKASNI.....................................................
MDP0000232295  .GPHQHLNNF.............NIQLVLDleavgkgmkdnpgialladptpknfppeppkvvgiaddfkiiieagilpvssn
MDP0000188994  .GLANFKSSH.............GFDPIFM.....................................................
MDP0000159189  .GLANFKSSH.............GFDPIFM.....................................................
MDP0000656178  .DVATQRGFIpvdermrvidan.GKLVPHL.....................................................
MDP0000910523  .GLAVFPQGH.............GLDNNVQ.....................................................
MDP0000119941  .GRILVNERF.............XTNVSGV.....................................................
MDP0000231799  .DVATQRGFIpvdermrvidan.GKLVPHL.....................................................
MDP0000255025  .RELDFFNNIyelv.........GVPVVT-.....................................................
MDP0000231632  .---------.............-------.....................................................
MDP0000173300  .KNKNIGRNL.............HLHPVLMawgyfpdsnsefkgknyeggiitsvykvvsxdskvkaiietpalgpgtfsals
MDP0000158474  .GPKADLQKL.............KIPVVLDnkfvgkgmadnpmnavfvpsskpekqtlietvgitkmgvyiegssgfsqskds
MDP0000276878  .--S------.............-------.....................................................
MDP0000154720  .---------.............-------.....................................................
MDP0000549646  .---------.............-------.....................................................
MDP0000158853  .---------.............-------.....................................................
MDP0000702799  .---------.............-------.....................................................
MDP0000233110  .KNRNI----.............GRNLHLHpvllswgyfpqhesefxxkkyeggiitsihkvvsetanaraixetavlgpasf
MDP0000260827  .---------.............-------.....................................................
MDP0000941459  .---------.............-------.....................................................
MDP0000185338  .GPRPYLSSW.............GIPVAHHlsyvgqylydnprngisivppiplehsliqvvgitesgayieaasnvipfapp
MDP0000451172  .GPAFHLRAH.............GIKVVADqpmvgqgmadnpmnlllipspqpvevslvqvvgitkfesyiegasgltlpipl
MDP0000136847  .GPKSYLSSL.............KIPVVHP.....................................................
MDP0000177641  .GPQKHLNKF.............NIPVAVNlksvgkgmtdnpciallaeiadakpknfppdspkvtviaddfklviqalilpx
MDP0000413935  .---------.............-------.....................................................
MDP0000206098  .---------.............-------.....................................................
MDP0000845788  .GYVLVEEGTa............KTSVEGV.....................................................
MDP0000465595  .GPHQHLKNF.............NIELVVDldvlclahilmkppkvvgiaddfkiiieagispvssnatvmpiaaklafpvse
MDP0000137211  .GPKSYLTSL.............KIPVVHPqpyvgkfmrdnprsniiilppspivptysqiagftsdfdiesisgtpyssqay
MDP0000130099  .GPESYLSSL.............GIPVVID.....................................................
MDP0000425135  .GPRPYLSSW.............GIPVAHH.....................................................
MDP0000200780  .---------.............-------.....................................................
MDP0000142434  .-----ADFI.............-------.....................................................
MDP0000248951  .GPKSYLSSL.............KIPVVHP.....................................................
MDP0000869086  .---------.............-------.....................................................
MDP0000318256  .GPKSYLSSR.............KIPVVHPqpyvgqfmrdnprnyitilppfqveastaqvvgitsdyyietfsglpfsrqaf
MDP0000231634  .---------.............-------.....................................................
MDP0000626995  .---------.............-------.....................................................
MDP0000123832  .GLAVFPEGH.............RLD----.....................................................
MDP0000236092  .---------.............-------.....................................................
MDP0000199159  .---------.............-------.....................................................
MDP0000162755  .---------.............-------.....................................................
MDP0000173666  .---------.............-------.....................................................
MDP0000262982  .---------.............-------.....................................................
MDP0000184832  .GPXKHLNKF.............DIPVAVNlksvgkgmqdnpsialvpxvadakpknfppdspkviaiaddfklivgsmilpi
MDP0000598927  .GLPVXPTKA.............RENAFLIxeavrgdggilynldmerfmplyderaelaprdvvarciddqlkkrnekyvll
MDP0000561228  .GPESYLSSL.............GIPVVLD.....................................................
MDP0000175650  .RGEKDLQKL.............-------.....................................................
MDP0000233802  .--------Hadgyvatkpgtt.QTSVKGV.....................................................
MDP0000321186  .---------.............-------.....................................................
MDP0000161955  .-------NL.............-------.....................................................
MDP0000213381  .---------.............-------.....................................................
MDP0000168437  .G--------.............-------.....................................................
MDP0000823251  .--------Hadgyvatkpgtt.QTSVKGV.....................................................
MDP0000191389  .-------NL.............-------.....................................................
MDP0000199319  .---------.............-------.....................................................
MDP0000857446  .---------.............-------.....................................................
MDP0000266638  .---------.............-------.....................................................
MDP0000208936  .KNRNI----.............GRNLHLHpvllawgyfpehepefkgksyeggiitslhkvvsgtanvrtiietaavgpatf
MDP0000202883  .-------NL.............-------.....................................................
MDP0000288439  .GPQKHLNKF.............NIPVAVNlksvgkgmtdnpciallaeiadakpknfppdspkvtviaddfklviqalilpx
MDP0000295839  .---------.............-------.....................................................
MDP0000903805  .XPKSYLSSL.............KIPVVHPqpyigqxmrdnprnyvtilppfqielsttqvvgissdyyietnsglpystqif
MDP0000202123  .GVKLSKNGAmevdkfs......RTAVPSI.....................................................
MDP0000227773  .---------.............-------.....................................................
MDP0000317524  .---------.............-------.....................................................
MDP0000320748  .---------.............-------.....................................................
MDP0000634676  .---------.............-------.....................................................
MDP0000235846  .--ELHDDGYvatkpgtt.....QTSVKGV.....................................................
MDP0000251344  .--ELHDDGYvatkpgtt.....QTSVKGV.....................................................
MDP0000501957  .---------.............-------.....................................................
MDP0000209681  .---------.............-------.....................................................
MDP0000293482  .---------.............-------.....................................................
MDP0000233995  .---------.............-------.....................................................
MDP0000257243  .GPKSYLSSR.............KIPVVHPqpyvgqfmrdnprnyitilppfqveastvqvvgitsdyyietfsglpfsrqaf
MDP0000160099  .---------.............-------.....................................................
MDP0000193196  .---------.............-------.....................................................
MDP0000208234  .---------.............-------.....................................................
MDP0000251783  .GSKSYFSSL.............KIPVVHPqpyvgqfmrdnprnyitilppfqlepstaqiagitsdyyietfsglpfstpaf
MDP0000686885  .--ELPIQPL.............ETTVCY-.....................................................
MDP0000138851  .---------.............-------.....................................................
MDP0000194930  .LPDSFVRAIkysdyssgtt...KINLAV-.....................................................
MDP0000169201  .---------.............-------.....................................................
MDP0000399642  .---------.............-------.....................................................
MDP0000582079  .---------.............-------.....................................................
MDP0000129765  .---------.............-------.....................................................
MDP0000272655  .GPKSYLSSR.............KIPVVHPqpyvgqfmrdnprnyittlapfqvepstaqfvgitsdyyietfsglpfstqaf
MDP0000686821  .---------.............-------.....................................................
MDP0000170414  .---------.............-------.....................................................
MDP0000320804  .---------.............-------.....................................................
MDP0000189790  .GLILEDCQL.............PYANHAHvilgdpslvsf..........................................
MDP0000847111  .---------.............-------.....................................................
MDP0000289536  .GVELPIQPL.............ETTVCYWrikeg................................................
MDP0000123987  .---------.............-------.....................................................
MDP0000245245  .---------.............-------.....................................................
MDP0000188553  .GCGYFLNLH.............-------.....................................................
MDP0000296599  .---------.............-------.....................................................
MDP0000746652  .-------NL.............-------.....................................................
MDP0000259265  .---------.............-------.....................................................
MDP0000151331  .GPKSYLSSL.............KIPVVLD.....................................................
MDP0000309775  .NIDLIPKDF.............AVGLRI-.....................................................
MDP0000232736  .---------.............-------.....................................................
MDP0000320539  .---------.............-------.....................................................
MDP0000239909  .---------.............-------.....................................................
MDP0000259264  .---------.............-------.....................................................
MDP0000293613  .---------.............-------.....................................................
MDP0000253362  .---------.............-------.....................................................
MDP0000182973  .---------.............-------.....................................................
MDP0000138005  .---------.............-------.....................................................
MDP0000261301  .---------.............-------.....................................................
MDP0000771633  .---------.............-------.....................................................
MDP0000851102  .---------.............-------.....................................................
MDP0000159873  .---------.............-------.....................................................
MDP0000140206  .---------.............-------.....................................................
MDP0000261201  .---------.............-------.....................................................
MDP0000252244  .---------.............-------.....................................................
MDP0000261821  .GGIKTDAFF.............KTSVPNV.....................................................
MDP0000124454  .---------.............-------.....................................................
MDP0000234830  .---------.............-------.....................................................
MDP0000297861  .---------.............-------.....................................................
MDP0000152184  .---------.............-------.....................................................
MDP0000157871  .GGIQTDGMF.............ETDVPDV.....................................................
MDP0000250932  .---------.............-------.....................................................
MDP0000219521  .---------.............-------.....................................................
MDP0000239289  .---------.............-------.....................................................
MDP0000258995  .---------.............-------.....................................................
MDP0000167343  .---------.............-------.....................................................
MDP0000222306  .---------.............-------.....................................................
MDP0000829384  .---------.............-------.....................................................
MDP0000145663  .---------.............------Mllmdwrdshlgnepylrtsnsrfptflyampfdsnlvfleetslvsrpvlsym
MDP0000288439  .GPXKHLNKF.............DIPVAVN.....................................................
MDP0000267350  .GGIKTDAFF.............KTSVPDV.....................................................
MDP0000155608  .---------.............-------.....................................................
MDP0000194622  .---------.............-------.....................................................
MDP0000134271  .---------.............-------.....................................................
MDP0000312748  .LPPDFVRAIkysdysxgtt...KINLA--.....................................................
MDP0000197715  .KNKNIGRNL.............HLHPVLMawgyfpdlnlefkgknyedgiitsvhkvvsadskakaiietptlglgtfsalc
MDP0000220943  .---------.............-------.....................................................
MDP0000320539  .GGIKVNGRM.............QSSNSSV.....................................................
MDP0000140206  .DGIRTDGMF.............ETDVPYV.....................................................
MDP0000215521  .---------.............-------.....................................................
MDP0000203847  .---------.............-------.....................................................
MDP0000201011  .---------.............-------..............................................