SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

L domain-like alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0045746 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1a9na_               vkltaelieqaaqytn..............................................................
ENSGGOP00000002818  anlgdiealnlgnngleevpeglgsalgslrvlvlrrnrfarlppavaelghhlteldvshnrltalgaevvsalrel
ENSGGOP00000026867  epvcpercdcqhpqhllctnrglrvvpktsslpsphdvltyslggnfitnitafdfhrlgqlrrldlqynqirslhpk
ENSGGOP00000014553  akniifvetsfttletrafgsnpnltkvvflntqlcqfrpdafgglprledlevtgssflnlstnifsnltslgkltl
ENSGGOP00000006261  pwytprssyreattvdcndlfltavppalpagtqtlllq.......................................
ENSGGOP00000007172  ahfsqcsnlkelqlhgnhleyipdgafdhlagltklnlgknslthisprvfqhlgnlqvlrlyenrladipmgtfdgl
ENSGGOP00000005919  pgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltilwlhsnvlaridaaaftgla
ENSGGOP00000024063  ngiqefpeniknckvltiveasvnpisklpdgfsqllnltqlylndafl.............................
ENSGGOP00000013969  shvvslflqhnkirsvegsqlkaylslevldlslnnitevrntcfphgppikelnlagnrigtlelgafdglsrsllt
ENSGGOP00000007076  peniknckvltiveasvnpisklpdgfsqllnltqlylndafl...................................
ENSGGOP00000015022  ffidasnqsltaipl...............................................................
ENSGGOP00000010210  cptkctcsaasvdchglglravprgiprnaerldldrnnitritkmdfaglknlrvlhle..................
ENSGGOP00000025646  qlcvceirpwftpqstyreattvdcndlrltripsnlssdtqvlllqsnniak.........................
ENSGGOP00000008275  ensmrldlskrsihilpssikeltqltelylysnklqslpaevgc.................................
ENSGGOP00000004396  cdctsqpqavlcghrqleavpgglpldtelldl.............................................
ENSGGOP00000027814  scpmlctcysspptvscqannfssvplslppstqrlflqnnlirtlrpgtfgsnlltlwlfsnnlstiypgtfrhlqa
ENSGGOP00000009302  scpmlctcysspptvscqannfssvplslppstqrlflqnnlirtlrpgtfgsnlltlwlfsnnlstiypgtfrhlqa
ENSGGOP00000010181  cecsaqdravlchrkrfvavpegiptetrlldlg............................................
ENSGGOP00000000462  erwweqtdltkliis...............................................................
ENSGGOP00000012823  cecsaqnksvschrrrliaipegipietkildlsk...........................................
ENSGGOP00000008393  acpkncrcdgkivyceshafadipenisggsqglslr.........................................
ENSGGOP00000017408  vpeeiyrysrsleellldanqlrelpkpffrllnlrklglsdneiqrlppevanfmqlveldvsrndipeipesikfc
ENSGGOP00000003137  cpvacscsnqasrvictrrdlaevpasipvntrylnlqengiqvirtdtfkhlrhleilqlsknlvrkievgafnglp
ENSGGOP00000019249  cpvacscsnqasrvictrrdlaevpasipvntrylnlqengiqvirtdtfkhlrhleilqlsknlvrkievgafnglp
ENSGGOP00000013132  cpqacicdnsrrhvacrhqnltevpdaipeltqrldlq........................................
ENSGGOP00000024818  cpqacicdnsrrhvacrhqnltevpdaipeltqrldlq........................................
ENSGGOP00000023908  acppkcrcekllfycdsqgfhsvpnatdkgslglslr.........................................
ENSGGOP00000024673  lllhkeilgcssvcqlctgrqincrnlglssipknfpestvflsltgnnisyineseltglhslvalyldnsnilyvy
ENSGGOP00000026305  ncpsvcscsnqfskvvctrrglsevpqgipsntrylnlmenniqmiqadtfrhlhhlevlqlgrnsirqievgafngl
ENSGGOP00000009400  ncpsvcscsnqfskvvctrrglsevpqgipsntrylnlmenniqmiqadtfrhlhhlevlqlgrnsirqievgafngl
ENSGGOP00000007056  mc............................................................................
ENSGGOP00000005706  mlsadcselglsavpgdldpltayldl...................................................
ENSGGOP00000023515  slknsgvpddifklddlsvldlshnqltecprelenaknmlvlnlshnsidtipnqlfinltdllyldlsenrleslp
ENSGGOP00000003028  slknsgvpddifklddlsvldlshnqltecprelenaknmlvlnlshnsidtipnqlfinltdllyldlsenrleslp
ENSGGOP00000002850  lrvdcsdlglselpsnlsvftsyldl....................................................
ENSGGOP00000006625  cpsvcscsnqfskvicvrknlrevpdgistntrllnlhenqiqiikvnsfkhlrhleilqlsrnhirtieigafngla
ENSGGOP00000005450  cphkcrceanvvecsslkltkiperipqstaelrlnnneisileat................................
ENSGGOP00000019824  llppdtaildlshnrlsnwnislesqtlqevkmnynelteipyfgeptsnitllslvhniipeinaqalqfypalesl
ENSGGOP00000001938  pmc...........................................................................
ENSGGOP00000006377  cpqnchchgdlqhvicdkvglqkipkvsektkllnlqrnnfpvlaansframpnlvslhl..................
ENSGGOP00000028264  pmc...........................................................................
ENSGGOP00000021709  tprsiymeastvdcndlglltfparlpantqilllqtnniakieyst...............................
ENSGGOP00000025918  cpkgcrcegkmvycesqklqeipssisagclglslr..........................................
ENSGGOP00000008365  cstvergcsvrcdragllrvpaelpceavsidldrnglrflgerafgtlpslrrlslrhnnlsfitpgafkglprlae
ENSGGOP00000006124  adelsvfcssrnltrlpdgipggtqalwldgnnlssispaafqnlsslgflnlqggqlgslepqallglenlchlhle
ENSGGOP00000015799  qlkylylnsnrvtsmepgyfdnlantllvlklnrnrisaippkmfklpqlqhlelnrnkiknvdgltfqglgalkslk
ENSGGOP00000010984  vnleakglqefpkdilkikyvkylyldknqiktfqgadsgdllgleilslqenglss.....................
ENSGGOP00000012493  edvdlnhyrigkiegfevlkkvktlclrqnlikcienleelqslreldlydnqikkienlealteleildisfnllrn
ENSGGOP00000018354  alglptnlthillfgmgrgvlqshsfsgmtvlqrlmisdshisavapgtfndliklktlrlsrnkithlpgalldkmv
ENSGGOP00000001578  lcrcegrllycealnlteaphnlsgllglsl...............................................
ENSGGOP00000004548  iplwrcnrhvesvdkrhcslqavpeeiyrysrsleellldanqlrelpkpffrllnlrklglsdneiqrlppevanfm
ENSGGOP00000013132  cpracvcvpesrhsscegcglqavprgfpndtqlldlrrnhfpsvpraafpglghlvslhlqhcgiaeleagalaglg
ENSGGOP00000024818  cpracvcvpesrhsscegcglqavprgfpndtqlldlrrnhfpsvpraafpglghlvslhlqhcgiaeleagalaglg
ENSGGOP00000025004  dism..........................................................................
ENSGGOP00000025833  dism..........................................................................
ENSGGOP00000016600  lelhlfmlsgipdtvfdlvelevlklelipdvtippsiaqltglkelwlyhtaakieapalaflrenlralhikftdi
ENSGGOP00000006124  gaflglkalrwldlshnrvaglledtfpgllglrvlrlshnaiaslrprtfkdlhfleelqlg...............
ENSGGOP00000005521  aavscprdcacsqegvvdcggidlrefpgdlpehtnhlslqnnqlekiypeelsrlhrletlnlqnnrltsrglpeka
ENSGGOP00000001854  fpaelhnvqsvhtvylygnqldefpmnlpknvrvlhlqenniqtisraalaqllkleelhlddnsistvgvedgafre
ENSGGOP00000019138  qpqtvfctarqgttvprdvppdtvglyvfe................................................
ENSGGOP00000021712  hlfmlsgvpdavfdltdldvlklelipeakipakisqmtnlqelhlchcpakveqtafsflrdhlrclhvkftdvaei
ENSGGOP00000015564  psalycdsrnlrkvpvipprihylyl....................................................
ENSGGOP00000012531  gpcpkvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvki.............
ENSGGOP00000020501  rdcacsqegvvdcggidlrefpgdlpehtnhlslqnnqlekiypeelsrlhrletlnlqnnrltsrglpekafehltn
ENSGGOP00000003727  vcpfrcqchlrvvqcsdlgldkvpkdlppdttlldl..........................................
ENSGGOP00000025379  lqnnqlggipaealwelpslqslrld....................................................
ENSGGOP00000025364  ipsdlknllkveriylyhnsldefptnlpkyvkelhlqennirtitydslskipyleelhlddnsvsavsieegafrd
ENSGGOP00000011582  cdcppnfptamycdnrnlkylpfvpsrmkyvyf.............................................
ENSGGOP00000023288  kcrcegtivdcsnqklaripshlpeyvtdlrlndnevsvleatgifkklpnlrkinlsnnkikevregafdgaasvqe
ENSGGOP00000010210  kcrcegtivdcsnqklaripshlpeyvtdlrlndnevsvleatgifkklpnlrkinlsnnkikevregafdgaasvqe
ENSGGOP00000019616  skmfpqfryldalqlagndlsfihpkalsglkelkvltlqnnqlktvpseairglsalqslrl...............
ENSGGOP00000026995  nrlelplimlsglpdtvfeitelqslkleiiknvmipatiaqldnlqelslhqcsvkihsaalsflkenlkvlsvkfd
ENSGGOP00000003265  iplwrcnrhvesidkrhcslvyvpeeiyryarsleellldanqlrelpeqffqlvklrklglsdneiqrlppeianfm
ENSGGOP00000024614  tvhlaveffnlthlpanllqgasklqelhlssngleslspeflrpvpqlrvldlt.......................
ENSGGOP00000025637  nvktkhvpaltdpglttlyla.........................................................
ENSGGOP00000014142  pcvcqnlseslstlcahrgllfvppnvdrrtvelrla.........................................
ENSGGOP00000013300  rtiscinamltqippltapqitslelt...................................................
ENSGGOP00000022805  grlelalcmlpglpdtvfelseveslrleaicditfppglsqlvhlqelsllhsparlpfslqvflrdhlkvmrvkce
ENSGGOP00000025292  tiscinamltqippltapqitslelt....................................................
ENSGGOP00000025973  qdlktkvnvqviylyendldefpinlprslrelhlqdnnvrtiardslariplleklhlddnsvstvsieedafadsk
ENSGGOP00000002611  pqccdcketelecvngdlksvpmisnnvtllslkknkihslpdkvfikytklkkifl.....................
ENSGGOP00000015422  ftldlsrnnlvtvqpemfaqlshlqclrlshncisqavngsqflpltglqvldlshnkldlyhehsftelprlealdl
ENSGGOP00000015431  ftldlsrnnlvtvqpemfaqlshlqclrlshncisqavngsqflpltglqvldlshnkldlyhehsftelprlealdl
ENSGGOP00000000213  vskvashlevncdkrnltvlppdlpkdttilhls............................................
ENSGGOP00000025405  vskvashlevncdkrnltvlppdlpkdttilhls............................................
ENSGGOP00000022526  gqsspncapecncpesypsamycdelklksvpmvppgikylylrnnqidhidekafenvtdlqwlildhnllenskik
ENSGGOP00000014753  laqle.........................................................................
ENSGGOP00000020501  hplafqglkrlhtvhlynnalervpsglprrvrtlmil........................................
ENSGGOP00000003295  asereyitsldlsanelrdidalsqkccisg...............................................
ENSGGOP00000022737  lcppgllfvppnvdrrtvelrla.......................................................
ENSGGOP00000007465  kcegpcrkvcngigigefkdtlsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgfl
ENSGGOP00000016887  lcakkgllfvppnidrrtvelrla......................................................
ENSGGOP00000018050  lcakkgllfvppnidrrtvelrla......................................................
ENSGGOP00000023473  lcakkgllfvppnidrrtvelrla......................................................
ENSGGOP00000010984  isccamleclslsdnkltelpkyihklnnlrklhvnrnnmvkitdsishlnnicslefsgniitdvpieikncqkiik
ENSGGOP00000024701  pqccdcketelecvngdlksvpmisnnvtlllpiqgeknglhtvsdkvfikytklkkiflqhncirhisrkaffglyn
ENSGGOP00000027247  slaslpkiddfsfqwlkclehlnmedndipgiksnmftglinlkylslsnsftslrtltnetfvslahsplhilnltk
ENSGGOP00000020624  fmsvnescykygqtldlsknsiffvkssdfqhlsflkclnlsgnlisqtlngsefqplaelryldfsnnrldllhsta
ENSGGOP00000009427  vyevhdsddwtihdfecpmecfcppsfptalycenrglkeipaipsriwylyl.........................
ENSGGOP00000006033  cfadlacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkinfsnnkitdieega
ENSGGOP00000028049  cfadlacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkinfsnnkitdieega
ENSGGOP00000022833  lfmlsgvpdavfdltdldvlklelipeakipakisqmtnlqelhlchcpakveqtafsflrdhlrclhvkftdvaeip
ENSGGOP00000008475  lfdsfsltrvdcsglgphimpvpipldtahldlssnrlemvnesvlagpgyttlagldlshnlltsisptafsrlryl
ENSGGOP00000001704  pckmvdkkvscqglgllqvpsvlppdtetldlsgnqlrsilasplgfytslrhldl......................
ENSGGOP00000002826  tevhctfryltsipdsippnverinlgynslvrlmetdfsgltklellmlh...........................
ENSGGOP00000008650  evpehlfysqditylnlrhnfmqlerpggldtlykfsqlkglnlshnklglfpillceistltelnlscngfhdlpsq
ENSGGOP00000013968  pctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpeklnvfrtvreitgfl
ENSGGOP00000007909  sveslnlqkhhfsdissttfqcftqlqeldltathlkglpsgikglnllkklvls.......................
ENSGGOP00000003513  aktsvyshivslnlhgnslsklrdlskltglrklnisfneftclddvyhlynleyldashnhvitlegfrglmklkhl
ENSGGOP00000016854  flqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkglyassnelvqldvypvpnylsymdvsrnrl
ENSGGOP00000022025  kaldlslnsiffigpnqfenlpdiaclnlsansnaqvlsgtefsaiphvkyldltnnrldfdnasaltelsdlevldl
ENSGGOP00000012021  kaldlslnsiffigpnqfenlpdiaclnlsansnaqvlsgtefsaiphvkyldltnnrldfdnasaltelsdlevldl
ENSGGOP00000027247  ctvshevadcshlkltqipddlptnitvlnlt..............................................
ENSGGOP00000012881  pvqclcqgleldcdetnlravpsvssnvtamslq............................................
ENSGGOP00000013469  glcpkeckvgtktidsiqaaqdlvgcthvegslilnlrqgynlepqlqhslglvetitgflkikhsfalvslgffknl
ENSGGOP00000014079  richcsnrvflcqeskvteipsdlprnavelrfvltklrviqkgafsgfgdlekieisqndvlevieadvfsnlpklh
ENSGGOP00000021874  pvqclcqgleldcdetnlravpsvssnvtamsl.............................................
ENSGGOP00000020681  tvecgalrlrvvplgippgtqtlflqdnniarlepgalaplaalrrlyl.............................
ENSGGOP00000013987  tvecgalrlrvvplgippgtqtlflqdnniarlepgalaplaalrrlyl.............................
ENSGGOP00000024070  qristvdlscysleevpehlfysqditylnlrhnfmqlerpggld.................................
ENSGGOP00000013477  glpaadat......................................................................
ENSGGOP00000005073  lqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkglyassnelvqldvypvpnylsymdvsrnrle
ENSGGOP00000018071  vcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylllfrvygleslk...........
ENSGGOP00000007465  lslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialntveriplenlqiirgnmyyensyala......
ENSGGOP00000027332  elk...........................................................................
ENSGGOP00000013375  cpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylllfrvygleslk............
ENSGGOP00000023252  lilfslv.......................................................................
ENSGGOP00000008663  cpkycvcqnlseslgtlcpskgllfvppdidrrtvelrlgg.....................................
ENSGGOP00000027539  ssvr..........................................................................
ENSGGOP00000008275  stiyslnmehnrinkipfgifsrakvlsklnmkdnqltslpldfgtwtsmvelnlatnql..................
ENSGGOP00000012531  cgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrvagleslgdlfpnltvirgwk
ENSGGOP00000009848  dkleilqcgpwdtlqqvttvtfqdlpgcvlstlaectnlqflslrrcgltslhslsnckklkyidaqenhieaiecen
ENSGGOP00000005706  nelqefpvairtlgrlqelgfhnnnikaipekafmgnpllqtihfydnpiqfvgrsafqylpklhtlslngatdiqef
ENSGGOP00000004424  pcarvcyglgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetleeitgylyisa
ENSGGOP00000004424  rhlyqgcqvvqgnleltylptnaslsflqdiqevqgyvliahnqvrqvplqrl.........................
ENSGGOP00000003450  acphpcacyvpsevhctfrslasvpagiakhverinlg........................................
ENSGGOP00000005521  krlhtvhlynnalervpsglprrvrtlmil................................................
ENSGGOP00000024070  lrtlyassnrltsvnvypvpslltsldlsrnllecvpdwaceakkievldvsynlltevpgsplrilsslslrklmlg
ENSGGOP00000004344  rqsslpkdrgkrssafvfelsgehwtelpdslkeqthlrewhis..................................
ENSGGOP00000024903  l.............................................................................
ENSGGOP00000007876  nittvslweefss.................................................................
ENSGGOP00000002850  ynnldefptairtlsnlkelgfhsnnirsipekafvgnpslitihfydnpiqfvgrsafqhlpelrtltlngasqite
ENSGGOP00000001704  rplsqlln......................................................................
ENSGGOP00000024790  ytr...........................................................................
ENSGGOP00000012480  dlr...........................................................................
ENSGGOP00000004216  qcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplaelaalnlsgsrldevragaf
ENSGGOP00000026324  qcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplaelaalnlsgsrldevragaf
ENSGGOP00000022546  elpeerelmtncsnmslrkvpad.......................................................
ENSGGOP00000006438  allrlllphnrlvslpralgsgfphlqlldvsgnaltalgpellalrglrtllaknnrlggpsalpkglaqsplc...
ENSGGOP00000009953  sggkntkiitlngkkmtk............................................................
ENSGGOP00000001696  pcdvytylhekyldcqerklvyvlpgwpqdllhmllarnkirilknnmfskfkklksldlqqneiskieseaffglnk
ENSGGOP00000027978  gmtd..........................................................................
ENSGGOP00000023252  rcscprvntvdcegldlrvfpdnitraaqhlslqnnqlqelpynelsrlsglrtlnlhnnlxxxxxxxxxxxesltql
ENSGGOP00000023288  iscpspctcsnnivdcrgkglmeipanlpegiveirle........................................
ENSGGOP00000000058  wshlrlpwvdldwlidi.............................................................
ENSGGOP00000022509  hacpagcactdphtvdcrdrglpsvpdpfpldvrkllva.......................................
ENSGGOP00000027332  rcscprvntvdcegldlrvfpdnitraaqhlslqnnqlqelpynelsrlsglrtlnlhnnlesltqlqhlcvahnkls
ENSGGOP00000012870  drsknglirvpkdlsq..............................................................
ENSGGOP00000010388  levdcsglglttvppdvpaatrtllll...................................................
ENSGGOP00000028222  lrevpeglpanvttlsl.............................................................
ENSGGOP00000010955  dcayrdlesvppgfpanvttlsl.......................................................
ENSGGOP00000028499  dcayrdlesvppgfpanvttlsl.......................................................
ENSGGOP00000009373  fqlkdrgl......................................................................
ENSGGOP00000015422  vncnwlflksvphfsmaaprgnvtslslssnrihhlhdsdfahlpslrrlnlkwncppvglspmhfpchmtiepstfl
ENSGGOP00000026779  dlrempldkmvdlsgsqlrrfplhvcsfrelvklylsdnhlns...................................
ENSGGOP00000011147  aapmttrvliitdgylssiestnlsllfnlallslsrngiedvqedalhgltmlrtlllehnqisss...........
ENSGGOP00000013381  tlnlsnrrlkhfprgaarsydlsditqadlsrnrfpev........................................
ENSGGOP00000001892  gssgilslsgrklrdfpgsgydltdttqadlsrnrfte........................................
ENSGGOP00000023288  vacptkctcsaasvdchglglravprgiprnaerldl.........................................
ENSGGOP00000020624  tldvpknhvivdctdkhlteipggiptnttnltltinhipdispasfhrldhlveidfrcncvpiplgsknnmcikrl
ENSGGOP00000021650  ng............................................................................
ENSGGOP00000018071  ggynlaaeleanlglieeisgylkirrsy.................................................
ENSGGOP00000013375  mnssnlaaeleanlglieeisgylkirrsy................................................
ENSGGOP00000007909  ekeanktyncenlglseipdtlpntteflef...............................................
ENSGGOP00000020706  dyylddiidlfncltnvssfslvsvtiervkdfsynfgwqhlelvnckfgqfptlklkslkrltftsnkggnafsevd
ENSGGOP00000021036  dyylddiidlfncltnvssfslvsvtiervkdfsynfgwqhlelvnckfgqfptlklkslkrltftsnkggnafsevd
ENSGGOP00000025923  cqekniqsmselipkplnakklhvngnsikdvdvsdftdfegldllhlg.............................
ENSGGOP00000001368  scpdkcycqsstnfvdcsqqglaeipshlppqtrtlhl........................................
ENSGGOP00000020939  rlekhknlflnyrnlhhfplellkdeglqylerlymk.........................................
ENSGGOP00000023533  rlekhknlflnyrnlhhfplellkdeglqylerlymk.........................................
ENSGGOP00000003534  ldvrkllva.....................................................................
ENSGGOP00000013469  evcpsldirsevaelrqlencsvveghlqillmftatgedfrglsfprltqvtdylllfrvyglqslrd.........
ENSGGOP00000015192  lpprlftlpllhylevsgcgslrapgpglaqglpqlhslvlrrnalgpglspelgplpalrvldlsgnalealppgqg
ENSGGOP00000026520  lpprlftlpllhylevsgcgslrapgpglaqglpqlhslvlrrnalgpglspelgplpalrvldlsgnalealppgqg
ENSGGOP00000008114  gtscpvlctcrnqvvdcssqrlfsvppdlpmdtrnlsla.......................................
ENSGGOP00000026663  nrt...........................................................................
ENSGGOP00000003265  p.............................................................................
ENSGGOP00000005450  scpamctcsngivdcrgkgltaipanlpetmteirle.........................................
ENSGGOP00000002218  fnnisellprplnakklylssnliqkiyrsdfwnfssldllhl...................................
ENSGGOP00000004826  dcpevctcvpgglascsalslpavpaglslrlralll.........................................
ENSGGOP00000026086  cptacicatdivsctnknlskvpgnlfrlikrldlsynriglldsewipvsfaklntlil..................
ENSGGOP00000022939  dis...........................................................................
ENSGGOP00000012492  dlsr..........................................................................
ENSGGOP00000024274  vscpaaclcasnilscskqqlpnvphslpsytalldlshnnlsrlraewtptrltqlhslll................
ENSGGOP00000023118  qisdlglnvncqerkiesiaelqpkpynpkkmyltenyiavvrrtdfleatgldllhl....................
ENSGGOP00000007876  cklvggaadcrgqslasvpsslppharmlildanplrtlwnhslqpyplleslslhschl..................
ENSGGOP00000010514  hlcvqqplqllqveflrlsthedpqlleatlaqlpqslsclrslvlkggqrrdtlgaclrgaltnlpaglsglahlah
ENSGGOP00000023229  svendtlktlstlktlelwknklvpsalsaslevlklndnsinvphgsdfegfkklkilklknnlisslspstfstlv
ENSGGOP00000028543  l.............................................................................
ENSGGOP00000016064  envlnincenkgfttvsllqppqyriyqlflngnlltrlypnefvnysnavtlhlg......................
ENSGGOP00000016064  nglnvncqerkftnisdlqpkptspkklyltgnylqtvykndlleyssldllhl........................
ENSGGOP00000022050  l.............................................................................
ENSGGOP00000007162  skcpnnclcqaqevictgkqlteypldiplntrrlfl.........................................
ENSGGOP00000023394  nnrnvssladlkpklsnvqelflrdnkihsirkshfvdyknlilldl...............................
ENSGGOP00000016854  asqrissvdlsccslehlpanlfysqdlthlnlkqnflrqnpslpaargln...........................
ENSGGOP00000027736  ycpipcnckvlspsgllihcqernieslsdlrpppqnprklilagniihslmksdlveyftlemlhlg..........
ENSGGOP00000005073  asqrissvdlsccslehlpanlfysqdlthlnlkqnflrqnpslpaargln...........................
ENSGGOP00000025004  lgefpqaikalpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnlsdlhslvirgasmvqqfp.
ENSGGOP00000025833  fpqaikalpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnlsdlhslvirgasmvqqfp....
ENSGGOP00000002210  ppd...........................................................................
ENSGGOP00000010355  lhncpykcicaadllsctglglqdvpaelpaatadldl........................................
ENSGGOP00000028049  hcpaactcsnnivdcrgkglteiptnlpetiteirle.........................................
ENSGGOP00000023394  hvdcekkgftslqrftaptsqfyhlflhgnsltrlfpnefanfynavslhme..........................
ENSGGOP00000015593  piekmd........................................................................
ENSGGOP00000012568  gt............................................................................
ENSGGOP00000023118  lseispprfpiyhlllsgnllnrlypnefvnytgasilhlg.....................................
ENSGGOP00000025923  venvlyvncekvsvyrpnqlkppwsnfyhlnfqnnflnilypntflnfshavslhlg.....................
ENSGGOP00000027736  qlsllnngltmlhtndfsgltnaisihlg.................................................
ENSGGOP00000000821  pse...........................................................................
ENSGGOP00000021010  s.............................................................................
ENSGGOP00000001364  rlvlcndmdmnelptnlpvdtvklriektv................................................
ENSGGOP00000020706  vvpnityqcmelnfykipdnlpfstknldl................................................
ENSGGOP00000021036  vvpnityqcmelnfykipdnlpfstknldl................................................
ENSGGOP00000020993  ipqhinstvhdlrl................................................................
ENSGGOP00000002485  klevkerdltdiyllrsyihlryvdisenhltdlsplnylthllwlkadgnrlrsaqlnelpylqiasfaynqitdte
ENSGGOP00000027543  nrt...........................................................................
ENSGGOP00000019774  ta............................................................................
ENSGGOP00000010786  secqwneyiltncsftrkcdipvdisqtaatvdisfsffrvllqshtkkeewkikhldl...................
ENSGGOP00000024131  klevkerdltdiyllrsyihlryvdisenhltdlsplnylthllwlkadgnrlrsaqlnelpylqiasfaynqitdte
ENSGGOP00000002218  pcycevkeslfhihcdskgftnisqitefwsrpfklylqr......................................
ENSGGOP00000008273  ta............................................................................
ENSGGOP00000015431  llglgnlthlslkynnltvvprnlpssleylllsynrivklapedlanltalrvldvggncrrcdhapnpcmecprhf
ENSGGOP00000008661  mnimmltisdtpfihmlcphapstfkflnftqnvftdsifekcstlvkletlilqknglkdlfkvglmtkdmpsleil
ENSGGOP00000027149  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlrii.....................
ENSGGOP00000013614  qgdhinlvssslssfpilqrsseekilysdrlslerqkltvcpiingedhlrllnfqhnfitriqnisnlqklisldl
ENSGGOP00000001884  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlrii.....................
ENSGGOP00000017691  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlrii.....................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ldfrn.........................................................................
ENSGGOP00000025013  ldfrn.........................................................................
ENSGGOP00000019011  nelptnlpvdtvklriektv..........................................................
ENSGGOP00000012497  fptcllctcisttvycddheldaipplpkntayfysr.........................................
ENSGGOP00000017205  krldlskmgitt..................................................................
ENSGGOP00000004288  krldlskmgitt..................................................................
ENSGGOP00000012465  rtlqctsvslgkipgnlseefkqvriensp................................................
ENSGGOP00000000942  ky............................................................................
ENSGGOP00000012474  ppdtsrlrlerta.................................................................
ENSGGOP00000000462  ihaiitlkildysdkqatlipdevfdavksniitsvnfsknqlceipkrmvelkemvsdvdlsfnklsfisl......
ENSGGOP00000022001  glqklgpnlpceadihtlildknqiiklenlekckrliqlsvannrlvrmmgvakltllrvlnlphnsigcv......
ENSGGOP00000025605  glqklgpnlpceadihtlildknqiiklenlekckrliqlsvannrlvrmmgvakltllrvlnlphnsigcv......
ENSGGOP00000005450  lpe...........................................................................
ENSGGOP00000000638  ldiskcelseipfgafatckvlqk......................................................
ENSGGOP00000017288  gskcpnnclcqaqevictgkqlteypldiplntrrlfl........................................
ENSGGOP00000008256  vtckdiqrips...................................................................
ENSGGOP00000015431  pcelqphglvncnwlflksvphfsmaaprgnvtslslssnrihhlhdsdfahlpslrrlnlkwncppvglspmhfpch
ENSGGOP00000000795  vif...........................................................................
ENSGGOP00000007172  psectcsrasqvectgarivavptplpwnamslqiln.........................................
ENSGGOP00000027628  lhcnn.........................................................................
ENSGGOP00000002833  cpepcacvdkyahqfadcaykelrevpeg.................................................
ENSGGOP00000017434  kemaqlkltlnkrydvsqqaldlqrlrfdpdlvkhhidiilnqrnymaatlk..........................
ENSGGOP00000010817  tltpvktsefenfktkmvitskkdyplsknfpyslehlqtsycglvrvdmrm..........................
ENSGGOP00000011344  krrihlelrnrtpa................................................................
ENSGGOP00000020930  krrihlelrnrtpa................................................................
ENSGGOP00000015568  lptclvcvclgssvycddidledipplprrtaylyar.........................................
ENSGGOP00000015042  rihlelrnrtpsd.................................................................
ENSGGOP00000018300  vtckdiqrips...................................................................
ENSGGOP00000026851  nltlsgcnlidvsilcgyvhlqkldlsankiedlscvscmpyllelnasqnnlttffnfkppknlkneie........
ENSGGOP00000026693  hlelrnrtpsd...................................................................
ENSGGOP00000015068  rnfg..........................................................................
ENSGGOP00000004548  lgglvlltdlllsqn...............................................................
ENSGGOP00000006033  hcpaactcsnni..................................................................
ENSGGOP00000027647  lkgneie.......................................................................
ENSGGOP00000027539  scsfdgriafyrfcnltqvpqvlntterlll...............................................
ENSGGOP00000012360  ek............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  rgd...........................................................................
ENSGGOP00000005584  se............................................................................
ENSGGOP00000019188  qqrnylgklkflslmpcivslketfwgvagtpphirkvdlsknllsswdevihiadqlrhlevlnvsenklkfpsgsv
ENSGGOP00000015022  alknlevlglddnkigqlps..........................................................
ENSGGOP00000021155  gy............................................................................
ENSGGOP00000006065  ptcllcvclsgsvyceevdidavpplpkesaylyar..........................................
ENSGGOP00000008763  v.............................................................................
ENSGGOP00000008108  tfr...........................................................................
ENSGGOP00000013299  irkvdlsknllsswdevihiadqlrhlevlnvsenklkfpsgsvltgtlsalkvlvlnqtgitwaevlrca.......
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ncwwg.........................................................................
ENSGGOP00000025379  t.............................................................................
ENSGGOP00000010879  esil..........................................................................
ENSGGOP00000008240  vfcslrg.......................................................................
ENSGGOP00000004098  etis..........................................................................
ENSGGOP00000017344  cpaqcs........................................................................
ENSGGOP00000018814  svlvlnscgitcagdekeiaafcahvseldlsdnkledwhevskivsnvpqleflnlssnplnlsvlertcagsfsgv
ENSGGOP00000025873  vlvlnscgitcagdekeiaafcahvseldlsdnkledwhevskivsnvpqleflnlssnplnlsvlertcagsfsgvr
ENSGGOP00000004959  dv............................................................................
ENSGGOP00000024368  mkrrihlelrnwtp................................................................
ENSGGOP00000011594  lelrnrspe.....................................................................
ENSGGOP00000014157  fhsvvyinasen..................................................................
ENSGGOP00000013487  lpg...........................................................................
ENSGGOP00000022399  iregqkdfv.....................................................................
ENSGGOP00000016688  vtlvd.........................................................................
ENSGGOP00000023599  tldlaecklvsfpigiykvlrnvsgq....................................................
ENSGGOP00000013768  dlaecklvsfpigiykvlrnvsgq......................................................
ENSGGOP00000012563  hgtf..........................................................................
ENSGGOP00000008281  qpelveslslqgsyag..............................................................
ENSGGOP00000021469  wki...........................................................................
ENSGGOP00000006875  dat...........................................................................
ENSGGOP00000017558  prdcvcypapmt..................................................................
ENSGGOP00000007076  vttldy........................................................................
ENSGGOP00000008661  avdkskrglihvpkdl..............................................................
ENSGGOP00000002527  hfa...........................................................................
ENSGGOP00000025482  hselpnrapsdvkel...............................................................
ENSGGOP00000028761  i.............................................................................
ENSGGOP00000010362  dla...........................................................................
ENSGGOP00000000179  s.............................................................................
ENSGGOP00000024608  tf............................................................................
ENSGGOP00000025066  rv............................................................................
ENSGGOP00000023515  vlpfvrgvdlsgndfkggy...........................................................
ENSGGOP00000003028  lpfvr.........................................................................
ENSGGOP00000023998  tlnavdm.......................................................................
ENSGGOP00000009979  tlnavdm.......................................................................
ENSGGOP00000024063  v.............................................................................
ENSGGOP00000025398  ksdr..........................................................................
ENSGGOP00000008650  ldrvvmag......................................................................
ENSGGOP00000025808  lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaa..........................
ENSGGOP00000003989  lkpgqmemlkltmnkwynvsqqaldlqnlrfdpdlmgrdidiilnqr...............................
ENSGGOP00000010116  srlkeltledlkitgtmpplpleatglalsslrlrnvswatgrswlaelqqwlkpglkvlsiaqahspafsceqvraf
ENSGGOP00000012588  t.............................................................................
ENSGGOP00000013959  eiineddv......................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie....................
ENSGGOP00000027053  t.............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  aactcagd......................................................................
ENSGGOP00000018989  daa...........................................................................
ENSGGOP00000017510  gkwihlelwnrtps................................................................
ENSGGOP00000028171  lksekveqiklamnqqcdvsqealdlqrlpfypgdmvnrdtkmasnprkcmaasldvheenip...............
ENSGGOP00000003513  gh............................................................................
ENSGGOP00000026797  cln...........................................................................
ENSGGOP00000016519  cln...........................................................................
ENSGGOP00000025973  tcpsvcrcdngf..................................................................
ENSGGOP00000003012  s.............................................................................
ENSGGOP00000028210  t.............................................................................
ENSGGOP00000025364  cpsvcrcdag....................................................................
ENSGGOP00000007122  cqyvffsltgkv..................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  rklnlshnqlpalpaqlgalahleeldvsfnrlahlpdslsclsrlrtldvdhnqltafprqllqlaaleeldvssnr
ENSGGOP00000026867  tfeklsrleelylgnnllqalapgtlaplrklrilyangneisrlsrgsfegleslvklrldgnalgalpdavfapls
ENSGGOP00000014553  nfnmlea.......................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  vnlqelal......................................................................
ENSGGOP00000005919  lleqldlsdnaqlrsvdpatfhglgrlhtlhld.............................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  lrlsknritqlpvrafklprltqldlnrnrirliegltfqglnslevlklq...........................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000025646  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  ..............................................................................
ENSGGOP00000027814  leeldlgdnrhlrslepdtfqglerlqslhlyr.............................................
ENSGGOP00000009302  leeldlgdnrhlrslepdtfqglerlqslhlyr.............................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  kaleiadfsgnplsrlpdgftqlrslahlalndvslqal.......................................
ENSGGOP00000003137  slntlelfdnrlttvptqafeylsklrelwlrnnpiesipsyafnrvpslrrldlgelkr..................
ENSGGOP00000019249  slntlelfdnrlttvptqafeylsklrelwlrnnpiesipsyafnrvpslrrldlgelkr..................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  pkafvqlrhlyflfl...............................................................
ENSGGOP00000026305  aslntlelfdnwltvipsgafeylsklrelwlrnnpiesipsyafnrvpslmrldlgelkk.................
ENSGGOP00000009400  aslntlelfdnwltvipsgafeylsklrelwlrnnpiesipsyafnrvpslmrldlgelkk.................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  pqmrrlvhlqtlvlngnpllhaqlrqlpamtalqtlhlrstqrtqsnl..............................
ENSGGOP00000003028  pqmrrlvhlqtlvlngnpllhaqlrqlpamtalqtlhlrstqrtqsnl..............................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  nlntlelfdnrlttipngafvylsklkelwlrnnpiesipsyafnripslrrldlgelk...................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000019824  dlssniiseiktssfprmqlkylnlsnnrittleagcfdnlsssllvvklnrnrismippkifklphlqflelk....
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  lrlahngdlrylhartfaalgrlrrldlaacrlfsvperllaelpalrelaafdnlfrrvpgalrglanlthahlerg
ENSGGOP00000006124  rnqlrslalgtfahtpalaslglsnnrlsrledglfeglgslwdlnlg..............................
ENSGGOP00000015799  mqrngvtklmdgafwglsnmeilql.....................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  iegvdkltrlkklflvnnkiskienlsnlhqlqmlelgsnriraienidtltnleslflgknk...............
ENSGGOP00000018354  lleqlfl.......................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  qlveldvsrndipeipesikfckaleiadfsgnplsrlpdgftqlrslahlalndvslqa..................
ENSGGOP00000013132  rliylylsdnqlaglstaalegaprlgylylernrflqvpgaalralpslfslhlqdnavdrlapgdlggtralrwvy
ENSGGOP00000024818  rliylylsdnqlaglstaalegaprlgylylernrflqvpgaalralpslfslhlqdnavdrlapgdlggtralrwvy
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  keiplwiyslktleelhltgnlsaennryividglrelkrlkvlrlksnlsklpqvvtdvgvhlqklsinnegtkliv
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  fehltnlnylylannkltlaprflpnalisvdfaa...........................................
ENSGGOP00000001854  aislkllflsknhlssvpvglpvdlqelrvd...............................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  pawvyllknlrelylvgnlnsennkmigleslrelrhlkilhvksnltkvpsnitdvaphltklvihndgtkllvlns
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  lnylylannkltlaprflpnalisvdfaa.................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  snylrllflsrnhlstipwglprtieelrl................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  lmltgnqletvhgrvfrglsglktlmlrsnliscvsndtfaglssvrllslydnrittitpgafttlvslstinllsn
ENSGGOP00000010210  lmltgnqletvhgrvfrglsglktlmlrsnliscvsndtfaglssvrllslydnrittitpgafttlvslstinllsn
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  dmrelppwmyglrnleelylvgslshdisrnvtleslrdlkslkilsiksnvskipqavvdvsshlqkmcihndgt..
ENSGGOP00000003265  qlveldvsrneipeipesisfckalqvadfsgnpltrlpesfpelqnltclsvndislqs..................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  ..............................................................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  ..............................................................................
ENSGGOP00000022805  elrevplwvfglrgleelhleglfpqelaraatleslrelkqlkvlslrsnagkvpasvtdvaghlqrlslhndgarl
ENSGGOP00000025292  ..............................................................................
ENSGGOP00000025973  qlkllflsrnhlssipsglphtleelrl..................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  synsqpfgmqgvghnfsfvahlrtlrhlslahnnihsqvsqqlcstslraldfsgnalghmwaegdlylhffqglsgl
ENSGGOP00000015431  synsqpfgmqgvghnfsfvahlrtlrhlslahnnihsqvsqqlcstslraldfsgnalghmwaegdlylhffqglsgl
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  grvfsklkqlkklhinhnnltesvgplpksledlqlt.........................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  ..............................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  liq...........................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ielsynkimyfplglcaldslyylsvngnyiseipvdisfskqllhlelsenkl........................
ENSGGOP00000024701  lqilyl........................................................................
ENSGGOP00000027247  nkiskiesdafswlghlevldlglneigqeltgqewrglenifeiylsynkylqltrnsfalvpslqrlmlrrvalkn
ENSGGOP00000020624  feelnklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslrtlefrgnhldvlwregd
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  fegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgndsfiglssvrllslydnqittvapgafdtlhs
ENSGGOP00000028049  fegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgndsfiglssvrllslydnqittvapgafdtlhs
ENSGGOP00000022833  awvyllknlrelylvgnlnsennkmigleslrelrhlkilhvksnltkvpsnitdvaphltklv..............
ENSGGOP00000008475  esldlshngltalpaesftssplsdvnlshnqlrevsvsaftthsqgralhvd.........................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  ignllnlqtlcldgnflttlpeelgnlqqlsslgisfnnfsqipevyekltmldrvvmagnclevlnlgvlnrmnhik
ENSGGOP00000013968  niqswppnmtdfsvfsnlvtiggrvl....................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  dlswnqlkksgdeinmlckhttslltldiqhnpwqkpatlrlsvigrlktlthlngvfiseeeataamkfiagtritq
ENSGGOP00000016854  env...........................................................................
ENSGGOP00000022025  synshyfriagvthhlefiqnftnlkvlnlshnniytltdkynleskslvelvfsgnrldilwndddnr.........
ENSGGOP00000012021  synshyfriagvthhlefiqnftnlkvlnlshnniytltdkynleskslvelvfsgnrldilwndddnr.........
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  klirgdamvdgnytly..............................................................
ENSGGOP00000014079  eiriek........................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  nv............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  lfynyalv......................................................................
ENSGGOP00000009848  lenlcvvllnknqltslhgldgctniqclelshnkitrigysffleenlvdntgfchhlgtstsylslaqvwiptglc
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  wpdslpdlsifqnlqvirgrilhngays..................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  hnhvqnlptlvehiplevldl.........................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ehlpslrqldlshnpladlspfafsgsnasvsapsplvelilnhivppederqnrsfegmvvaallagr.........
ENSGGOP00000026324  ehlpslrqldlshnpladlspfafsgsnasvsapsplvelilnhivppederqnrsfegmvvaallagr.........
ENSGGOP00000022546  ..............................................................................
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  lttlllqhnqikvlteevfiytpllsylrlydnpwhctceietlismlqiprnrnlgnyakcespqeqknkklrqiks
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  qhlcvahnklsvapqflprslrvadla...................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ..............................................................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  vapqflprslrvadla..............................................................
ENSGGOP00000012870  ..............................................................................
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  avptleelnlsynnimtvpalpkslislslshtnilmldsaslaglhalrflfmdgncyyknpcrqalevapgallgl
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  qikprsfsgltylkslyldgnqlleipqglppslqllsleannifsirkenltelanieilylgqncyyrnpcyvsy.
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000020706  lpslefldlsrnglsfkgccsqsdfgttslkyldlsfngvitmssnflgleqlehldfqhsnlkqmsefsvflslrnl
ENSGGOP00000021036  lpslefldlsrnglsfkgccsqsdfgttslkyldlsfngvitmssnflgleqlehldfqhsnlkqmsefsvflslrnl
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  lgpaep........................................................................
ENSGGOP00000026520  lgpaep........................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ..............................................................................
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ldlsfnsletlpacvlqmrg..........................................................
ENSGGOP00000023229  slqslmldgnnveatagplilphlthmslennklhliqslqflsfsgnflskvpinlpksllslkmernhlrivrfrh
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  gishprletlnlk.................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  gishprletlnlk.................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  dvswnslesgrhke................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ydnqieeisglstlrclrvlllgkn.....................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ltgtlsalkvlvlnqtgitwaevlrca...................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  rklvlnnskaswetv...............................................................
ENSGGOP00000025873  klvlnnskaswetv................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ..............................................................................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  paltsldlsdnpglgergliaalcphkfpaiqnlalrntgmetptgvcaalaaagvq.....................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  lrglpedisalralkilwlsgaelgt....................................................
ENSGGOP00000026867  nllylhlesnrirflgknafaqlgklrflnlsanelqpslrhaatfaplrslsslil.....................
ENSGGOP00000014553  ..............................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000025646  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  ..............................................................................
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  ..............................................................................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  ..............................................................................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  rieavass......................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  ..............................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  l.............................................................................
ENSGGOP00000024818  l.............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  lnslkkmanltelelircdleriphsifslhnlqeidlkdnnlktieeiisfqhlhrltclklwynhiay........
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  lkkmmnvaelelq.................................................................
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  pfncnchlawlgkwlrkrrivsgnprcqkpfflkeipiqdvaiqdftcdgndesscqlsprcpeqctcmetvvrcsnk
ENSGGOP00000010210  pfncnchlawlgkwlrkrrivsgnprcqkpfflkeipiqdvaiqdftcdgndesscqlsprcpeqctcmetvvrcsnk
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  ..............................................................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  ..............................................................................
ENSGGOP00000022805  valnslkklaalrelelvacgleriphavfslgalqeldlkdnhlrsi..............................
ENSGGOP00000025292  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  iwldl.........................................................................
ENSGGOP00000015431  iwldl.........................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  ..............................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  vdss..........................................................................
ENSGGOP00000020624  nrylq.........................................................................
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  lstlnllanpfncncylawlgewlrkkrivtgnprcqkpyflkeipiqdvaiqdftcddgnddnscsplsrcptectc
ENSGGOP00000028049  lstlnllanpfncncylawlgewlrkkrivtgnprcqkpyflkeipiqdvaiqdftcddgnddnscsplsrcptectc
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  hvdlrmnhlktmvienlegnkhvthvdlrdnrltdldlsslcsleqlhcgrnqlreltlsgfslrtlyassnrltsvn
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  lsllrhsstkeerprilsiwpsakiltqisklgphlhpsgncylkitalnldgqhlfeitnleklenlkwasfsnnnl
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  wsripvtsltknsdcnflishlywncgleslknlqqlildhnqlintkglcdtptivyldcshnhl............
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  ..............................................................................
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  eqlcneeekeqldpkpqvsgrppvikpevdstfchnyvf.......................................
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ..............................................................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  ..............................................................................
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  gnlthlslkynnltvvprnlpssleylllsynrivklapedlanltalrvldvggncrrcdhapnpcmecprhf....
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000020706  iyldishth.....................................................................
ENSGGOP00000021036  iyldishth.....................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ..............................................................................
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  lylsenllssingaqfltnltalelsqnqlqilpfrlpvklqkldc................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ..............................................................................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  ..............................................................................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  ..............................................................................
ENSGGOP00000026867  ..............................................................................
ENSGGOP00000014553  ..............................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000025646  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  ..............................................................................
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  ..............................................................................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  ..............................................................................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  ..............................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  ..............................................................................
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  glralpkg......................................................................
ENSGGOP00000010210  glralpkg......................................................................
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  ..............................................................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  ..............................................................................
ENSGGOP00000022805  ..............................................................................
ENSGGOP00000025292  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  ..............................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  ldtvvrcsnkglkvlpkg............................................................
ENSGGOP00000028049  ldtvvrcsnkglkvlpkg............................................................
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  vypvpslltsldlsrnllecvpdwaceakkievldvsynlltevpvrilsslslrklmlghnhvqnlptlvehiplev
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  tkmeglescinleeltldgnciskiegiskmtkltrlsinnnlltgweehtfdnmlhlhslslennritslsglqksf
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  ..............................................................................
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  ..............................................................................
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ..............................................................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  ..............................................................................
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ..............................................................................
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  ..............................................................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ..............................................................................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  ..............................................................................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  ..............................................................................
ENSGGOP00000026867  ..............................................................................
ENSGGOP00000014553  ..............................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000025646  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  ..............................................................................
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  ..............................................................................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  ..............................................................................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  ..............................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  ..............................................................................
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  ..............................................................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  ..............................................................................
ENSGGOP00000022805  ..............................................................................
ENSGGOP00000025292  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  ..............................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  ldl...........................................................................
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  tlvelyisnnyiavnqemynlkglcnlvildmcgniiiwnqenyrlfvifhlpelkaldgipieppetdsakdlfggr
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  ..............................................................................
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  ..............................................................................
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ..............................................................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  ..............................................................................
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ..............................................................................
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  ..............................................................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ..............................................................................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  ..............................................................................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  ..............................................................................
ENSGGOP00000026867  ..............................................................................
ENSGGOP00000014553  ..............................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000025646  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  ..............................................................................
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  ..............................................................................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  ..............................................................................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  ..............................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  ..............................................................................
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  ..............................................................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  ..............................................................................
ENSGGOP00000022805  ..............................................................................
ENSGGOP00000025292  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  ..............................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  ltsdmiaerqghsnfkqmqelnwtsssirtvdlipvdqfrnvcnvnlqnnhltsfsgliylpnvkvlclnynhiesim
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  ..............................................................................
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  ..............................................................................
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ..............................................................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  ..............................................................................
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ..............................................................................
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  ..............................................................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ..............................................................................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  ..............................................................................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                     10         20  
                                                                                      |          |  
d1a9na_               .......................................................----------------AV.RDRE
ENSGGOP00000002818  .......................................................---------LPAGFCELA.SLES
ENSGGOP00000026867  .......................................................-SANSLQHLGPRIFQHLP.RLGL
ENSGGOP00000014553  .......................................................--------LPEGLFQRLA.ALES
ENSGGOP00000006261  .......................................................--SNSIVHVDQSELGYLA.NLTE
ENSGGOP00000007172  .......................................................-QQNQIGLLSPGLFHNNH.NLQR
ENSGGOP00000005919  .......................................................--RCGLQELGPGLFRGLA.ALQY
ENSGGOP00000024063  .......................................................-------EFLPANFGRLT.KLQI
ENSGGOP00000013969  .......................................................--RNNISKLTDGAFWGLS.KMHV
ENSGGOP00000007076  .......................................................-------EFLPANFGRLT.KLQI
ENSGGOP00000015022  .......................................................------------EIFTFT.ELEE
ENSGGOP00000010210  .......................................................--DNQVSVIERGAFQDLK.QLER
ENSGGOP00000025646  .......................................................---------TVDELQQLF.NLTE
ENSGGOP00000008275  .......................................................------------------.----
ENSGGOP00000004396  .......................................................-SGNRLWGLQRGMLSRLS.LLQE
ENSGGOP00000027814  .......................................................---CQLSSLPGNIFRGLV.SLQY
ENSGGOP00000009302  .......................................................---CQLSSLPGNIFRGLV.SLQY
ENSGGOP00000010181  .......................................................--KNRIKTLNQDEFASFP.HLEE
ENSGGOP00000000462  .......................................................---NNKLQSLTDDLRLLP.ALTV
ENSGGOP00000012823  .......................................................---NRLKSVNPEEFISYP.LLEE
ENSGGOP00000008393  .......................................................--FNSIQKLKSNQFAGLN.QLIW
ENSGGOP00000017408  .......................................................----------PGDVGNLA.NLVT
ENSGGOP00000003137  .......................................................-----LEYISEAAFEGLV.NLRY
ENSGGOP00000019249  .......................................................-----LEYISEAAFEGLV.NLRY
ENSGGOP00000013132  .......................................................--GNLLKVIPAAAFQGVP.HLTH
ENSGGOP00000024818  .......................................................--GNLLKVIPAAAFQGVP.HLTH
ENSGGOP00000023908  .......................................................--HNHITELERDQFASFS.QLTW
ENSGGOP00000024673  .......................................................-NNNFIKRLDPGIFKGLL.NLRN
ENSGGOP00000026305  .......................................................-----LEYISEGAFEGLF.NLKY
ENSGGOP00000009400  .......................................................-----LEYISEGAFEGLF.NLKY
ENSGGOP00000007056  .......................................................------------PFGCHC.HLRV
ENSGGOP00000005706  .......................................................-SMNNLTELQPGLFHHLR.FLEE
ENSGGOP00000023515  .......................................................----------PTSLEGLS.NLAD
ENSGGOP00000003028  .......................................................----------PTSLEGLS.NLAD
ENSGGOP00000002850  .......................................................-SMNNISQLLPNPLPSLR.FLEE
ENSGGOP00000006625  .......................................................----RLSYISEGAFEGLS.NLRY
ENSGGOP00000005450  .......................................................-----------GMFKKLT.HLKK
ENSGGOP00000019824  .......................................................--RNRIKIVEGLTFQGLD.SLRS
ENSGGOP00000001938  .......................................................------------PFGCQC.YSRV
ENSGGOP00000006377  .......................................................-QHCQIREVAAGAFRGLK.QLIY
ENSGGOP00000028264  .......................................................------------PFGCQC.YSRV
ENSGGOP00000021709  .......................................................--------------DFPV.NLTG
ENSGGOP00000025918  .......................................................--YNSLQKLKYNQFKGLN.QLTW
ENSGGOP00000008365  .......................................................------------SLQGLR.RLRS
ENSGGOP00000006124  .......................................................--WNSLAVLPDAAFRGLG.SLRE
ENSGGOP00000015799  .......................................................-DHNNLTEITKGWLYGLL.MLQE
ENSGGOP00000010984  .......................................................---------LPSEIQLLH.NLRI
ENSGGOP00000012493  .......................................................-------ITKLQNLDALT.NLTV
ENSGGOP00000018354  .......................................................-DHNALRGIDQNMFQKLV.NLQE
ENSGGOP00000001578  .......................................................-RYNSLSELRAGQFTGLM.QLTW
ENSGGOP00000004548  .......................................................---------LPGDVGNLA.NLVT
ENSGGOP00000013132  .......................................................-SGNRITEVSLGALGPAR.ELEK
ENSGGOP00000024818  .......................................................-SGNRITEVSLGALGPAR.ELEK
ENSGGOP00000025004  .......................................................---NNITQLPEDAFKNFP.FLEE
ENSGGOP00000025833  .......................................................---NNITQLPEDAFKNFP.FLEE
ENSGGOP00000016600  .......................................................---------IPIQIGNLT.NLER
ENSGGOP00000006124  .......................................................--HNRIRQLAERSFEGLG.QLEV
ENSGGOP00000005521  .......................................................---NYLTKIYGLTFGQKP.NLRS
ENSGGOP00000001854  .......................................................--ENRIAVISNMAFQNLT.SLER
ENSGGOP00000019138  .......................................................---NGITMLDTGSFAGLP.GLQL
ENSGGOP00000021712  .......................................................---NCELERIPHAIFSLS.NLQE
ENSGGOP00000015564  .......................................................-QNNFITELPVESFQNAT.GLRW
ENSGGOP00000012531  .......................................................------------------.----
ENSGGOP00000020501  .......................................................---NYLTKIYGLTFGQKP.NLRS
ENSGGOP00000003727  .......................................................-QNNKITEIKDGDFKNLK.NLHA
ENSGGOP00000025379  .......................................................--ANLISLVPERSFEGLS.SLRH
ENSGGOP00000025364  .......................................................-DDNRISTISSPSLQGLT.SLKR
ENSGGOP00000011582  .......................................................-QNNQITSIQEGVFDNAT.GLLW
ENSGGOP00000023288  .......................................................---------------MPK.DVTE
ENSGGOP00000010210  .......................................................---------------MPK.DVTE
ENSGGOP00000019616  .......................................................-DANHITSVPEDSFEGLV.QLRH
ENSGGOP00000026995  .......................................................------KLVMLNNLKKMT.NLTE
ENSGGOP00000003265  .......................................................---------LPENIGNLY.NLAS
ENSGGOP00000024614  .......................................................--RNALTGLPPGLFQASA.ALDT
ENSGGOP00000025637  .......................................................--ENEIAKIPAHTFLGLP.NLEW
ENSGGOP00000014142  .......................................................--DNFIQALGPPDFRNMT.GLVD
ENSGGOP00000013300  .......................................................--GNSIASIPDEAFNGLP.NLER
ENSGGOP00000022805  .......................................................--------EEILSFQHCR.KLVT
ENSGGOP00000025292  .......................................................--GNSIASIPDEAFNGLP.NLER
ENSGGOP00000025973  .......................................................-DDNRISTIPLHAFKGLN.SLRR
ENSGGOP00000002611  .......................................................------------------.----
ENSGGOP00000015422  .......................................................-SQNRLHTLLPQTLRNLPkSLQV
ENSGGOP00000015431  .......................................................-SQNRLHTLLPQTLRNLPkSLQV
ENSGGOP00000000213  .......................................................--ENLLYTFSLATLMPYT.RLTQ
ENSGGOP00000025405  .......................................................--ENLLYTFSLATLMPYT.RLTQ
ENSGGOP00000022526  .......................................................----HNKITKLGSFEGLV.NLTF
ENSGGOP00000014753  .......................................................------------------.---R
ENSGGOP00000020501  .......................................................--HNQITGIGREDFATTY.FLEE
ENSGGOP00000003295  .......................................................---------------HLE.HLEK
ENSGGOP00000022737  .......................................................--DNFIQALGPPDFRNMT.GLVD
ENSGGOP00000007465  .......................................................------------------.----
ENSGGOP00000016887  .......................................................--DNFVTNIKRKDFANMT.SLVD
ENSGGOP00000018050  .......................................................--DNFVTNIKRKDFANMT.SLVD
ENSGGOP00000023473  .......................................................--DNFVTNIKRKDFANMT.SLVD
ENSGGOP00000010984  .......................................................-------LIFSEHFCSLI.NLKY
ENSGGOP00000024701  .......................................................-NHNCITTLRPGIFKDLH.QLTW
ENSGGOP00000027247  .......................................................----------PSPFQPLR.NLTI
ENSGGOP00000020624  .......................................................------------LFKNLL.KLEE
ENSGGOP00000009427  .......................................................-QNNLIETIPEKPFENAT.QLRW
ENSGGOP00000006033  .......................................................---------------IPR.DVTE
ENSGGOP00000028049  .......................................................---------------IPR.DVTE
ENSGGOP00000022833  .......................................................--------IHNDGTKLLS.NLQE
ENSGGOP00000008475  .......................................................------------------.----
ENSGGOP00000001704  .......................................................-STNEISFLQPGAFQALT.HLEH
ENSGGOP00000002826  .......................................................--SNGIHTIPDKTFSDLQ.ALQV
ENSGGOP00000008650  .......................................................-QHNALTRLPDTLFSKAL.NLRY
ENSGGOP00000013968  .......................................................------------------.----
ENSGGOP00000007909  .......................................................--VNHFDQLCQISAANFP.SLTH
ENSGGOP00000003513  prlkpqthltsrqllyqkvpssgygqqgisktnrdimssenlppimhslevlhlg--YNGICNLMKLQLNRLR.NLKF
ENSGGOP00000016854  .......................................................----------PEWVCESR.KLEV
ENSGGOP00000022025  .......................................................---------YISIFKGLK.NLTR
ENSGGOP00000012021  .......................................................---------YISIFKGLK.NLTR
ENSGGOP00000027247  .......................................................--HNQLRRLPAANFTRYS.QLTS
ENSGGOP00000012881  .......................................................--WNLIRKLPPDCFKNYH.DLQK
ENSGGOP00000013469  .......................................................------------------.----
ENSGGOP00000014079  .......................................................--ANNLLYINPEAFQNLP.NLQY
ENSGGOP00000021874  .......................................................-QWNLIRKLPPDCFKNYH.DLQK
ENSGGOP00000020681  .......................................................-HNNSLRALEAGAFRAQP.RLLE
ENSGGOP00000013987  .......................................................-HNNSLRALEAGAFRAQP.RLLE
ENSGGOP00000024070  .......................................................------------TLYKFS.QLKG
ENSGGOP00000013477  .......................................................------------------.---A
ENSGGOP00000005073  .......................................................----------PEWVCESR.KLEV
ENSGGOP00000018071  .......................................................------------------.----
ENSGGOP00000007465  .......................................................------------------.----
ENSGGOP00000027332  .......................................................--NNLISKVPRGALSRQT.QLRE
ENSGGOP00000013375  .......................................................------------------.----
ENSGGOP00000023252  .......................................................-QNNLISKVPRGALSRQT.QLRE
ENSGGOP00000008663  .......................................................---NFIIHISRQDFANMT.GLVD
ENSGGOP00000027539  .......................................................------------------.---H
ENSGGOP00000008275  .......................................................-------TKIPEDVSGLV.SLEV
ENSGGOP00000012531  .......................................................------------------.----
ENSGGOP00000009848  .......................................................--------TDVEGIENCG.LLQI
ENSGGOP00000005706  .......................................................-----------PDLKGTT.SLEI
ENSGGOP00000004424  .......................................................------------------.----
ENSGGOP00000004424  .......................................................------------------.----
ENSGGOP00000003450  .......................................................--FNSIQALSETSFAGLT.KLEL
ENSGGOP00000005521  .......................................................--HNQITGIGREDFATTY.FLEE
ENSGGOP00000024070  .......................................................-QHNALTRLPDTLFSKAL.NLRY
ENSGGOP00000004344  .......................................................---NTLIQIIPTYIELFQ.AMRI
ENSGGOP00000024903  .......................................................-----------------S.HITQ
ENSGGOP00000007876  .......................................................--------------SDLA.DLRF
ENSGGOP00000002850  .......................................................----------FPDLTGTA.NLES
ENSGGOP00000001704  .......................................................------------------.----
ENSGGOP00000024790  .......................................................------------------.-LTQ
ENSGGOP00000012480  .......................................................--FNRIREIQPGAFRRLR.NLNT
ENSGGOP00000004216  .......................................................------------------.----
ENSGGOP00000026324  .......................................................------------------.----
ENSGGOP00000022546  .......................................................---------------LTP.ATTT
ENSGGOP00000006438  .......................................................-----------------R.SLQV
ENSGGOP00000009953  .......................................................---------MPSALGKLP.GLKT
ENSGGOP00000001696  .......................................................------------------.PIQT
ENSGGOP00000027978  .......................................................---------IPDFLWGLS.EVQK
ENSGGOP00000023252  .......................................................--ANQVMEIFPLTFGEKP.ALRS
ENSGGOP00000023288  .......................................................--QNSIKAIPAGAFTQYK.KLKR
ENSGGOP00000000058  .......................................................----------------SC.QITE
ENSGGOP00000022509  .......................................................--GNRIQRIPEDFFIFYG.DLVY
ENSGGOP00000027332  .......................................................--ANQVMEIFPLTFGEKP.ALRS
ENSGGOP00000012870  .......................................................------------------.KTTI
ENSGGOP00000010388  .......................................................--NNKLSALPSWAFANLS.SLQR
ENSGGOP00000028222  .......................................................-SANKIAVLRRGAFADVT.QVTS
ENSGGOP00000010955  .......................................................-SANRLPGLPEGAFREVP.LLQS
ENSGGOP00000028499  .......................................................-SANRLPGLPEGAFREVP.LLQS
ENSGGOP00000009373  .......................................................------TEFPADLQKLTS.NLRT
ENSGGOP00000015422  .......................................................------PQLHPDTFSHLS.RLEG
ENSGGOP00000026779  .......................................................---------LPPELGQLQ.NLQI
ENSGGOP00000011147  .......................................................-------SLTDHTFSKLH.SLQV
ENSGGOP00000013381  .......................................................----------PEAACQLV.SLEG
ENSGGOP00000001892  .......................................................---------IPSDVWLFA.PLET
ENSGGOP00000023288  .......................................................-DRNNITRITKMDFAGLK.NLRV
ENSGGOP00000020624  .......................................................-------SIEKDAFLNLT.KLKV
ENSGGOP00000021650  .......................................................-------------LFTLS.HITQ
ENSGGOP00000018071  .......................................................------------------.----
ENSGGOP00000013375  .......................................................------------------.----
ENSGGOP00000007909  .......................................................-SFNFLPTIHNRTFSRLM.NLTF
ENSGGOP00000020706  .......................................................-----TRVAFNGIFNGLS.SLEV
ENSGGOP00000021036  .......................................................-----TRVAFNGIFNGLS.SLEV
ENSGGOP00000025923  .......................................................--SNQITVIKGDVFHNLT.NLRR
ENSGGOP00000001368  .......................................................-QDNQIHHLPAFAFRSVP.WLMT
ENSGGOP00000020939  .......................................................--RNSLTSLPENLAQKLP.NLVE
ENSGGOP00000023533  .......................................................--RNSLTSLPENLAQKLP.NLVE
ENSGGOP00000003534  .......................................................--GNRIQRIPEDFFIFYG.DLVY
ENSGGOP00000013469  .......................................................------------------.----
ENSGGOP00000015192  .......................................................--------------PGLP.QLQS
ENSGGOP00000026520  .......................................................--------------PGLP.QLQS
ENSGGOP00000008114  .......................................................--HNRITTVPPGYLTCYM.ELQV
ENSGGOP00000026663  .......................................................------------------.--VT
ENSGGOP00000003265  .......................................................-----------ESIGALL.HLKD
ENSGGOP00000005450  .......................................................--LNGIKSIPPGAFSPYR.KLRR
ENSGGOP00000002218  .......................................................-GNNRISYVQDGAFINLP.NLKS
ENSGGOP00000004826  .......................................................-DHNRVRALPPGAFAGAG.ALQR
ENSGGOP00000026086  .......................................................-RHNNITSISTGSFSTTP.NLKC
ENSGGOP00000022939  .......................................................------------------.---S
ENSGGOP00000012492  .......................................................---NRLSEIPIEA-CHFV.SLEN
ENSGGOP00000024274  .......................................................-SHNHLNFISSEAFSPVP.NLRY
ENSGGOP00000023118  .......................................................-GNNRISMIQDRAFGDLT.NLRR
ENSGGOP00000007876  .......................................................------ERISRGAFQEQG.HLRS
ENSGGOP00000010514  .......................................................------------------.-LGA
ENSGGOP00000023229  .......................................................-SNNLIQRVTAQDFQDLQ.DLKH
ENSGGOP00000028543  .......................................................-SRNTIRHVAAGAFADLR.ALRA
ENSGGOP00000016064  .......................................................--NNGLQEIRTGAFSGLK.TLKR
ENSGGOP00000016064  .......................................................-GNNRIAVIQEGAFTNLT.SLRR
ENSGGOP00000022050  .......................................................-SRNTIRHVAAGAFADLR.ALRA
ENSGGOP00000007162  .......................................................-NENRITSLPAMHLGLLS.DLVY
ENSGGOP00000023394  .......................................................-GNNNIATVENNTFKNLL.DLRW
ENSGGOP00000016854  .......................................................------------ELQRFT.KLKS
ENSGGOP00000027736  .......................................................--NNRIEVLEEGSFMNLT.RLQK
ENSGGOP00000005073  .......................................................------------ELQRFT.KLKS
ENSGGOP00000025004  .......................................................------------NLTGTV.HLES
ENSGGOP00000025833  .......................................................------------NLTGTV.HLES
ENSGGOP00000002210  .......................................................------------------.-VIS
ENSGGOP00000010355  .......................................................-SHNALQRLRPGWLAPLF.QLRA
ENSGGOP00000028049  .......................................................--QNTIKIIPPGAFSPYK.KLRR
ENSGGOP00000023394  .......................................................--NNGLHEIVPGAFLGLQ.LVKR
ENSGGOP00000015593  .......................................................-----------ASLSMLA.NCEK
ENSGGOP00000012568  .......................................................------------------.--VT
ENSGGOP00000023118  .......................................................--SNVIQDIETGAFHGLR.GLRR
ENSGGOP00000025923  .......................................................--NNKLQNIEGGAFLGLS.ALKQ
ENSGGOP00000027736  .......................................................--FNNIADIEIGAFNGLG.LLKQ
ENSGGOP00000000821  .......................................................------------------.-VIS
ENSGGOP00000021010  .......................................................-----------------P.TLLS
ENSGGOP00000001364  .......................................................-----IRRISAEAFYYLV.ELQY
ENSGGOP00000020706  .......................................................-SFNPLRHLGSYSFFSFP.ELQV
ENSGGOP00000021036  .......................................................-SFNPLRHLGSYSFFSFP.ELQV
ENSGGOP00000020993  .......................................................-NENKLKAVLYSSLNRFG.NLTD
ENSGGOP00000002485  .......................................................--GNSIHTVTGLDPEKLI.SLHT
ENSGGOP00000027543  .......................................................------------------.--VT
ENSGGOP00000019774  .......................................................------------------.GLTR
ENSGGOP00000010786  .......................................................-SNNLISKITLSSFAYLH.ALEV
ENSGGOP00000024131  .......................................................--GNSIHTVTGLDPEKLI.SLHT
ENSGGOP00000002218  .......................................................---NSMRKLYTNSFLHLN.NAVS
ENSGGOP00000008273  .......................................................------------------.GLTR
ENSGGOP00000015431  .......................................................------PQLHPDTFSHLS.RLEG
ENSGGOP00000008661  .......................................................------------NCTWVE.SIVV
ENSGGOP00000027149  .......................................................------------------.----
ENSGGOP00000013614  .......................................................------RIKKISNLENLK.SLDV
ENSGGOP00000001884  .......................................................------------------.----
ENSGGOP00000017691  .......................................................------------------.----
ENSGGOP00000017973  .......................................................------------------.----
ENSGGOP00000000481  .......................................................-------ILRIDNLWQFE.NLRK
ENSGGOP00000025013  .......................................................-------ILRIDNLWQFE.NLRK
ENSGGOP00000019011  .......................................................-----IRRISAEAFYYLV.ELQY
ENSGGOP00000012497  .......................................................--FNRIKKINKNDFASLS.DLKR
ENSGGOP00000017205  .......................................................---------FPKCILHLS.DVDE
ENSGGOP00000004288  .......................................................---------FPKCILHLS.DVDE
ENSGGOP00000012465  .......................................................-----LFEMPQGSFINMS.TLEY
ENSGGOP00000000942  .......................................................----------IENLEKCV.QLEV
ENSGGOP00000012474  .......................................................-----IRRVPGEAFRPLR.RLEQ
ENSGGOP00000000462  .......................................................------------ELCVLQ.KLTF
ENSGGOP00000022001  .......................................................-----------EGLKELV.HLEW
ENSGGOP00000025605  .......................................................-----------EGLKELV.HLEW
ENSGGOP00000005450  .......................................................------------------.----
ENSGGOP00000000638  .......................................................------------------.--KV
ENSGGOP00000017288  .......................................................-NENRITSLPAMHLGLLS.DLVY
ENSGGOP00000008256  .......................................................---------------LPP.STQT
ENSGGOP00000015431  .......................................................------MTIEPSTFLAVP.TLEE
ENSGGOP00000000795  .......................................................------------------.SLEE
ENSGGOP00000007172  .......................................................---THITELNESPFLNIS.ALIA
ENSGGOP00000027628  .......................................................-------ISKIEAIDHIW.NLRH
ENSGGOP00000002833  .......................................................---------------LPA.NVTT
ENSGGOP00000017434  .......................................................------------------.----
ENSGGOP00000010817  .......................................................--------------LCLK.SLRK
ENSGGOP00000011344  .......................................................------------------.AVRE
ENSGGOP00000020930  .......................................................------------------.AVRE
ENSGGOP00000015568  .......................................................--FNRISRIRAEDFKGLT.KLKR
ENSGGOP00000015042  .......................................................------------------.-VKE
ENSGGOP00000018300  .......................................................---------------LPP.STQT
ENSGGOP00000026851  .......................................................---------EISGLEMCN.NLIH
ENSGGOP00000026693  .......................................................------------------.-VKE
ENSGGOP00000015068  .......................................................--------------VHLP.NLDQ
ENSGGOP00000004548  .......................................................-----LLRRLPDGIGQLK.QLSI
ENSGGOP00000006033  .......................................................------------------.----
ENSGGOP00000027647  .......................................................---------EISGLEMCN.NLIH
ENSGGOP00000027539  .......................................................-SFNYIRTVTASSFPFLE.QLQL
ENSGGOP00000012360  .......................................................------------MFHTLD.ELQT
ENSGGOP00000006033  .......................................................------------------.----
ENSGGOP00000028049  .......................................................------------------.----
ENSGGOP00000027098  .......................................................------------------.---E
ENSGGOP00000011109  .......................................................------------QLRGLG.NLRH
ENSGGOP00000005584  .......................................................------------------.----
ENSGGOP00000019188  .......................................................--------------AGCP.GLEE
ENSGGOP00000015022  .......................................................------------ELGSLS.KLKI
ENSGGOP00000021155  .......................................................------------------.----
ENSGGOP00000006065  .......................................................--FNKIKKLTAKDFADIP.NLRR
ENSGGOP00000008763  .......................................................------------------.----
ENSGGOP00000008108  .......................................................------------------.----
ENSGGOP00000013299  .......................................................--------------AGCP.GLEE
ENSGGOP00000006171  .......................................................------------------.---E
ENSGGOP00000023255  .......................................................------------------.----
ENSGGOP00000025379  .......................................................-----------------T.SLEI
ENSGGOP00000010879  .......................................................------------------.---L
ENSGGOP00000008240  .......................................................------------------.----
ENSGGOP00000004098  .......................................................--------------QCLK.KITH
ENSGGOP00000017344  .......................................................-----------------C.SGST
ENSGGOP00000018814  .......................................................----------HTILQELP.DLEE
ENSGGOP00000025873  .......................................................----------HTILQELP.DLEE
ENSGGOP00000004959  .......................................................------------------.--FE
ENSGGOP00000024368  .......................................................-----------------S.AVRE
ENSGGOP00000011594  .......................................................------------------.EVTE
ENSGGOP00000014157  .......................................................-------LLPLEAFHTFP.ALKE
ENSGGOP00000013487  .......................................................------------------.----
ENSGGOP00000022399  .......................................................------------------.---F
ENSGGOP00000016688  .......................................................-----------KDLLKFL.KLEE
ENSGGOP00000023599  .......................................................------------------.-IHL
ENSGGOP00000013768  .......................................................------------------.-IHL
ENSGGOP00000012563  .......................................................------------------.--TI
ENSGGOP00000008281  .......................................................------------------.----
ENSGGOP00000021469  .......................................................------------------.----
ENSGGOP00000006875  .......................................................------------------.----
ENSGGOP00000017558  .......................................................------------------.----
ENSGGOP00000007076  .......................................................-SHCSLEQVPKEIFTFEK.TLEE
ENSGGOP00000008661  .......................................................----------------PL.KTKV
ENSGGOP00000002527  .......................................................------------------.----
ENSGGOP00000025482  .......................................................------------------.----
ENSGGOP00000028761  .......................................................------------------.----
ENSGGOP00000010362  .......................................................------------------.----
ENSGGOP00000000179  .......................................................------------------.----
ENSGGOP00000024608  .......................................................------------------.--TI
ENSGGOP00000025066  .......................................................------------------.----
ENSGGOP00000023515  .......................................................---------FPENVKAMT.SLRW
ENSGGOP00000003028  .......................................................------------------.---G
ENSGGOP00000023998  .......................................................------------------.----
ENSGGOP00000009979  .......................................................------------------.----
ENSGGOP00000024063  .......................................................------------------.--TT
ENSGGOP00000025398  .......................................................------------------.----
ENSGGOP00000008650  .......................................................---NCLEVLNLGVLNRMN.HIKH
ENSGGOP00000025808  .......................................................------------------.----
ENSGGOP00000003989  .......................................................------------------.----
ENSGGOP00000010116  .......................................................------------------.----
ENSGGOP00000012588  .......................................................------------------.----
ENSGGOP00000013959  .......................................................------------------.----
ENSGGOP00000024093  .......................................................------------------.--TT
ENSGGOP00000015656  .......................................................------------------.----
ENSGGOP00000027053  .......................................................------------------.---I
ENSGGOP00000026787  .......................................................------------------.----
ENSGGOP00000013969  .......................................................------------------.---S
ENSGGOP00000018989  .......................................................------------------.----
ENSGGOP00000017510  .......................................................------------------.DVKE
ENSGGOP00000028171  .......................................................------------------.----
ENSGGOP00000003513  .......................................................--------------SNFK.QMQE
ENSGGOP00000026797  .......................................................------------------.----
ENSGGOP00000016519  .......................................................------------------.----
ENSGGOP00000025973  .......................................................------------------.----
ENSGGOP00000003012  .......................................................------------------.----
ENSGGOP00000028210  .......................................................------------------.----
ENSGGOP00000025364  .......................................................------------------.---F
ENSGGOP00000007122  .......................................................------------------.----


                            30                         40         50                                
                             |                          |          |                                
d1a9na_               LDLRGYKIPVI.............E....NLGATLDQFDAIDFS.DN.E...IRKL......................
ENSGGOP00000002818  LMLDNNGLQAL.............P....AQFSCLQRLKMLNLS.SN.L...FEEF......................
ENSGGOP00000026867  LSLRGNQLTHL.............As...EAFWGLEALRELRLE.GN.R...LSQL......................
ENSGGOP00000014553  LHLQGNQLQAL.............Pr...RLFQPLTHLKTLNLA.QN.L...LAQL......................
ENSGGOP00000006261  LDLSQNSFSDA.............Rd...CDFHALPQLLSLHLE.EN.Q...LTRL......................
ENSGGOP00000007172  LYLSNNHISQL.............Pp...SIFMQLPQLNRLTLF.GN.S...LKEL......................
ENSGGOP00000005919  LYLQDNALQAL.............Pd...DTFRDLGNLTHLFLH.GN.R...ISSV......................
ENSGGOP00000024063  LELRENQLKML.............P....KTMNRLTQLERLDLG.SN.E...FTEV......................
ENSGGOP00000013969  LHLEYNSLVEV.............Ns...GSLYGLTALHQLHLS.NN.S...IARI......................
ENSGGOP00000007076  LELRENQLKML.............P....KTMNRLTQLERLDLG.SN.E...FTEV......................
ENSGGOP00000015022  VHLENNQIEEI.............P....QEIQRLKNIRVLYLD.KN.N...LRSL......................
ENSGGOP00000010210  LRLNKNKLQVL.............Pe...LLFQSTPKLTRLDLS.EN.Q...IQGI......................
ENSGGOP00000025646  LDFSQNNFTNI.............Ke...VGLANLTQLTTLHLE.EN.Q...ITEM......................
ENSGGOP00000008275  -----------.............-....-----LVNLMTLALS.EN.S...LTSL......................
ENSGGOP00000004396  LDLSYNQLSTL.............Ep...GAFHGLQSLLTLRLQ.GN.R...LRIM......................
ENSGGOP00000027814  LYLQENSLLHL.............Qd...DLFADLANLSHLFLH.GN.R...LRLL......................
ENSGGOP00000009302  LYLQENSLLHL.............Qd...DLFADLANLSHLFLH.GN.R...LRLL......................
ENSGGOP00000010181  LELNENIVSAV.............Ep...GAFNNLFNLRTLGLR.SN.R...LKLI......................
ENSGGOP00000000462  LDIHDNQLTSL.............P....SAIRELENLQKLNVS.HN.K...LKTL......................
ENSGGOP00000012823  IDLSDNIIANV.............Ep...GAFNNLFNLRSLRLK.GN.R...LKLV......................
ENSGGOP00000008393  LYLDHNYISSV.............De...DAFQGIRRLKELILS.SN.K...ITYL......................
ENSGGOP00000017408  LELRENLLKSL.............P....ASLSFLVKLEQLDLG.GN.D...LEVL......................
ENSGGOP00000003137  LNLGMCNLKDI.............P....N-LTALVRLEELELS.GN.R...LDLI......................
ENSGGOP00000019249  LNLGMCNLKDI.............P....N-LTALVRLEELELS.GN.R...LDLI......................
ENSGGOP00000013132  LDLRHCQVELV.............Ae...GAFRGLGRLLLLNLA.SN.H...LREL......................
ENSGGOP00000024818  LDLRHCQVELV.............Ae...GAFRGLGRLLLLNLA.SN.H...LREL......................
ENSGGOP00000023908  LHLDHNQISTV.............Ke...DAFQGLYKLKELILS.SN.K...IFYL......................
ENSGGOP00000024673  LYLQSNQVSFV.............Pr...GVFNDLVSVQYLNLQ.RN.R...LTVL......................
ENSGGOP00000026305  LNLGMCNIKDM.............P....N-LTPLVGLEELEMS.GN.H...FPEI......................
ENSGGOP00000009400  LNLGMCNIKDM.............P....N-LTPLVGLEELEMS.GN.H...FPEI......................
ENSGGOP00000007056  VQCSDLGLKSV.............P....K--EISPDTTLLDLQ.NN.D...ISEL......................
ENSGGOP00000005706  LRLSGNHLSHI.............Pg...QAFSGLYSLKILMLQ.NN.Q...LGGI......................
ENSGGOP00000023515  VDLSCNDLTRV.............P....ECLYTLPSLHRLNLS.SN.Q...ITEL......................
ENSGGOP00000003028  VDLSCNDLTRV.............P....ECLYTLPSLHRLNLS.SN.Q...ITEL......................
ENSGGOP00000002850  LRLAGNALTYI.............Pk...GAFTGLYSLKVLMLQ.NN.Q...LRQV......................
ENSGGOP00000006625  LNLAMCNLREI.............P....N-LTPLIKLDELDLS.GN.H...LSAI......................
ENSGGOP00000005450  INLSNNKVSEI.............Ed...GAFEGAASVSELHLT.AN.Q...LESI......................
ENSGGOP00000019824  LKMQRNGISKL.............Kd...GAFFGLNNMEELELE.HN.N...LTRV......................
ENSGGOP00000001938  VHCSDLGLTSV.............P....T--NIPFDTRMLDLQ.NN.K...IKEI......................
ENSGGOP00000006377  LYLSHNDIRVL.............Ra...GAFDDLTELTYLYLD.HN.K...VTEL......................
ENSGGOP00000028264  VHCSDLGLTSV.............P....T--NIPFDTRMLDLQ.NN.K...IKEI......................
ENSGGOP00000021709  LDLSQNNLSSV.............Tn...INVKKMPQLLSVYLE.EN.K...LTEL......................
ENSGGOP00000025918  LYLDHNHISNI.............De...NAFNGIRRLKELILS.SN.R...ISYF......................
ENSGGOP00000008365  LSLQANRVRAV.............Ha...GAFGDCGVLEHLLLN.DN.L...LAEL......................
ENSGGOP00000006124  LVLAGNRLAYL.............Qp...ALFSGLAELRELDLS.RN.A...LRAI......................
ENSGGOP00000015799  LHLSQNAINRI.............Sp...DAWEFCQKLSELDLT.FN.H...LSRL......................
ENSGGOP00000010984  LNVSHNHISHI.............P....KEISQLGNIRQLFFY.NN.Y...IENF......................
ENSGGOP00000012493  LSMQSNRLTKI.............E....G-LQNLVNLRELYLS.HN.G...IEVI......................
ENSGGOP00000018354  LALNQNQLDFL.............Pa...SLFTNLENLKLLDLS.GN.N...LTHL......................
ENSGGOP00000001578  LYLDHNHICSV.............Qg...DAFQKLRRVKELTLS.SN.Q...ITQL......................
ENSGGOP00000004548  LELRENLLKSL.............P....ASLSFLVKLEQLDLG.GN.D...LEVL......................
ENSGGOP00000013132  LHLDRNQLREV.............Pt...GALEGLPALLELQLS.GN.P...LRAL......................
ENSGGOP00000024818  LHLDRNQLREV.............Pt...GALEGLPALLELQLS.GN.P...LRAL......................
ENSGGOP00000025004  LQLAGNDLSFI.............Hp...KALSGLKELKVLTLQ.NN.Q...LKTV......................
ENSGGOP00000025833  LQLAGNDLSFI.............Hp...KALSGLKELKVLTLQ.NN.Q...LKTV......................
ENSGGOP00000016600  LYLNRNKIEKI.............P....TQLFYCRKLRYLDLS.HN.N...LTFL......................
ENSGGOP00000006124  LTLDHNQLQEV.............Ka...GAFLGLTNVAVMNLS.GN.C...LRNL......................
ENSGGOP00000005521  VYLHNNKLADA.............Glpd.NMFNGSSNVEVLILS.SN.F...LRHV......................
ENSGGOP00000001854  LIVDGNLLTNK.............Giae.GTFSHLTKLKEFSIV.RN.S...LSHP......................
ENSGGOP00000019138  LDLSQNQIASL.............Ps...GVFQPLANLSNLDLT.AN.R...LHEI......................
ENSGGOP00000021712  LDLKSNNIRTI.............Eei..ISFQHLKRLTCLKLW.HN.K...IVTI......................
ENSGGOP00000015564  INLDNNRIRKI.............Dq...RVLEKLPGLVFLYME.KN.Q...LEEV......................
ENSGGOP00000012531  -----------.............-....---------------.--.-...-RHS......................
ENSGGOP00000020501  VYLHNNKLADA.............Glpd.NMFNGSSNVEVLILS.SN.F...LRHV......................
ENSGGOP00000003727  LILVNNKISKV.............Sp...GAFTPLVKLERLYLS.KN.Q...LKEL......................
ENSGGOP00000025379  LWLDDNALTEI.............Pv...RALNNLPALQAMTLA.LN.R...ISHI......................
ENSGGOP00000025364  LVLDGNLLNNH.............Glgd.KVFFNLVNLTELSLV.RN.S...LTAA......................
ENSGGOP00000011582  IALHGNQITSD.............Kvgr.KVFSKLRHLERLYLD.HN.N...LTRM......................
ENSGGOP00000023288  LYLEGNHLTAV.............P....RELSTLRHLTLIDLS.NN.S...ISML......................
ENSGGOP00000010210  LYLEGNHLTAV.............P....RELSTLRHLTLIDLS.NN.S...ISML......................
ENSGGOP00000019616  LWLDDNSLTEV.............Pv...HPLSNLPTLQALTLA.LN.K...ISSI......................
ENSGGOP00000026995  LELVHCDLERI.............P....HAVFSLLSLQELDLK.EN.N...LKSI......................
ENSGGOP00000003265  LELRENLLTYL.............P....DSLTQLRRLEELDLG.NN.E...IYNL......................
ENSGGOP00000024614  LVLKENQLEVL.............Ev...SWLHGLKALGHLDLS.GN.R...LRKL......................
ENSGGOP00000025637  LDLSKNKLDPR.............Glhp.HAFKDLMRLKRLNLD.GN.S...LTTV......................
ENSGGOP00000014142  LTLSRNAITRI.............Ga...RAFGDLESLRSLHLD.GN.R...LVEL......................
ENSGGOP00000013300  LDLSKNNITSS.............Gigp.KAFKLLKKLMRLNMD.GN.N...LIQI......................
ENSGGOP00000022805  LRLWHNQIAYV.............P....EHVRKLRSLEQLYLS.YN.K...LETL......................
ENSGGOP00000025292  LDLSKNNITSS.............Gigp.KAFKLLKKLMRLNMD.GN.N...LIQI......................
ENSGGOP00000025973  LVLDGNLLANQ.............Riad.DTFSRLQNLTELSLV.RN.S...LAAP......................
ENSGGOP00000002611  ---QHNCIRHI.............Sr...KAFFGLYNLQILYLN.HN.C...ITTL......................
ENSGGOP00000015422  LRLRDNYLAFF.............Kw...WSLHFLPKLEVLDLA.GN.Q...LKAL......................
ENSGGOP00000015431  LRLRDNYLAFF.............Kw...WSLHFLPKLEVLDLA.GN.Q...LKAL......................
ENSGGOP00000000213  LNLDRCELTKL.............Hv...D--GTLPVLGTLDLS.HN.Q...LQSL......................
ENSGGOP00000025405  LNLDRCELTKL.............Hv...D--GTLPVLGTLDLS.HN.Q...LQSL......................
ENSGGOP00000022526  IHLQHNRLKED.............Avs..AAFKGLKSLEYLDLS.FN.Q...IAKL......................
ENSGGOP00000014753  LDLGNNEFGEL.............P....EVLDQIQNLRELWMD.NN.A...LQVL......................
ENSGGOP00000020501  LNLSYNRITSP.............Qvhr.DAFRKLRLLRSLDLS.GN.R...LHTL......................
ENSGGOP00000003295  LELHQNALTSF.............Pq...QLCETLKSLTHLDLH.SN.K...FTSF......................
ENSGGOP00000022737  LTLSRNAITRI.............Ga...RAFGDLESLRSLHLD.GN.R...LVEL......................
ENSGGOP00000007465  -----------.............-....---------------.--.-...----......................
ENSGGOP00000016887  LTLSRNTISFI.............Tp...HAFADLRNLRALHLN.SN.R...LTKI......................
ENSGGOP00000018050  LTLSRNTISFI.............Tp...HAFADLRNLRALHLN.SN.R...LTKI......................
ENSGGOP00000023473  LTLSRNTISFI.............Tp...HAFADLRNLRALHLN.SN.R...LTKI......................
ENSGGOP00000010984  LDLGKNQIKKI.............P....ASISNMISLHVLILC.CN.K...FETF......................
ENSGGOP00000024701  LILDDNPITRI.............Sq...RLFTGLNSLFFLSMV.NN.Y...LEAL......................
ENSGGOP00000027247  LDLSNNNIANI.............Nd...DMLEGLEKLEILDLQ.HN.N...LARLwkhan.................
ENSGGOP00000020624  LDISKNSLSFL.............Psg..VFDGMPPNLKNLSLA.KN.G...LKSF......................
ENSGGOP00000009427  INLNKNKITNY.............Giek.GALSQLKKLLFLFLE.DN.E...LEEV......................
ENSGGOP00000006033  LYLDGNQFTLV.............P....KELSNYKHLTLIDLS.NN.R...ISTL......................
ENSGGOP00000028049  LYLDGNQFTLV.............P....KELSNYKHLTLIDLS.NN.R...ISTL......................
ENSGGOP00000022833  LDLKSNNIRTI.............Eei..ISFQHLKRLTCLKLW.HN.K...IVTI......................
ENSGGOP00000008475  -----------.............-....---------------.--.-...----......................
ENSGGOP00000001704  LSLAHNRLAMA.............TalsaGGLGPLPRVTSLDLS.GN.S...LYSG......................
ENSGGOP00000002826  LKMSYNKVRKL.............Qk...DTFYGLRSLTRLHMD.HN.N...IEFI......................
ENSGGOP00000008650  LNASANSLESL.............Psac.TEEESLSMLQLLYLT.NN.L...LTDQ......................
ENSGGOP00000013968  -----------.............-....---------------.--.-...----......................
ENSGGOP00000007909  LYIRGNVKKLH.............Lgv..GCLEKLGNLQTLDLS.HN.D...IEAS......................
ENSGGOP00000003513  LFLQGNEISQV.............E....G-LDNLVVLQELVVD.HN.R...IRSF......................
ENSGGOP00000016854  LDIGHNQICEL.............P....ARLFCNSSLRKLLAG.HN.Q...LARL......................
ENSGGOP00000022025  LDLSLNRLKHI.............Pne..AFLNLPASLTELHIN.DN.M...LKFF......................
ENSGGOP00000012021  LDLSLNRLKHI.............Pne..AFLNLPASLTELHIN.DN.M...LKFF......................
ENSGGOP00000027247  LDVGFNTISKL.............Ep...ELCQKLPMLKVLNLQ.HN.E...LSQL......................
ENSGGOP00000012881  LYLQNNKITSI.............Si...YAFRGLNSLTKLYLQ.NN.K...ITSIsiyafrglnslnfwlvvlefgt
ENSGGOP00000013469  -----------.............-....---------------.--.-...----......................
ENSGGOP00000014079  LLISNTGIKHL.............Pd...VHKIHSLQKVLLDIQ.DNiN...IHTI......................
ENSGGOP00000021874  LYLQNNKITSI.............Si...YAFRGLNSLTKLVLM.NN.V...LTRL......................
ENSGGOP00000020681  LALTSNRLRGL.............Rg...GAFVGLAQLRVLYLA.GN.Q...LARL......................
ENSGGOP00000013987  LALTSNRLRGL.............Rg...GAFVGLAQLRVLYLA.GN.Q...LARL......................
ENSGGOP00000024070  LNLSHNKLGLF.............P....ILLCEISTLTELNLS.CN.G...FHDL......................
ENSGGOP00000013477  LTLANRNLERL.............P....G--CLPRTLRSLDAS.HN.L...LRAL......................
ENSGGOP00000005073  LDIGHNQICEL.............P....ARLFCNSSLRKLLAG.HN.Q...LARL......................
ENSGGOP00000018071  -----------.............-....---D-----------.--.-...----......................
ENSGGOP00000007465  -----------.............-....----------V----.--.-...----......................
ENSGGOP00000027332  LYLQHNQLTDS.............Glda.TTFSKLHSLEYLDLS.HN.Q...LTTV......................
ENSGGOP00000013375  -----------.............-....---D-----------.--.-...----......................
ENSGGOP00000023252  LYLQHNQLTDS.............Glda.TTFSKLHSLEYLDLS.HN.Q...LTTV......................
ENSGGOP00000008663  LTLSRNTISHI.............Qp...FSFLDLESLRSLHLD.SN.R...LPSL......................
ENSGGOP00000027539  LDLSHGFVFSL.............Ns...RVFETLKDLKVLNLA.YN.K...INKI......................
ENSGGOP00000008275  LILSNNLLKKL.............P....HGLGNLRKLRELDLE.EN.K...LESL......................
ENSGGOP00000012531  -----------.............-....---------------.--.-...----......................
ENSGGOP00000009848  LKLQGNYLSEL.............P....S-LENLVLLRELHLD.DN.S...ISTV......................
ENSGGOP00000005706  LTLTRAGIRLL.............Ps...GMCQQLPRLRVLELS.HN.Q...IEEL......................
ENSGGOP00000004424  L----------.............-....---------------.--.-...----......................
ENSGGOP00000004424  ------R----.............-....---------------.--.-...----......................
ENSGGOP00000003450  LMIHGNEIPSI.............Pd...GALRDLSSLQVFKFS.YN.K...LRVI......................
ENSGGOP00000005521  LNLSYNRITSP.............Qvhr.DAFRKLRLLRSLDLS.GN.R...LHTL......................
ENSGGOP00000024070  LNASANSLESL.............Psac.TEEESLSMLQLLYLT.NN.L...LTDQ......................
ENSGGOP00000004344  LDLPKNQISHL.............P....AEIGCLKNLKELNVS.FN.Y...LKSI......................
ENSGGOP00000024903  LVLSHNKLATV.............P....PNIAELKNLEVLNFF.NN.Q...IEEL......................
ENSGGOP00000007876  LDMSQNQFQYL.............Pd...GFLRKMPSLSHLNLN.RN.C...LMTL......................
ENSGGOP00000002850  LTLTGAQISSL.............Pq...TVCNQLPNLQVLDLS.YN.L...LEDL......................
ENSGGOP00000001704  LDLSYNEIELI.............Pd...SFLEHLTSLCFLNLS.RN.C...LRTF......................
ENSGGOP00000024790  LNLDRCELTKL.............Hv...D--GTLPVLGTLDLS.HN.Q...LQSL......................
ENSGGOP00000012480  LLLNNNQIKRI.............Ps...GAFEDLENLKYLYLY.KN.E...IQSI......................
ENSGGOP00000004216  -----------.............-....----ALQGLRRLELA.SN.H...FLYL......................
ENSGGOP00000026324  -----------.............-....----ALQGLRRLELA.SN.H...FLYL......................
ENSGGOP00000022546  LDLSYNLLFQL.............Qs...SDFHSVSKLRVLILC.HN.R...IQQL......................
ENSGGOP00000006438  LNFSGNCFQEV.............P....ASLLELRALQTLSLG.GN.Q...LQSI......................
ENSGGOP00000009953  LVLQNNLIPKV.............C....PELCNLTQLTTLNLG.NN.L...LEEV......................
ENSGGOP00000001696  LDCKRKELKKV.............P....N--NIPPDIVKLDLS.YN.K...INQL......................
ENSGGOP00000027978  LNLSHNQLRVL.............P....PEVGKLTRIVVLNLC.GN.R...LKSL......................
ENSGGOP00000023252  VYLHNNQLSNA.............Glpp.DAFRGSEAIATLSLS.NN.R...LSYL......................
ENSGGOP00000023288  IDISKNQISDI.............Ap...DAFQGLKSLTSLVLY.GN.K...ITEI......................
ENSGGOP00000000058  LDLSANCLATL.............Ps...VIPWGLINLRKLNLS.DN.H...LGEL......................
ENSGGOP00000022509  LDFRNNSLRSL.............Ee...GTFSGSAKLVFLDLS.YN.N...LTQL......................
ENSGGOP00000027332  VYLHNNQLSNA.............Glpp.DAFRGSEAIATLSLS.NN.R...LSYL......................
ENSGGOP00000012870  LNISQNYISEL.............Wt...SDILSLSKLRILIIS.HN.R...IQYL......................
ENSGGOP00000010388  LDLSNNFLDRL.............Pr...SIFGDLTNLTELQLR.NN.S...IRTL......................
ENSGGOP00000028222  LWLAHNEVRTV.............Ep...GALAVLSQLKNLDLS.HN.F...ISSF......................
ENSGGOP00000010955  LWLAHNEIRTV.............Aa...GALASLSHLKSLDLS.HN.L...ISDF......................
ENSGGOP00000028499  LWLAHNEIRTV.............Aa...GALASLSHLKSLDLS.HN.L...ISDF......................
ENSGGOP00000009373  IDLSNNKIESL.............Pp...LLIGKFTLLKSLSLN.NN.K...LTVL......................
ENSGGOP00000015422  LVLKDSSLSWL.............Na...SWFRGLGNLRVLDLS.EN.F...LYKC......................
ENSGGOP00000026779  LALDFNNFKAL.............P....QVVCTLKQLCILYLG.NN.K...LCDL......................
ENSGGOP00000011147  LVLSNNALRTL.............Qg...SWFRNTSGLTRLQLD.GN.Q...ITNL......................
ENSGGOP00000013381  LSLYHNCLRCL.............N....PALGNLTALTYLNLS.RN.Q...LSLL......................
ENSGGOP00000001892  LNLYHNCIKTI.............P....EAIKNLQMLTYLNIS.RN.L...LSTL......................
ENSGGOP00000023288  LHLEDNQVSVI.............Er...GAFQDLKQLERLRLN.KN.K...LQVL......................
ENSGGOP00000020624  LSLKDNNVTTV.............P....T--VLPSTLTELYLY.NN.M...IAKI......................
ENSGGOP00000021650  LVLSHNKLATV.............P....PNIAELKNLEVLNFF.NN.Q...IEEL......................
ENSGGOP00000018071  -----------.............-....---------------.--.-...----......................
ENSGGOP00000013375  -----------.............-....---------------.--.-...----......................
ENSGGOP00000007909  LDLTRCQINWI.............He...DTFQSHHQLSTLVLT.GN.P...LIFM......................
ENSGGOP00000020706  LKMAGNSFQEN.............Flp..DIFTELRNLTFLDLS.QC.Q...LEQL......................
ENSGGOP00000021036  LKMAGNSFQEN.............Flp..DIFTELRNLTFLDLS.QC.Q...LEQL......................
ENSGGOP00000025923  LYLNGNQIERL.............Yp...EIFSGLHNLQYLYLE.YN.L...IKEI......................
ENSGGOP00000001368  LNLSNNSLSNL.............Ap...GAFHGLQHLQVLNLT.QN.S...LLSL......................
ENSGGOP00000020939  LYLHSNNIVVV.............P....EAIGSLVKLQCLDLS.DN.A...LEIV......................
ENSGGOP00000023533  LYLHSNNIVVV.............P....EAIGSLVKLQCLDLS.DN.A...LEIV......................
ENSGGOP00000003534  LDFRNNSLRSL.............Ee...GTFSGSAKLVFLDLS.YN.N...LTQL......................
ENSGGOP00000013469  -----------.............-....---------------.--.-...----......................
ENSGGOP00000015192  LNLSGNRLREL.............Pa...DLARCAPRLQSLNLT.GN.C...LDSF......................
ENSGGOP00000026520  LNLSGNRLREL.............Pa...DLARCAPRLQSLNLT.GN.C...LDSF......................
ENSGGOP00000008114  LDLHNNSLMEL.............Pr...GLFLHAKRLAHLDLS.YN.N...FSHV......................
ENSGGOP00000026663  LILSNNKISEL.............Kn...GSFSGLSLLERLDLR.NN.L...ISSI......................
ENSGGOP00000003265  LWLDGNQLSEL.............P....QEIGNLKNLLCLDVS.EN.R...LERL......................
ENSGGOP00000005450  IDLSNNQIAEI.............Ap...DAFQGLRSLNSLVLY.GN.K...ITDL......................
ENSGGOP00000002218  LFLNGNDIEKL.............Tp...GMFRGLQSLHYLYFE.FN.V...IREI......................
ENSGGOP00000004826  LDLSENGLHSV.............Hv...RAFWGLGALQLLDLS.AN.Q...LEAL......................
ENSGGOP00000026086  LDLSSNKLKTV.............Kn...AVFQELKVLEVLLLY.NN.H...ISYL......................
ENSGGOP00000022939  LSLVNGTFSEI.............Kd...RMFSHLPSLQLLLLN.SN.S...FTII......................
ENSGGOP00000012492  LNLYQNCIRYI.............P....EAILNLQALTFLNIS.RN.Q...LSTL......................
ENSGGOP00000024274  LDLSSNQLRTL.............De...FLFSDLQVLEVLLLY.NN.H...IMAV......................
ENSGGOP00000023118  LYLNGNRIERL.............Sp...ELFYGLQSLQYLFLQ.YN.L...IREI......................
ENSGGOP00000007876  LVLGDNCLSEN.............YketaAALHALPGLRRLDLS.GN.S...LTED......................
ENSGGOP00000010514  LLLSHNCLSEL.............P....EALGALPALTFLTVT.HN.R...LQTL......................
ENSGGOP00000023229  LILENNASFFE.............A....GALQRCSQLSNLALE.QN.L...LLSI......................
ENSGGOP00000028543  LHLDGNRLTSL.............Ge...GQLRGLVNLRHLILS.NN.Q...LAAL......................
ENSGGOP00000016064  LHLNNNKLEIL.............Re...DTFLGLESLEYLQAD.YN.Y...ISAI......................
ENSGGOP00000016064  LYLNGNYLEVL.............Yp...SMFDGLQSLQYLYLE.YN.V...IKEI......................
ENSGGOP00000022050  LHLDGNRLTSL.............Ge...GQLRGLVNLRHLILS.NN.Q...LAAL......................
ENSGGOP00000007162  LDCQNNRIREV.............Md...YTFIGVFKLIYLDLS.SN.N...LTSI......................
ENSGGOP00000023394  LYMDSNYLDTL.............Sr...EKFAGLQNLEYLNVE.YN.A...IQLI......................
ENSGGOP00000016854  LNLSNNHLGDF.............P....LAVCSIPTLAELNVS.CN.A...LRSV......................
ENSGGOP00000027736  LYLNGNHLTKL.............Sk...GMFLGLHNLEYLYLE.YN.A...IKEI......................
ENSGGOP00000005073  LNLSNNHLGDF.............P....LAVCSIPTLAELNVS.CN.A...LRSV......................
ENSGGOP00000025004  LTLTGAKISSI.............Pn...NLCQEQKMLRTLDLS.YN.N...IRDL......................
ENSGGOP00000025833  LTLTGAKISSI.............Pn...NLCQEQKMLRTLDLS.YN.N...IRDL......................
ENSGGOP00000002210  LSFVRSGFTEI.............Se...GSFLFTPSLQLLLFT.SN.S...FDVI......................
ENSGGOP00000010355  LHLDHNELDAL.............Gr...GVFANASGLRLLDLS.SN.T...LRAL......................
ENSGGOP00000028049  IDLSNNQISEL.............Ap...DAFQGLRSLNSLSFY.GN.K...CPEP......................
ENSGGOP00000023394  LHINNNKIKSF.............Rk...QTFLGLDDLEYLQAD.FN.L...LRDI......................
ENSGGOP00000015593  LSLSTNCIEKI.............A....N-LNGLKNLRILSLG.RN.N...IKNL......................
ENSGGOP00000012568  LLLSNNKITGL.............Rn...GSFLGLSLLEKLDLR.NN.I...ISTV......................
ENSGGOP00000023118  LHLNNNKLELL.............Rd...DTFLGLENLEYLQVD.YN.Y...ISVI......................
ENSGGOP00000025923  LHLNNNELKIL.............Ra...DTFLGIENLEYLQAD.YN.L...IKYI......................
ENSGGOP00000027736  LHINHNSLEIL.............Ke...DTFHGLENLEFLQAD.NN.F...ITVI......................
ENSGGOP00000000821  LTLVNAAFSEI.............Qd...GAFSHLPLLQFLLLN.SN.K...FTLI......................
ENSGGOP00000021010  LSLVRTGVTQL.............Ka...GSFLRIPSLHLLLFT.SN.S...FSVI......................
ENSGGOP00000001364  LWVTYNSVASI.............Dp...SSFYNLKQLHELRLD.GN.S...LAAF......................
ENSGGOP00000020706  LDLSRCEIQTI.............Ed...GAYQSLSHLSTLILT.GN.P...IQSL......................
ENSGGOP00000021036  LDLSRCEIQTI.............Ed...GAYQSLSHLSTLILT.GN.P...IQSL......................
ENSGGOP00000020993  LNLTKNEISYI.............Ed...GAFLGQSSLQVLQLG.YN.K...LSNL......................
ENSGGOP00000002485  VELRGNQLEST.............L....G--INLPKLKNLYLA.QN.M...LKKV......................
ENSGGOP00000027543  LILSNNKISEL.............Qn...GSFSGLSLLERLDLN.NL.I...SRID......................
ENSGGOP00000019774  LSLAYLPVKVI.............Ps...QAFRGLNEVIKIEIS.QI.Ds..LERI......................
ENSGGOP00000010786  LNLSNNAIHSLsldllspksswvkPhrs.SFRNRFPLLKVLILQ.RN.K...LSDT......................
ENSGGOP00000024131  VELRGNQLEST.............L....G--INLPKLKNLYLA.QN.M...LKKV......................
ENSGGOP00000002218  INLGNNALQDI.............Qt...GAFNGLKILKRLYLH.EN.K...LDVF......................
ENSGGOP00000008273  LSLAYLPVKVI.............Ps...QAFRGLNEVIKIEIS.QI.Ds..LERI......................
ENSGGOP00000015431  LVLKDSSLSWL.............Na...SWFRGLGNLRVLDLS.EN.F...LYKC......................
ENSGGOP00000008661  LNLSSNMLTDS.............V....F-RCLPPRIKVLDLH.SN.K...IKSI......................
ENSGGOP00000027149  -----------.............-....---------------.--.-...----......................
ENSGGOP00000013614  LDLHGNQITKI.............E....N-INHLCELRVLNLA.RN.F...LSHV......................
ENSGGOP00000001884  -----------.............-....---------------.--.-...----......................
ENSGGOP00000017691  -----------.............-....---------------.--.-...----......................
ENSGGOP00000017973  --LNNNHIRKI.............Sr...NAFEGLENLLYLYLY.KN.E...IHAL......................
ENSGGOP00000000481  LQLDNNIIEKI.............E....G-LENLAHLVWLDLS.FN.N...IETI......................
ENSGGOP00000025013  LQLDNNIIEKI.............E....G-LENLAHLVWLDLS.FN.N...IETI......................
ENSGGOP00000019011  LWVTYNSVASI.............Dp...SSFYNLKQLHELRLD.GN.S...LAAF......................
ENSGGOP00000012497  IDLTSNLISEI.............De...DAFRKLPQLRELVLR.DN.K...IRQL......................
ENSGGOP00000017205  LDLSRNLIRKI.............P....DSISKFQNLRWLDLH.SN.Y...IDKL......................
ENSGGOP00000004288  LDLSRNLIRKI.............P....DSISKFQNLRWLDLH.SN.Y...IDKL......................
ENSGGOP00000012465  LWLNFNNISVI.............Hl...GALEHLPELRELRLE.GN.K...LCSV......................
ENSGGOP00000000942  LNLSYNLIGKI.............E....K-LDKLLKLRELNLS.YN.K...ISKI......................
ENSGGOP00000012474  LWLPYNALSEL.............Na...LMLRGLRRLRELRLP.GN.R...LAAF......................
ENSGGOP00000000462  LDLRNNFLNSL.............P....EEMKSLVRLQTINLS.FN.R...FKML......................
ENSGGOP00000022001  LNLAGNNLKAM.............E....Q-INSCTALQHLDLS.DN.N...ISQI......................
ENSGGOP00000025605  LNLAGNNLKAM.............E....Q-INSCTALQHLDLS.DN.N...ISQI......................
ENSGGOP00000005450  -----------.............-....LLFQNNQALSRLDLS.EN.A...IQAI......................
ENSGGOP00000000638  LIVHTNHLTSL.............Lpks.CSLLSLATIKVLDLH.DN.Q...LTAL......................
ENSGGOP00000017288  LDCQNNR----.............-....--------LIYLDLS.SN.N...LTSI......................
ENSGGOP00000008256  LKLIETHLRTI.............Ps...HAFSNLPNISRIYVSiDV.T...LQQL......................
ENSGGOP00000015431  LNLSYNNIMTV.............P....A---LPKSLISLSLS.HT.N...ILML......................
ENSGGOP00000000795  LSLHQQEIERL.............E....HIDKWCRDLKILYLQ.NN.L...IGKI......................
ENSGGOP00000007172  LRIEKNELSRI.............Mp...GAFRNLGSLRYLSLA.NN.K...LQVL......................
ENSGGOP00000027628  LDLSSNQISRI.............E....G-LNTLTKLCTLNLS.CN.L...ITKV......................
ENSGGOP00000002833  LSLSANKIAVL.............Rr...GAFADVTQVTSLWLA.HN.E...VRTV......................
ENSGGOP00000017434  -----------.............-....---------------.--.-...----......................
ENSGGOP00000010817  LDLSHNHIKKL.............P....ATIGDLIHLQELNLN.DN.H...LESF......................
ENSGGOP00000011344  LVLDNCKSNDG.............Kie..GLTAEFVNLEFLSLI.NV.G...LISV......................
ENSGGOP00000020930  LVLDNCKSNDG.............Kie..GLTAEFVNLEFLSLI.NV.G...LISV......................
ENSGGOP00000015568  IDLSNNLISSI.............Dn...DAFRLLHALQDLILP.EN.Q...LEAL......................
ENSGGOP00000015042  LVLDNSRSNEG.............Kle..GLTDEFEELEFLSTI.NV.G...LTSI......................
ENSGGOP00000018300  LKLIETHLRTI.............Ps...HAFSNLPNISRIYVSiDV.T...LQQL......................
ENSGGOP00000026851  LSLANNKITTI.............N....G--LNKLPIKILCLS.NN.Q...IEMI......................
ENSGGOP00000026693  LVLDNSRSNEG.............Kle..GLTDEFEELEFLSTI.NV.G...LTSI......................
ENSGGOP00000015068  LKLNGSHLGSL.............R....DLGTSLGHLQVLWLA.HC.G...LADL......................
ENSGGOP00000004548  LKVDQNRLCEV.............T....EAIGDCENLSELILT.EN.L...LMAL......................
ENSGGOP00000006033  VDCRGKGLTEI.............P....T--NLPETITEIRLE.QN.T...IKII......................
ENSGGOP00000027647  LSLANNKITTI.............N....G--LNKLPIKILCLS.NN.Q...IEMI......................
ENSGGOP00000027539  LELGSQYTPLT.............Idk..EAFRNLPNLRILDLG.SS.K...IYFL......................
ENSGGOP00000012360  VRLDREGITTI.............R....N-LEGLQNLHSLYLQ.GN.K...IQQI......................
ENSGGOP00000006033  -----------.............-....------------DLS.EN.Q...IQAI......................
ENSGGOP00000028049  -----------.............-....------------DLS.EN.Q...IQAI......................
ENSGGOP00000027098  LDLSLSDLNEV.............Pv...KELAALPKATILDLS.CN.K...LTTL......................
ENSGGOP00000011109  LILGNNQIRRV.............Esa..AFDAFLSTVEDLDLS.YN.N...LEAL......................
ENSGGOP00000005584  -----------.............-....-----LHSVRKLNCW.GS.R...LTDI......................
ENSGGOP00000019188  LYLESNNIFIS.............E....RPTDVLQTVKLLDLS.SN.Q...LIDE......................
ENSGGOP00000015022  LGLTGNEFLSF.............P....EEVLSLASLEKLYIG.QD.QgfkLTYV......................
ENSGGOP00000021155  ------KIPVI.............E....NLGATLDQFDAIDFS.DN.E...IRKL......................
ENSGGOP00000006065  LDFTGNLIEDI.............Ed...GTFSKLSLLEELSLA.EN.Q...LLKL......................
ENSGGOP00000008763  -TCSNANLKEI.............P....R--DLPPETVLLYLD.SN.Q...ITSI......................
ENSGGOP00000008108  --CSQAGLSAV.............P....S--GIPNDTRKLYLD.AN.Q...LASV......................
ENSGGOP00000013299  LYLESNNIFIS.............E....RPTDVLQTVKLLDLS.SN.Q...LIDE......................
ENSGGOP00000006171  LDLSLSDLNEV.............Pv...KELAALPKATILDLS.CN.K...LTTL......................
ENSGGOP00000023255  -----------.............-....---------------.-S.R...LTDI......................
ENSGGOP00000025379  LTLTRAGIRLL.............Ps...GMCQQLPRLRVLELS.HN.Q...IEEL......................
ENSGGOP00000010879  LKLRGLGLADL.............G....C-LGECLGLEWLDLS.GN.A...LTHL......................
ENSGGOP00000008240  -------LQEV.............P....E--DIPANTVLLKLD.AN.K...ISHL......................
ENSGGOP00000004098  INFSDKNIDAI.............E....D-LSLCKNLSVLYLY.DN.C...ISQI......................
ENSGGOP00000017344  VDCHGLALRSV.............P....R--NIPRNTERLDLN.GN.N...ITRI......................
ENSGGOP00000018814  LFLCLNDYETV.............S....CPSICCHSLKLLHIT.DN.N...LQDW......................
ENSGGOP00000025873  LFLCLNDYETV.............S....CPSICCHSLKLLHIT.DN.N...LQDW......................
ENSGGOP00000004959  LFLSKKELTEV.............I....D-LSRFKKLKYLWLH.HN.K...LHGI......................
ENSGGOP00000024368  LVLDNCKSNDG.............Kie..GLTAEFVNLEFLSLI.NV.G...LISV......................
ENSGGOP00000011594  LVLDNCLCVNG.............Eie..GLNDTFKELEFLSMA.NV.E...LSSL......................
ENSGGOP00000014157  LDLAFNGIKTI.............Y....VKYGDFKLLEFLDLS.FN.S...LTVE......................
ENSGGOP00000013487  -----------.............-....-----AENLTELYIE.NQ.Qh..LQHL......................
ENSGGOP00000022399  VKFNGLHLKSV.............E....N-LQSCISLRVCIFS.NN.F...ITDI......................
ENSGGOP00000016688  LVLSANRIKEV.............D....A-TNLPPTLKVLELY.GN.E...ISSM......................
ENSGGOP00000023599  ITLANNELKSL.............Ts...KFMTTFSQLRELHLE.GN.F...LHRL......................
ENSGGOP00000013768  ITLANNELKSL.............Ts...KFMTTFSQLRELHLE.GN.F...LHRL......................
ENSGGOP00000012563  LNFQGNYISYI.............D....GNVWKAYGTGKLILN.EN.Y...LTEL......................
ENSGGOP00000008281  -----------.............-....---------------.--.K...IHSI......................
ENSGGOP00000021469  -----------.............E....SLTAEFVNLEFLRLI.NV.G...LISI......................
ENSGGOP00000006875  -----------.............-....---------------.--.-...----......................
ENSGGOP00000017558  VSCQAHNFAAI.............P....E--GIPVDSERVFLQ.NN.R...IGLL......................
ENSGGOP00000007076  LYLDANQIEEL.............P....KQLFNCQSLHKLSLP.DN.D...LTTL......................
ENSGGOP00000008661  LDMSQNYIAEL.............Qv...SDMSFLSELKVLRLS.HN.R...IQLL......................
ENSGGOP00000002527  -----------.............-....---------KRLDLS.FN.L...LRSL......................
ENSGGOP00000025482  -ALDNSRSNEG.............Kle..ALTDEFEELEFLSTI.NG.G...LTSI......................
ENSGGOP00000028761  LDLSESGLCRL.............E....E-VFRIPSLQQLHLQ.RN.A...LCVI......................
ENSGGOP00000010362  -----------.............-....-------ELRSLSIP.GT.Y...QEKI......................
ENSGGOP00000000179  -----------.............-....---------------.--.-...----......................
ENSGGOP00000024608  LNFQGNYISYI.............D....GNVWKAYGTGKLILN.EN.Y...LTEL......................
ENSGGOP00000025066  --------RSL.............S....TSLWSLTHLTALHLN.DN.Y...LSRI......................
ENSGGOP00000023515  LKLNRTGLCYL.............P....EELAALQKLEHLSVS.HN.N...LTTL......................
ENSGGOP00000003028  VDLSGNDFKGG.............Yfp..ENVKAMTSLRWLKLN.RT.G...LCYL......................
ENSGGOP00000023998  -----------.............-....---------------.--.-...----......................
ENSGGOP00000009979  -----------.............-....---------------.--.-...----......................
ENSGGOP00000024063  LDYSHCSLEQV.............Pk...EIFTFEKTLEELYLD.AN.Q...IEEL......................
ENSGGOP00000025398  -----------.............-....-----LGKIRSLDLS.GL.E...LLSE......................
ENSGGOP00000008650  VDLRMNHLKTM.............Vi...ENLEGNKHVTHVDLR.DN.R...LTDL......................
ENSGGOP00000025808  ---------TL.............K....IIERNFPELLSLNLC.NN.K...LYHL......................
ENSGGOP00000003989  ----NCMTATL.............K....IIERNFPELLSLNLC.NN.K...LYHL......................
ENSGGOP00000010116  -----------.............-....--------PHSLDLS.HN.S...LRAT......................
ENSGGOP00000012588  -----------.............-....---------------.--.-...----......................
ENSGGOP00000013959  -----------.............-....---------------.--.-...----......................
ENSGGOP00000024093  LNFQGNYISYI.............Dg...NVWKAYSWTEKLILS.EN.Y...LTEL......................
ENSGGOP00000015656  -----------.............-....---------------.--.-...----......................
ENSGGOP00000027053  LNFQGNYISYI.............Ge...DVWKAYSWTEKLILN.EN.Y...LTEL......................
ENSGGOP00000026787  -----------.............-....---------------.--.-...----......................
ENSGGOP00000013969  LDCGGRGLAAL.............P....G--DLPSWTRSLNLS.YN.R...LSEI......................
ENSGGOP00000018989  -----------.............-....---------------.--.-...----......................
ENSGGOP00000017510  LVLDNSRSNEG.............Kle..GLTDEFEELEFLNTI.NI.G...LTSI......................
ENSGGOP00000028171  -----------.............-....-------TLLPLNPN.SN.K...AYQM......................
ENSGGOP00000003513  LNWTSSSIRTV.............Dl...IPVDQFRNVCNVNLQ.NN.H...LTSF......................
ENSGGOP00000026797  -----------.............-....-------------FS.GL.S...LSLP......................
ENSGGOP00000016519  -----------.............-....-------------FS.GL.S...LSLP......................
ENSGGOP00000025973  IYCNDRGLTSI.............P....T--DIPDDATTLYLQ.NN.Q...INNA......................
ENSGGOP00000003012  -----------.............-....-LFSHLTKLQILRVG.NM.D...TFTK......................
ENSGGOP00000028210  -----------.............-....----------TLNFQ.GN.Y...ISYI......................
ENSGGOP00000025364  IYCNDRFLTSI.............P....T--GIPEDATTLYLQ.NN.Q...INNA......................
ENSGGOP00000007122  -----------.............-....---------------.--.-...-RSL......................


                                                           60                                70     
                                                            |                                 |     
d1a9na_               ..............................DG.....FPLLRRLKTL........................LVNNN..
ENSGGOP00000002818  ..............................PAa....LLPLAGLEEL........................YLSRN..
ENSGGOP00000026867  ..............................PTal...LEPLHSLEAL........................DLSGN..
ENSGGOP00000014553  ..............................PEel...FHPLTSLQTL........................KLSNN..
ENSGGOP00000006261  ..............................EDhs...FAGLASLQEL........................YLNHN..
ENSGGOP00000007172  ..............................SPgi...FGPMPNLREL........................WLYDN..
ENSGGOP00000005919  ..............................PEra...FRGLHSLDRL........................LLHQN..
ENSGGOP00000024063  ..............................PEv....LEQLSGLKEF........................WMDAN..
ENSGGOP00000013969  ..............................HRkg...WSFCQKLHEL........................VLSFN..
ENSGGOP00000007076  ..............................PEv....LEQLSGLKEF........................WMDAN..
ENSGGOP00000015022  ..............................CPa....LGLLSSLESL........................DLSYN..
ENSGGOP00000010210  ..............................PRka...FRGITDVKNL........................QLDNN..
ENSGGOP00000025646  ..............................TDyc...LQDLSNLQEL........................YINHN..
ENSGGOP00000008275  ..............................PDs....LDNLKKLRML........................DLRHN..
ENSGGOP00000004396  ..............................GPgv...FSGLSALTLL........................DLRLN..
ENSGGOP00000027814  ..............................TEhv...FRGLGSLDRL........................LLHGN..
ENSGGOP00000009302  ..............................TEhv...FRGLGSLDRL........................LLHGN..
ENSGGOP00000010181  ..............................PLgv...FTGLSNLTKL........................DISEN..
ENSGGOP00000000462  ..............................PEe....ITNLRNLKCL........................YLQHN..
ENSGGOP00000012823  ..............................PLgv...FTGLSNLTKL........................DISEN..
ENSGGOP00000008393  ..............................HNkt...FHPVPNLRNL........................DLSYN..
ENSGGOP00000017408  ..............................PDt....LGALPNLREL........................WLDRN..
ENSGGOP00000003137  ..............................RPgs...FQGLTSLRKL........................WLMHA..
ENSGGOP00000019249  ..............................RPgs...FQGLTSLRKL........................WLMHA..
ENSGGOP00000013132  ..............................PQea...LDGLGSLRRL........................ELEGN..
ENSGGOP00000024818  ..............................PQea...LDGLGSLRRL........................ELEGN..
ENSGGOP00000023908  ..............................PNtt...FTQLINLQNL........................DLSFN..
ENSGGOP00000024673  ..............................GSgt...FVGMVALRIL........................DLSNN..
ENSGGOP00000026305  ..............................RPgs...FHGLSSLKKL........................WVMNS..
ENSGGOP00000009400  ..............................RPgs...FHGLSSLKKL........................WVMNS..
ENSGGOP00000007056  ..............................RKdd...FKGLQHLYAL........................VLVNN..
ENSGGOP00000005706  ..............................PAea...LWELPSLQSL........................RLDAN..
ENSGGOP00000023515  ..............................SLc....IDQWVHVETL........................NLSRN..
ENSGGOP00000003028  ..............................SLc....IDQWVHVETL........................NLSRN..
ENSGGOP00000002850  ..............................PTea...LQNLRSLQSL........................RLDAN..
ENSGGOP00000006625  ..............................RPgs...FQGLMHLQKL........................WMIQS..
ENSGGOP00000005450  ..............................RSgm...FRGLDGLRTL........................MLRNN..
ENSGGOP00000019824  ..............................NKgw...LYGLRMLQQL........................YVSQN..
ENSGGOP00000001938  ..............................KEnd...FKGLTSLYGL........................ILNNN..
ENSGGOP00000006377  ..............................PRgl...LSPLVNLFIL........................QLNNN..
ENSGGOP00000028264  ..............................KEnd...FKGLTSLYGL........................ILNNN..
ENSGGOP00000021709  ..............................PEkc...LSKLSNLQEL........................YINHN..
ENSGGOP00000025918  ..............................LNnt...FRPVTNLRNL........................DLSYN..
ENSGGOP00000008365  ..............................PAda...FRGLRRLRTL........................NLGGN..
ENSGGOP00000006124  ..............................KAnv...FVQLPRLQKL........................YLDRN..
ENSGGOP00000015799  ..............................DDss...FLGLSLLNTL........................HIGNN..
ENSGGOP00000010984  ..............................PSd....LECLGNLEIL........................SLGKN..
ENSGGOP00000012493  ..............................EG.....LENNNKLTML........................DIASN..
ENSGGOP00000018354  ..............................PKgl...LGAQAKLERL........................LLHSN..
ENSGGOP00000001578  ..............................PNtt...FRPMPNLRSV........................DLSYN..
ENSGGOP00000004548  ..............................PDt....LGALPNLREL........................WLDRN..
ENSGGOP00000013132  ..............................RDgaf..QPVGRSLQHL........................FLNSS..
ENSGGOP00000024818  ..............................RDgaf..QPVGRSLQHL........................FLNSS..
ENSGGOP00000025004  ..............................PSea...IRGLSALQSL........................RLDAN..
ENSGGOP00000025833  ..............................PSea...IRGLSALQSL........................RLDAN..
ENSGGOP00000016600  ..............................PAd....IGLLQNLQNL........................AITAN..
ENSGGOP00000006124  ..............................PEqv...FRGLGKLHSL........................HLEGS..
ENSGGOP00000005521  ..............................PK.....-HLPPALYKL........................HLKNN..
ENSGGOP00000001854  ..............................PP.....DLPGTHLIRL........................YLQDN..
ENSGGOP00000019138  ..............................TNet...FRGLRRLERL........................YLGKN..
ENSGGOP00000021712  ..............................PPs....ITHVKNLESL........................YFSNN..
ENSGGOP00000015564  ..............................PS.....-ALPRNLEQL........................RLSQN..
ENSGGOP00000012531  ..............................HA.....----------........................-----..
ENSGGOP00000020501  ..............................PK.....-HLPPALYKL........................HLKNN..
ENSGGOP00000003727  ..............................PE.....-KMPKTLQEL........................RAHEN..
ENSGGOP00000025379  ..............................PDya...FQNLTSLVVL........................HLHNN..
ENSGGOP00000025364  ..............................PV.....NLPGTNLRKL........................YLQDN..
ENSGGOP00000011582  ..............................PG.....-PLPRSLREL........................HLDHN..
ENSGGOP00000023288  ..............................TNyt...FSNMSHLSTL........................ILSYN..
ENSGGOP00000010210  ..............................TNyt...FSNMSHLSTL........................ILSYN..
ENSGGOP00000019616  ..............................PDfa...FTNLSSLVVL........................HLHNN..
ENSGGOP00000026995  ..............................EEivs..FQHLRKLTVL........................KLWHN..
ENSGGOP00000003265  ..............................PEs....IGALLHLKDL........................WLDGN..
ENSGGOP00000024614  ..............................PPgl...LANFTLLRTL........................DLGEN..
ENSGGOP00000025637  ..............................PA.....--LPASLQEL........................KLNDN..
ENSGGOP00000014142  ..............................GTgs...LRGPVNLQHL........................ILSGN..
ENSGGOP00000013300  ..............................PS.....-QLPSTLEEL........................KINEN..
ENSGGOP00000022805  ..............................PSq....LGLCSGLRLL........................DVSHN..
ENSGGOP00000025292  ..............................PS.....-QLPSTLEEL........................KINEN..
ENSGGOP00000025973  ..............................PL.....NLPSAHLQKL........................YLQDN..
ENSGGOP00000002611  ..............................RPgi...FKDLHQLTWL........................ILDDN..
ENSGGOP00000015422  ..............................TNgs...LPAGTRLRRL........................DVSCN..
ENSGGOP00000015431  ..............................TNgs...LPAGTRLRRL........................DVSCN..
ENSGGOP00000000213  ..............................PLl....GQTLPALTVL........................DVSFN..
ENSGGOP00000025405  ..............................PLl....GQTLPALTVL........................DVSFN..
ENSGGOP00000022526  ..............................PS.....-GLPVSLLTL........................YLDNN..
ENSGGOP00000014753  ..............................PGs....IGKLKMLVYL........................DMSKN..
ENSGGOP00000020501  ..............................PP.....-GLPRNVHVL........................KVKRN..
ENSGGOP00000003295  ..............................PSy....LLKMSCIANL........................DVSRN..
ENSGGOP00000022737  ..............................GTgs...LRGPVNLQHL........................ILSGN..
ENSGGOP00000007465  ..............................--.....----------........................-----..
ENSGGOP00000016887  ..............................TNdm...FSGLSNLHHL........................ILNNN..
ENSGGOP00000018050  ..............................TNdm...FSGLSNLHHL........................ILNNN..
ENSGGOP00000023473  ..............................TNdm...FSGLSNLHHL........................ILNNN..
ENSGGOP00000010984  ..............................PRe....LCTLENLQVL........................DLSEN..
ENSGGOP00000024701  ..............................PKqm...CAQMPQLNWV........................DLEGN..
ENSGGOP00000027247  ..............................PGgpvyfLKGLSHLHIL........................NLESN..
ENSGGOP00000020624  ..............................SWrk...LQCLKNLETL........................DLSHN..
ENSGGOP00000009427  ..............................PS.....-PLPRSLEQL........................QLARN..
ENSGGOP00000006033  ..............................SNqs...FSNMTQLLTL........................ILSYN..
ENSGGOP00000028049  ..............................SNqs...FSNMTQLLTL........................ILSYN..
ENSGGOP00000022833  ..............................PPs....ITHVKNLESL........................YFSNN..
ENSGGOP00000008475  ..............................--.....----------........................-----..
ENSGGOP00000001704  ..............................LLerl..LGEAPSLHTL........................SLSEN..
ENSGGOP00000002826  ..............................NPev...FYGLNFLRLV........................HLEGN..
ENSGGOP00000008650  ..............................CIpv...LVGHLHLRIL........................HLANN..
ENSGGOP00000013968  ..............................--.....----------........................-----..
ENSGGOP00000007909  ..............................DCcslq.LKNLSHLQTL........................NLSHN..
ENSGGOP00000003513  ..............................NDsa...FAKPSSLLAL........................HLEEN..
ENSGGOP00000016854  ..............................PE.....RLERTSVEVL........................DVQHN..
ENSGGOP00000022025  ..............................NWtl...LQQFPRLELL........................DLRGN..
ENSGGOP00000012021  ..............................NWtl...LQQFPRLELL........................DLRGN..
ENSGGOP00000027247  ..............................SDkt...FAFCTNLTEL........................HLMSN..
ENSGGOP00000012881  esrtppitiflstsllsivlmnnvltrlpdKPl....CQHMPRLHWL........................DLEGN..
ENSGGOP00000013469  ..............................--.....----------........................-----..
ENSGGOP00000014079  ..............................ERnsf..VGLSFESVIL........................WLNKN..
ENSGGOP00000021874  ..............................PDkpl..CQHMPRLHWL........................DLEGN..
ENSGGOP00000020681  ..............................LDft...FLHLPRLQEL........................HLQEN..
ENSGGOP00000013987  ..............................LDft...FLHLPRLQEL........................HLQEN..
ENSGGOP00000024070  ..............................PSq....IGNLLNLQTL........................CLDGN..
ENSGGOP00000013477  ..............................STse...LGHLEQLQVL........................TLRHN..
ENSGGOP00000005073  ..............................PE.....RLERTSVEVL........................DVQHN..
ENSGGOP00000018071  ..............................--.....----------........................-----..
ENSGGOP00000007465  ..............................--.....----------........................-----..
ENSGGOP00000027332  ..............................PA.....-GLPRTLAIL........................HLGRN..
ENSGGOP00000013375  ..............................--.....----------........................-----..
ENSGGOP00000023252  ..............................PA.....-GLPRTLAIL........................HLGRN..
ENSGGOP00000008663  ..............................GEdt...LRGLVNLQHL........................IVNNN..
ENSGGOP00000027539  ..............................ADea...FYGLDNLQVL........................NLSYN..
ENSGGOP00000008275  ..............................PNe....IAYLKDLQKL........................VLTNN..
ENSGGOP00000012531  ..............................--.....----------........................-----..
ENSGGOP00000009848  ..............................EAfs...SYWLPLLQNI........................TISQN..
ENSGGOP00000005706  ..............................PS.....LHRCQKLEEI........................GLQHN..
ENSGGOP00000004424  ..............................--.....----------........................-----..
ENSGGOP00000004424  ..............................--.....----------........................-----..
ENSGGOP00000003450  ..............................TGqt...LQGLSNLMRL........................HIDHN..
ENSGGOP00000005521  ..............................PP.....-GLPRNVHVL........................KVKRN..
ENSGGOP00000024070  ..............................CIpv...LVGHLHLRIL........................HLANN..
ENSGGOP00000004344  ..............................PPe....LGDCENLERL........................DCSGNl.
ENSGGOP00000024903  ..............................PTq....ISSLQKLKHL........................NLGMN..
ENSGGOP00000007876  ..............................HIre...HEPPGALTEL........................DLSHN..
ENSGGOP00000002850  ..............................PS.....FSVCQKLQKI........................DLRHN..
ENSGGOP00000001704  ..............................EArr...SGSLPCLMLL........................DLSHN..
ENSGGOP00000024790  ..............................PLl....GQTLPALTVL........................DVSFN..
ENSGGOP00000012480  ..............................DRqa...FKGLASLEQL........................YLHFN..
ENSGGOP00000004216  ..............................PRdv...LAQLPSLRHL........................DLSNN..
ENSGGOP00000026324  ..............................PRdv...LAQLPSLRHL........................DLSNN..
ENSGGOP00000022546  ..............................DLkt...FEFNKELRYL........................DLSNN..
ENSGGOP00000006438  ..............................PAe....IENLQSLECL........................YLGGN..
ENSGGOP00000009953  ..............................PEe....MKYLTSLKNL........................HLSGN..
ENSGGOP00000001696  ..............................RPke...FEDVHELKKL........................NLSSN..
ENSGGOP00000027978  ..............................PRe....VSLLQCLKVL........................FVNMN..
ENSGGOP00000023252  ..............................PPr....LHSSLILFSL........................-VQNN..
ENSGGOP00000023288  ..............................AKgl...FDGLVSLQLL........................LLNAN..
ENSGGOP00000000058  ..............................PGvqssdEIICSRLLEI........................DISSN..
ENSGGOP00000022509  ..............................GAga...FRSAGRLVKL........................SLANN..
ENSGGOP00000027332  ..............................PPr....LNASG--NHF........................ELKNN..
ENSGGOP00000012870  ..............................DIsv...FRFNQELEYL........................DLSHN..
ENSGGOP00000010388  ..............................DRdl...LRRSPLLRHL........................DLSIN..
ENSGGOP00000028222  ..............................PWsd...LRNLSALQLL........................KMNHN..
ENSGGOP00000010955  ..............................AWsd...LHNLSALQLL........................KMDSN..
ENSGGOP00000028499  ..............................AWsd...LHNLSALQLL........................KMDSN..
ENSGGOP00000009373  ..............................PDe....ICNLKKLETL........................SLNNN..
ENSGGOP00000015422  ..............................ITktka.FQGLTQLRKL........................NLSFN..
ENSGGOP00000026779  ..............................PSe....LSLLQNLRTL........................WIEAN..
ENSGGOP00000011147  ..............................TDssfg.GTNLHSLRYL........................DLSNN..
ENSGGOP00000013381  ..............................PP.....YICQLPLRVL........................IVSNN..
ENSGGOP00000001892  ..............................PK.....YLFDLPLKVL........................VVSNN..
ENSGGOP00000023288  ..............................PEll...FQSTPKLTRLfyklayyipiprkafwfikiapprQLDNN..
ENSGGOP00000020624  ..............................QEdd...FNNLNQLQIL........................DLSGN..
ENSGGOP00000021650  ..............................PTq....ISSLQKLKHL........................NLGMN..
ENSGGOP00000018071  ..............................--.....----------........................-----..
ENSGGOP00000013375  ..............................--.....----------........................-----..
ENSGGOP00000007909  ..............................AEts...LNGPKSLKHL........................FLIQT..
ENSGGOP00000020706  ..............................SPta...FNSLSSLQVL........................NMSHN..
ENSGGOP00000021036  ..............................SPta...FNSLSSLQVL........................NMSHN..
ENSGGOP00000025923  ..............................SAgt...FDSMPNLQLL........................YLNNN..
ENSGGOP00000001368  ..............................ESrl...FHSLPQLREL........................DLSSN..
ENSGGOP00000020939  ..............................CPe....IGRLRALRHL........................RLANN..
ENSGGOP00000023533  ..............................CPe....IGRLRALRHL........................RLANN..
ENSGGOP00000003534  ..............................GAga...FRSAGRLVKL........................SLANN..
ENSGGOP00000013469  ..............................--.....----------........................-----..
ENSGGOP00000015192  ..............................PAelfr.PGALPLLSEL........................AAADN..
ENSGGOP00000026520  ..............................PAelfr.PGALPLLSEL........................AAADN..
ENSGGOP00000008114  ..............................PAdm...FQEAHGLVHI........................DLSHNp.
ENSGGOP00000026663  ..............................DPga...FWGLSSLKRL........................DLTNN..
ENSGGOP00000003265  ..............................PEe....ISGLTSLTDL........................VISQN..
ENSGGOP00000005450  ..............................PRgv...FGGLYTLQLL........................LLNAN..
ENSGGOP00000002218  ..............................QPaa...FSLMPNLKLL........................FLNNN..
ENSGGOP00000004826  ..............................APgt...FAPLRELRNL........................SLAGN..
ENSGGOP00000026086  ..............................DPsa...FGGLSQLQKL........................YLSGN..
ENSGGOP00000022939  ..............................RDda...FAGLFHLEYL........................FIEGN..
ENSGGOP00000012492  ..............................PV.....HLCNLPLKVL........................IASNN..
ENSGGOP00000024274  ..............................DRca...FDDMAQLQKL........................YLSQN..
ENSGGOP00000023118  ..............................QSgt...FDPVPNLQLL........................FLNNN..
ENSGGOP00000007876  ..............................MAalm..LRNLSSLRSV........................SLAGN..
ENSGGOP00000010514  ..............................PPa....LGALSTLQRL........................DLSQN..
ENSGGOP00000023229  ..............................P-.....LRLPGTLTRL........................DLKSS..
ENSGGOP00000028543  ..............................AAgal..DDCAETLEDL........................DLSYN..
ENSGGOP00000016064  ..............................EAga...FSKLNKLKVL........................ILNDN..
ENSGGOP00000016064  ..............................KPlt...FDALINLQLL........................FLNNN..
ENSGGOP00000022050  ..............................AAgal..DDCAETLEDL........................DLSYN..
ENSGGOP00000007162  ..............................SPft...FSVLSNLVQL........................NIANNp.
ENSGGOP00000023394  ..............................LPgt...FNAMPKLRIL........................ILNNN..
ENSGGOP00000016854  ..............................PAa....VGVMHNLQTF........................LLDGN..
ENSGGOP00000027736  ..............................LPgt...FNPMPKLKVL........................YLNNN..
ENSGGOP00000005073  ..............................PAa....VGVMHNLQTF........................LLDGN..
ENSGGOP00000025004  ..............................PS.....FNGCHALEEI........................SLQRN..
ENSGGOP00000025833  ..............................PS.....FNGCHALEEI........................SLQRN..
ENSGGOP00000002210  ..............................SDda...FIGLPHLEYL........................FIENN..
ENSGGOP00000010355  ..............................GRhd...LDGLGALEKL........................LLFNN..
ENSGGOP00000028049  ..............................PKsl...FEGLFSLQLL........................LLTVT..
ENSGGOP00000023394  ..............................DPga...FQDLNKLEVL........................ILNDN..
ENSGGOP00000015593  ..............................NGl....EAVGDTLEEL........................WISYN..
ENSGGOP00000012568  ..............................QPga...FLGLGELKRL........................DLSNN..
ENSGGOP00000023118  ..............................EPna...FGKLHLLQVL........................ILNDN..
ENSGGOP00000025923  ..............................ERga...FNKLHKLKVL........................ILNDN..
ENSGGOP00000027736  ..............................EPna...FSKLNRLKVL........................ILNDN..
ENSGGOP00000000821  ..............................GDna...FTGLSHLQYL........................FIENN..
ENSGGOP00000021010  ..............................EDda...FAGLSHLQYL........................FIEDN..
ENSGGOP00000001364  ..............................PWas...LLDMPLLRTL........................DLHNN..
ENSGGOP00000020706  ..............................ALga...FSGLSSLQKL........................VAVET..
ENSGGOP00000021036  ..............................ALga...FSGLSSLQKL........................VAVET..
ENSGGOP00000020993  ..............................TEgm...LRGMSRLQFL........................FVQHN..
ENSGGOP00000002485  ..............................EG.....LEDLSNLTTL........................HLRDN..
ENSGGOP00000027543  ..............................PGa....FWGLSSLKRL........................DLTNN..
ENSGGOP00000019774  ..............................EAna...FDNLLNLSEI........................LIQNTk.
ENSGGOP00000010786  ..............................PKg....LWKLKSLQSL........................DLSFN..
ENSGGOP00000024131  ..............................EG.....LEDLSNLTTL........................HLRDN..
ENSGGOP00000002218  ..............................RNdt...FLGLESLEYL........................QADYN..
ENSGGOP00000008273  ..............................EAna...FDNLLNLSEI........................LIQNTk.
ENSGGOP00000015431  ..............................ITktka.FQGLTQLRKL........................NLSFN..
ENSGGOP00000008661  ..............................PKq....VVKLEALQEL........................NVAFN..
ENSGGOP00000027149  ..............................--.....EENIPELLSL........................NLSNN..
ENSGGOP00000013614  ..............................DN.....LNGLDSLTEL........................NLRHN..
ENSGGOP00000001884  ..............................--.....EENIPELLSL........................NLSNN..
ENSGGOP00000017691  ..............................--.....EENIPELLSL........................NLSNN..
ENSGGOP00000017973  ..............................DKqt...FKGLISLEHL........................YIHFN..
ENSGGOP00000000481  ..............................EG.....LDTLVNLEDL........................SLFNN..
ENSGGOP00000025013  ..............................EG.....LDTLVNLEDL........................SLFNN..
ENSGGOP00000019011  ..............................PWas...LLDMPLLRTL........................DLHNN..
ENSGGOP00000012497  ..............................PE.....--LPTTLTFI........................DISNN..
ENSGGOP00000017205  ..............................PQs....IGQMTSLLYL........................NVSNN..
ENSGGOP00000004288  ..............................PQs....IGQMTSLLYL........................NVSNN..
ENSGGOP00000012465  ..............................PWta...FRATPLLRVL........................DLKRN..
ENSGGOP00000000942  ..............................EG.....IENMCNLQKL........................NLAGN..
ENSGGOP00000012474  ..............................PWaa...LRDAPQLRLL........................DLQAN..
ENSGGOP00000000462  ..............................PEv....LYHIFTLETI........................LISNN..
ENSGGOP00000022001  ..............................GD.....LSKLVSLKTL........................LLHGN..
ENSGGOP00000025605  ..............................GD.....LSKLVSLKTL........................LLHGN..
ENSGGOP00000005450  ..............................PRka...FRGATDLKNL........................QLDKN..
ENSGGOP00000000638  ..............................PDd....LGQLTALQVL........................NVERN..
ENSGGOP00000017288  ..............................SPft...FSVLSNLVQL........................NIANNp.
ENSGGOP00000008256  ..............................EShs...FYNLSKVTHI........................EIRNTr.
ENSGGOP00000015431  ..............................DSas...LAGLHALRFL........................FMDGN..
ENSGGOP00000000795  ..............................EN.....VSKLKKLEYL........................NLALN..
ENSGGOP00000007172  ..............................PIgl...FQGLDSLESL........................LLSSN..
ENSGGOP00000027628  ..............................EG.....LEELINLTRL........................NVSYN..
ENSGGOP00000002833  ..............................EPga...LAVLSQLKNL........................DLSHN..
ENSGGOP00000017434  ..............................-Ii....ERNFPELLSL........................NLCDN..
ENSGGOP00000010817  ..............................SValch.STLQKSLRSL........................DLSKN..
ENSGGOP00000011344  ..............................SN.....LPKLPKLKKL........................ELSEN..
ENSGGOP00000020930  ..............................SN.....LPKLPKLKKL........................ELSEN..
ENSGGOP00000015568  ..............................PV.....--LPSGIEFL........................DVRLN..
ENSGGOP00000015042  ..............................AN.....LPKLNKLKKL........................ELSDN..
ENSGGOP00000018300  ..............................EShs...FYNLSKVTHI........................EIRNTr.
ENSGGOP00000026851  ..............................TG.....LEDLKALQNL........................NLSHN..
ENSGGOP00000026693  ..............................AN.....LPKLNKLKKL........................ELSDN..
ENSGGOP00000015068  ..............................DG.....IASLPALKEL........................YASYN..
ENSGGOP00000004548  ..............................PRs....LGKLTKLTNL........................NVDRN..
ENSGGOP00000006033  ..............................PPga...FSPYKKLRRI........................DLSNN..
ENSGGOP00000027647  ..............................TG.....LEDLKALQNL........................NLSHN..
ENSGGOP00000027539  ..............................HPda...FQGLFHLFEL........................RLYFC..
ENSGGOP00000012360  ..............................EN.....LACIPSLRFL........................SLAGN..
ENSGGOP00000006033  ..............................PRka...FRGAVDIKNL........................QLDYN..
ENSGGOP00000028049  ..............................PRka...FRGAVDIKNL........................QLDYN..
ENSGGOP00000027098  ..............................PSd....FCGLTHLVKL........................DLSKN..
ENSGGOP00000011109  ..............................PWea...VGQMVNLNTL........................TLDHN..
ENSGGOP00000005584  ..............................SI.....CREMPSLEVI........................TLSVN..
ENSGGOP00000019188  ..............................NQlyl..IAHLPRLEQL........................ILSDT..
ENSGGOP00000015022  ..............................PEh....IRKLQSLKEL........................YIENN..
ENSGGOP00000021155  ..............................DG.....FPLLRRLKTL........................LVNNN..
ENSGGOP00000006065  ..............................PV.....--LPPKLTLF........................NAKYN..
ENSGGOP00000008763  ..............................PNei...FKDLHQLRVL........................NLSKN..
ENSGGOP00000008108  ..............................PAga...FQHLPALEEL........................DLSHN..
ENSGGOP00000013299  ..............................NQlyl..IAHLPRLEQL........................ILSDT..
ENSGGOP00000006171  ..............................PSd....FCGLTHLVKL........................DLSKN..
ENSGGOP00000023255  ..............................SI.....CREMPSLEVI........................TLSVN..
ENSGGOP00000025379  ..............................PS.....LHRCQKLEEIps......................GLQHN..
ENSGGOP00000010879  ..............................GP.....LASLRQLAVL........................NVSNN..
ENSGGOP00000008240  ..............................PDga...FQHLHRLREL........................DLSHN..
ENSGGOP00000004098  ..............................TN.....LNYATNLTHL........................YLQNN..
ENSGGOP00000017344  ..............................TKtd...FAGLRHLRVL........................QLMEN..
ENSGGOP00000018814  ..............................TEirkl.GVMFPSLDTL........................VLANN..
ENSGGOP00000025873  ..............................TEirkl.GVMFPSLDTL........................VLANN..
ENSGGOP00000004959  ..............................TF.....LTRNYCLTEL........................YLNNN..
ENSGGOP00000024368  ..............................SN.....LPKLPKLKKL........................ELSEN..
ENSGGOP00000011594  ..............................AR.....LPSLNKLRKL........................ELSDN..
ENSGGOP00000014157  ..............................AIcd...LGILPHLRVL........................LLTGN..
ENSGGOP00000013487  ..............................ELrd...LRGLGELRNL........................TIVKS..
ENSGGOP00000022399  ..............................HP.....LQSCVKLIKL........................DLHGN..
ENSGGOP00000016688  ..............................EClc...ARPPASLQHL........................GLGRN..
ENSGGOP00000023599  ..............................PSe....VSALQHLKAI........................DLSRN..
ENSGGOP00000013768  ..............................PSe....VSALQHLKAI........................DLSRN..
ENSGGOP00000012563  ..............................HNds...FEGLLSLQYL........................DLSCN..
ENSGGOP00000008281  ..............................GDa....FRNFKNLRSL........................DLSRN..
ENSGGOP00000021469  ..............................SN.....LPKLPKLKKF........................VLSEN..
ENSGGOP00000006875  ..............................--.....--------AL........................DVSHN..
ENSGGOP00000017558  ..............................QP.....GHFSPAMVTL........................WIYSN..
ENSGGOP00000007076  ..............................PAs....IANLINLREL........................DVSKN..
ENSGGOP00000008661  ..............................DLsv...FKFNQDLEYL........................DLSHN..
ENSGGOP00000002527  ..............................EG.....LSAFRSLEEL........................ILDNN..
ENSGGOP00000025482  ..............................SD.....LPKL-KLRKL........................ELRVS..
ENSGGOP00000028761  ..............................PQdf...FQLLPNLTWL........................DLWYN..
ENSGGOP00000010362  ..............................THlghs.LMSLTGLKSL........................DLSRN..
ENSGGOP00000000179  ..............................--.....---LNKLRKL........................ELSDN..
ENSGGOP00000024608  ..............................HNds...FEGLLSLQYL........................DLSCN..
ENSGGOP00000025066  ..............................PPd....IAKLHNLVYL........................DLSSN..
ENSGGOP00000023515  ..............................HGe....LSSLPSLRAI........................VARAN..
ENSGGOP00000003028  ..............................PEe....LAALQKLEHL........................SVSHN..
ENSGGOP00000023998  ..............................--.....-ELYTGLQKL........................TIKNS..
ENSGGOP00000009979  ..............................--.....-ELYTGLQKL........................TIKNS..
ENSGGOP00000024063  ..............................PKq....LFNCQSLHKL........................SLPDN..
ENSGGOP00000025398  ..............................HLdpkl.LCRLTQLQEL........................DLSNN..
ENSGGOP00000008650  ..............................D-.....LSSLCSLEQL........................HCGRN..
ENSGGOP00000025808  ..............................DGlsdi.IEKAPKVKTL........................NLSKN..
ENSGGOP00000003989  ..............................DGlsdi.IEKAPKVKTL........................NLSKN..
ENSGGOP00000010116  ..............................VNpsaprCMWSSALNSL........................NLSFA..
ENSGGOP00000012588  ..............................--.....----------........................-----..
ENSGGOP00000013959  ..............................--.....-EAYVGLRNL........................TIVDS..
ENSGGOP00000024093  ..............................HKds...FEGLLSLQYRq.......................DLSCN..
ENSGGOP00000015656  ..............................--.....-RNFPELLSL........................NLCNN..
ENSGGOP00000027053  ..............................HRds...FEGLLSLQYWq.......................DLSCN..
ENSGGOP00000026787  ..............................--.....----------........................-----..
ENSGGOP00000013969  ..............................DPag...FEDLPNLQEV........................YLNNN..
ENSGGOP00000018989  ..............................--.....LAPLTELRLL........................GLAGN..
ENSGGOP00000017510  ..............................AN.....LPKLNKLKKL........................ELSSNra
ENSGGOP00000028171  ..............................LDi....MPKAPNINKL........................NFLKN..
ENSGGOP00000003513  ..............................SG.....LIYLPNVKVL........................CLNYN..
ENSGGOP00000026797  ..............................HNq....SLRASNVILL........................DLSGN..
ENSGGOP00000016519  ..............................HNq....SLRASNVILL........................DLSGN..
ENSGGOP00000025973  ..............................GIpqd..LKTKVNVQVI........................YLYEN..
ENSGGOP00000003012  ..............................IQrkd..FAGLTFLEEL........................EIDAS..
ENSGGOP00000028210  ..............................DGnv...WKAYSWTEKL........................ILNRN..
ENSGGOP00000025364  ..............................GIpsd..LKNLLKVERI........................YLYHN..
ENSGGOP00000007122  ..............................SAs....LWSLTHLTAL........................HLSDN..


                                                 80                                          90     
                                                  |                                           |     
d1a9na_               .....RICR.................IGE.................GL...D...QA.L.........PDL.T.....
ENSGGOP00000002818  .....QLTS.................VPS.................L-...I...SG.L.........GRL.L.....
ENSGGOP00000026867  .....ELSA.................LHP.................AT...F...GH.L.........GRL.R.....
ENSGGOP00000014553  .....ALSG.................LPQ.................GV...F...GK.L.........GSL.Q.....
ENSGGOP00000006261  .....QLYR.................IAP.................RA...F...SG.L.........SNL.L.....
ENSGGOP00000007172  .....HISS.................LPD.................NV...F...SN.L.........RQL.Q.....
ENSGGOP00000005919  .....RVAH.................VHP.................HA...F...RD.L.........GRL.M.....
ENSGGOP00000024063  .....RLTF.................IPG.................F-...I...GS.L.........KQL.T.....
ENSGGOP00000013969  .....NLTR.................LDE.................ES...L...AE.L.........SSL.S.....
ENSGGOP00000007076  .....RLTF.................IPG.................F-...I...GS.L.........KQL.T.....
ENSGGOP00000015022  .....PIFS.................SSL.................VV...V...SF.L.........HAL.R.....
ENSGGOP00000010210  .....HISC.................IED.................GA...F...RA.L.........RDL.E.....
ENSGGOP00000025646  .....QIST.................ISA.................HA...F...AG.L.........KNL.L.....
ENSGGOP00000008275  .....KLRE.................IPS.................V-...V...YR.L.........DSL.T.....
ENSGGOP00000004396  .....QIVL.................FLD.................GA...F...GE.L.........GSL.Q.....
ENSGGOP00000027814  .....RLQG.................VHR.................AA...F...RG.L.........SRL.T.....
ENSGGOP00000009302  .....RLQG.................VHR.................AA...F...RG.L.........SRL.T.....
ENSGGOP00000010181  .....KIVI.................LLD.................YM...F...QD.L.........YNL.K.....
ENSGGOP00000000462  .....ELTC.................ISE.................G-...F...EQ.L.........SNL.E.....
ENSGGOP00000012823  .....KIVI.................LLD.................YM...F...QD.L.........HNL.K.....
ENSGGOP00000008393  .....KLQT.................LQS.................EQ...F...KG.L.........RKL.I.....
ENSGGOP00000017408  .....QLSA.................LPP.................E-...L...GN.L.........RRL.V.....
ENSGGOP00000003137  .....QVAT.................IER.................NA...F...DD.L.........KSL.E.....
ENSGGOP00000019249  .....QVAT.................IER.................NA...F...DD.L.........KSL.E.....
ENSGGOP00000013132  .....ALEE.................LRP.................GT...F...GA.L.........GAL.A.....
ENSGGOP00000024818  .....ALEE.................LRP.................GT...F...GA.L.........GAL.A.....
ENSGGOP00000023908  .....QLSS.................LHP.................EL...F...YG.L.........RKL.Q.....
ENSGGOP00000024673  .....NILR.................ISE.................SG...F...QH.L.........ENL.A.....
ENSGGOP00000026305  .....QVSL.................IER.................NA...F...DG.L.........ASL.V.....
ENSGGOP00000009400  .....QVSL.................IER.................NA...F...DG.L.........ASL.V.....
ENSGGOP00000007056  .....KISK.................IHE.................KA...F...SP.L.........RKL.Q.....
ENSGGOP00000005706  .....LISL.................VPE.................RS...F...EG.L.........SSL.R.....
ENSGGOP00000023515  .....QLTS.................LPS.................A-...I...CK.L.........SKL.K.....
ENSGGOP00000003028  .....QLTS.................LPS.................A-...I...CK.L.........SKL.K.....
ENSGGOP00000002850  .....HISY.................VPP.................GC...F...SG.L.........HSL.R.....
ENSGGOP00000006625  .....QIQV.................IER.................NA...F...DN.L.........QSL.V.....
ENSGGOP00000005450  .....RISC.................IHN.................DS...F...TG.L.........RNV.R.....
ENSGGOP00000019824  .....AIER.................ISP.................DA...W...EF.C.........QRL.S.....
ENSGGOP00000001938  .....KLTK.................IHP.................KA...F...LT.T.........KKL.R.....
ENSGGOP00000006377  .....KIRE.................LRA.................GA...F...QG.A.........KDL.R.....
ENSGGOP00000028264  .....KLTK.................IHP.................KA...F...LT.T.........KKL.R.....
ENSGGOP00000021709  .....LLST.................ISP.................GA...F...IG.L.........HNL.L.....
ENSGGOP00000025918  .....QLHS.................LGS.................EQ...F...RG.L.........RKL.L.....
ENSGGOP00000008365  .....ALDR.................VAR.................AW...F...AD.L.........AEL.E.....
ENSGGOP00000006124  .....LIAA.................VAP.................GA...F...LG.L.........KAL.R.....
ENSGGOP00000015799  .....RVSY.................IAD.................CA...F...RG.L.........SSL.K.....
ENSGGOP00000010984  .....KLRH.................IPD.................T-...L...PS.L.........KNL.R.....
ENSGGOP00000012493  .....RIKK.................IEN.................--...I...SH.L.........TEL.Q.....
ENSGGOP00000018354  .....RLVS.................LDS.................GL...L...NS.L.........GAL.T.....
ENSGGOP00000001578  .....KLQA.................LAP.................DL...F...HG.L.........RKL.T.....
ENSGGOP00000004548  .....QLSA.................LPP.................E-...L...GN.L.........RRL.V.....
ENSGGOP00000013132  .....GLEQ.................ICP.................GA...F...SG.Lg........PGL.Q.....
ENSGGOP00000024818  .....GLEQ.................ICP.................GA...F...SG.Lg........PGL.Q.....
ENSGGOP00000025004  .....HITS.................VPE.................DS...F...EG.L.........VQL.R.....
ENSGGOP00000025833  .....HITS.................VPE.................DS...F...EG.L.........VQL.R.....
ENSGGOP00000016600  .....RIET.................LPP.................E-...L...FQ.C.........RKL.R.....
ENSGGOP00000006124  .....CLGR.................IRP.................HT...F...TG.L.........SGL.R.....
ENSGGOP00000005521  .....KLEK.................IPP.................GA...F...SE.L.........SSL.R.....
ENSGGOP00000001854  .....QINH.................IPL.................TA...F...SN.L.........RKL.E.....
ENSGGOP00000019138  .....RIRH.................IQP.................GA...F...DT.L.........DRL.L.....
ENSGGOP00000021712  .....KLES.................LPV.................A-...V...FS.L.........QKL.R.....
ENSGGOP00000015564  .....HISR.................IPP.................GV...F...SK.L.........ENL.L.....
ENSGGOP00000012531  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000020501  .....KLEK.................IPP.................GA...F...SE.L.........SSL.R.....
ENSGGOP00000003727  .....EITK.................VRK.................VT...F...NG.LnqmiviglpPSL.T.....
ENSGGOP00000025379  .....RIQH.................LGT.................HS...F...EG.L.........HNL.E.....
ENSGGOP00000025364  .....HINR.................VPP.................NA...F...SY.L.........RQL.Y.....
ENSGGOP00000011582  .....QISR.................VPN.................NA...L...EG.L.........ENL.T.....
ENSGGOP00000023288  .....RLRC.................IPV.................HA...F...NG.L.........RSL.R.....
ENSGGOP00000010210  .....RLRC.................IPV.................HA...F...NG.L.........RSL.R.....
ENSGGOP00000019616  .....KIKS.................LSQ.................HC...F...DG.L.........DNL.E.....
ENSGGOP00000026995  .....SITY.................IPE.................H-...I...KK.L.........TSL.E.....
ENSGGOP00000003265  .....QLSE.................LPQ.................E-...I...GN.L.........KNL.L.....
ENSGGOP00000024614  .....QLET.................LPP.................DL...L...RG.P.........LQL.E.....
ENSGGOP00000025637  .....LLQG.................LQR.................SS...F...RG.L.........SQL.L.....
ENSGGOP00000014142  .....QLGR.................IAP.................GA...F...DDfL.........ESL.E.....
ENSGGOP00000013300  .....NLQA.................IDE.................ES...L...SD.L.........NQL.V.....
ENSGGOP00000022805  .....GLHS.................LPP.................E-...V...GL.L.........QNL.Q.....
ENSGGOP00000025292  .....NLQA.................IDE.................ES...L...SD.L.........NQL.V.....
ENSGGOP00000025973  .....AISH.................IPY.................NT...L...AK.M.........REL.E.....
ENSGGOP00000002611  .....PITR.................ISQ.................RL...F...TG.L.........NSL.F.....
ENSGGOP00000015422  .....SISF.................VAP.................GF...F...SK.A.........KEL.R.....
ENSGGOP00000015431  .....SISF.................VAP.................GF...F...SK.A.........KEL.R.....
ENSGGOP00000000213  .....RLTS.................LPL.................GA...L...RG.L.........GEL.Q.....
ENSGGOP00000025405  .....RLTS.................LPL.................GA...L...RG.L.........GEL.Q.....
ENSGGOP00000022526  .....KISN.................IPD.................EY...F...KR.F.........NAL.Q.....
ENSGGOP00000014753  .....RIET.................VDM.................D-...I...SG.C.........EAL.E.....
ENSGGOP00000020501  .....ELAA.................LAR.................GA...L...AG.M.........AQL.R.....
ENSGGOP00000003295  .....DIGPsvv..............LDP.................--...T...VK.C.........PTL.K.....
ENSGGOP00000022737  .....QLAA.................APG.................AF...D...DF.L.........ESL.E.....
ENSGGOP00000007465  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000016887  .....QLTL.................ISS.................TA...F...DD.V.........FAL.E.....
ENSGGOP00000018050  .....QLTL.................ISS.................TA...F...DD.V.........FAL.E.....
ENSGGOP00000023473  .....QLTL.................ISS.................TA...F...DD.V.........FAL.E.....
ENSGGOP00000010984  .....QLQK.................ISS.................D-...I...CN.L.........KGI.Q.....
ENSGGOP00000024701  .....RIKY.................LTN.................ST...F...LS.C.........DLL.T.....
ENSGGOP00000027247  .....GFDE.................IPV.................EV...F...KD.L.........SEL.K.....
ENSGGOP00000020624  .....QLTT.................VPE.................RL...S...NC.S.........RSL.K.....
ENSGGOP00000009427  .....KVSR.................IPQ.................GT...F...SN.L.........ENL.T.....
ENSGGOP00000006033  .....RLRC.................IPP.................RT...F...DG.L.........KSL.R.....
ENSGGOP00000028049  .....RLRC.................IPP.................RT...F...DG.L.........KSL.R.....
ENSGGOP00000022833  .....KLES.................LPV.................A-...V...FS.L.........QKL.R.....
ENSGGOP00000008475  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000001704  .....SLTR.................LTR.................HT...F...RD.M.........PAL.E.....
ENSGGOP00000002826  .....QLTK.................LHP.................DT...F...VS.L.........SYL.Qifkis
ENSGGOP00000008650  .....QLQT.................FPA.................SK...L...NK.L.........EQL.E.....
ENSGGOP00000013968  .....----.................---.................--...-...--.Y.........SGL.S.....
ENSGGOP00000007909  .....EPLG.................LQS.................QA...F...KE.C.........PQL.E.....
ENSGGOP00000003513  .....RLRE.................LGK.................--...L...QS.F.........VKL.E.....
ENSGGOP00000016854  .....QLLE.................LPP.................NL...L...MK.A.........DSL.R.....
ENSGGOP00000022025  .....KLLF.................LTD.................SL...S...DF.T.........SSL.R.....
ENSGGOP00000012021  .....KLLF.................LTD.................SL...S...DF.T.........SSL.R.....
ENSGGOP00000027247  .....SIQK.................IKN.................NP...F...VK.Q.........KNL.I.....
ENSGGOP00000012881  .....HIHN.................LRN.................LT...F...IS.C.........SNL.T.....
ENSGGOP00000013469  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000014079  .....GIQE.................IHN.................CA...F...-N.G.........TQL.D.....
ENSGGOP00000021874  .....HIHN.................LRN.................LT...F...IS.C.........SNL.T.....
ENSGGOP00000020681  .....SIEL.................LED.................QA...L...AG.L.........SSL.A.....
ENSGGOP00000013987  .....SIEL.................LED.................QA...L...AG.L.........SSL.A.....
ENSGGOP00000024070  .....FLTT.................LPE.................E-...L...GN.L.........QQL.S.....
ENSGGOP00000013477  .....RIAA.................LRW.................G-...P...GG.P.........AGL.H.....
ENSGGOP00000005073  .....QLLE.................LPP.................NL...L...MK.A.........DSL.R.....
ENSGGOP00000018071  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000007465  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000027332  .....RIRQ.................VEA.................AR...L...HG.A.........RGL.R.....
ENSGGOP00000013375  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000023252  .....RIRQ.................VEA.................AR...L...HG.A.........RGL.R.....
ENSGGOP00000008663  .....QLGG.................IAD.................EA...F...EDfL.........LTL.E.....
ENSGGOP00000027539  .....LLGE.................LYS.................SN...F...YG.L.........PKV.A.....
ENSGGOP00000008275  .....QLTT.................LPR.................G-...I...GH.L.........TNL.T.....
ENSGGOP00000012531  .....----.................---.................--...I...--.-.........---.-.....
ENSGGOP00000009848  .....SLTK.................IVP.................--...L...FH.F.........VSL.E.....
ENSGGOP00000005706  .....RIWE.................IGA.................DT...F...SQ.L.........SSL.Q.....
ENSGGOP00000004424  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000004424  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000003450  .....KIEF.................IHP.................QA...F...NG.L.........TSL.R.....
ENSGGOP00000005521  .....ELAA.................LAR.................GA...L...AG.M.........AQL.R.....
ENSGGOP00000024070  .....QLQT.................FPA.................SK...L...NK.L.........EQL.E.....
ENSGGOP00000004344  .....ELME.................LPF.................E-...L...SN.L.........KQV.T.....
ENSGGOP00000024903  .....RLNT.................LPR.................G-...F...GS.L.........PAL.E.....
ENSGGOP00000007876  .....QLSElh...............LAP.................GL...A...SC.L.........GSL.R.....
ENSGGOP00000002850  .....EIYE.................IKV.................DT...F...QQ.L.........LSL.R.....
ENSGGOP00000001704  .....ALET.................LEL.................G-...A...RA.L.........GSL.R.....
ENSGGOP00000024790  .....RLTS.................LPL.................GA...L...RG.L.........GEL.Q.....
ENSGGOP00000012480  .....QIET.................LDP.................DS...F...QH.L.........PKL.E.....
ENSGGOP00000004216  .....SLVS.................LTY.................VS...F...RN.L.........THL.E.....
ENSGGOP00000026324  .....SLVS.................LTY.................VS...F...RN.L.........THL.E.....
ENSGGOP00000022546  .....RLKS.................VTW.................--...-...YL.L.........AGL.R.....
ENSGGOP00000006438  .....FIKE.................IPP.................E-...L...GN.L.........PSL.N.....
ENSGGOP00000009953  .....RICR.................FAP.................GA...C...DG.L.........QNL.I.....
ENSGGOP00000001696  .....GIEF.................IDP.................AA...F...LG.L.........THL.E.....
ENSGGOP00000027978  .....CLTE.................VPA.................E-...L...SL.C.........RKL.E.....
ENSGGOP00000023252  .....LISK.................VPR.................GA...L...SR.Q.........TQL.R.....
ENSGGOP00000023288  .....KINC.................LRV.................NT...F...QD.L.........QNL.N.....
ENSGGOP00000000058  .....KLSH.................LPP.................G-...F...LH.L.........SKL.Q.....
ENSGGOP00000022509  .....NLVG.................VHE.................DA...F...ET.L.........ESL.Q.....
ENSGGOP00000027332  .....LISK.................VPR.................GA...L...SR.Q.........TQL.R.....
ENSGGOP00000012870  .....KLAK.................ISC.................--...-...HP.T.........VNL.K.....
ENSGGOP00000010388  .....GLAQ.................LPP.................GL...F...DG.L.........LAL.R.....
ENSGGOP00000028222  .....RLGS.................LPR.................DA...L...GA.L.........PDL.R.....
ENSGGOP00000010955  .....ELTF.................IPR.................DA...F...RS.L.........RAL.R.....
ENSGGOP00000028499  .....ELTF.................IPR.................DA...F...RS.L.........RAL.R.....
ENSGGOP00000009373  .....HLRE.................LPS.................T-...F...GQ.L.........SAL.K.....
ENSGGOP00000015422  .....YQKR.................VSFahlsla...........PS...F...GS.L.........VAL.K.....
ENSGGOP00000026779  .....CLTQ.................LPD.................V-...V...CE.L.........SLL.K.....
ENSGGOP00000011147  .....FISY.................IGK.................DA...F...RP.L.........PQL.Q.....
ENSGGOP00000013381  .....KLGA.................LPP.................D-...I...GT.L.........GSL.R.....
ENSGGOP00000001892  .....KLVS.................IPE.................E-...I...GK.L.........KDL.M.....
ENSGGOP00000023288  .....HISC.................IED.................GA...F...RA.L.........RDL.E.....
ENSGGOP00000020624  .....CPRCynapfpcmpcknnsplqIPV.................NA...F...DA.L.........TEL.K.....
ENSGGOP00000021650  .....RLNT.................LPR.................G-...F...GS.L.........PAL.E.....
ENSGGOP00000018071  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000013375  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000007909  .....GISN.................LEF.................IP...V...HN.L.........ENL.E.....
ENSGGOP00000020706  .....NFFS.................LDT.................FP...Y...KC.L.........NSL.R.....
ENSGGOP00000021036  .....NFFS.................LDT.................FP...Y...KC.L.........NSL.R.....
ENSGGOP00000025923  .....LLKS.................LPV.................YI...F...SG.A.........P-L.A.....
ENSGGOP00000001368  .....NISH.................LPT.................SL...G...ET.W.........ENL.T.....
ENSGGOP00000020939  .....QLQF.................LPP.................E-...V...GD.L.........KEL.Q.....
ENSGGOP00000023533  .....QLQF.................LPP.................E-...V...GD.L.........KEL.Q.....
ENSGGOP00000003534  .....NLVG.................VHE.................DA...F...ET.L.........ESL.Q.....
ENSGGOP00000013469  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000015192  .....CLRE.................LSP.................D-...I...AH.L.........ASL.K.....
ENSGGOP00000026520  .....CLRE.................LSP.................D-...I...AH.L.........ASL.K.....
ENSGGOP00000008114  .....WLRR.................VHP.................QA...F...QG.L.........MQL.R.....
ENSGGOP00000026663  .....RIGC.................LNA.................DV...F...RG.L.........TNL.V.....
ENSGGOP00000003265  .....LLET.................IPD.................G-...I...GK.L.........KKL.S.....
ENSGGOP00000005450  .....KINC.................IRP.................DA...F...QD.L.........QNL.S.....
ENSGGOP00000002218  .....LLRT.................LPT.................DA...F...AG.-.........TSL.A.....
ENSGGOP00000004826  .....RLAR.................LEP.................AA...L...GA.L.........PLL.R.....
ENSGGOP00000026086  .....FLTQ.................FPM.................DLyvgR...FK.L.........AEL.M.....
ENSGGOP00000022939  .....KIET.................ISR.................NA...F...RG.L.........RDL.T.....
ENSGGOP00000012492  .....KLVS.................LPE.................E-...I...GH.L.........RHL.M.....
ENSGGOP00000024274  .....QISR.................FPL.................EL...VkegAK.L.........PKL.T.....
ENSGGOP00000023118  .....LLQA.................MPS.................GV...F...SG.L.........T-L.L.....
ENSGGOP00000007876  .....TIMR.................LDD.................SV...F...EG.L.........ERL.R.....
ENSGGOP00000010514  .....LLDT.................LPP.................E-...I...GG.L.........GSL.L.....
ENSGGOP00000023229  .....VIQN.................IAE.................RE...L...KD.L.........KQL.H.....
ENSGGOP00000028543  .....NLEQ.................LPW.................EA...L...GR.L.........GNV.N.....
ENSGGOP00000016064  .....LLLS.................LPS.................N-...V...FR.F.........VLL.T.....
ENSGGOP00000016064  .....LLRS.................LPD.................N-...I...FG.G.........TAL.T.....
ENSGGOP00000022050  .....NLEQ.................LPW.................EA...L...GR.L.........GNV.N.....
ENSGGOP00000007162  .....HLLS.................LHK.................FT...F...AN.T.........TSL.R.....
ENSGGOP00000023394  .....LLRS.................LPV.................DV...F...AG.-.........VSL.S.....
ENSGGOP00000016854  .....FLQS.................LPA.................E-...L...EN.M.........KQL.S.....
ENSGGOP00000027736  .....LLQV.................LPP.................HI...F...SG.V.........P-L.T.....
ENSGGOP00000005073  .....FLQS.................LPA.................E-...L...EN.M.........KQL.S.....
ENSGGOP00000025004  .....QIYQ.................IKE.................GT...F...QG.L.........ISL.R.....
ENSGGOP00000025833  .....QIYQ.................IKE.................GT...F...QG.L.........ISL.R.....
ENSGGOP00000002210  .....NIKS.................ISR.................HT...F...RG.L.........KSL.I.....
ENSGGOP00000010355  .....RLAH.................LDE.................HA...F...HG.L.........RAL.S.....
ENSGGOP00000028049  .....NLLK.................VLS.................--...I...KA.L.........KKI.F.....
ENSGGOP00000023394  .....LIST.................LPA.................N-...V...FQ.Y.........VPI.T.....
ENSGGOP00000015593  .....FIEK.................LKG.................--...I...HV.M.........KKL.K.....
ENSGGOP00000012568  .....RIGC.................LTS.................ET...F...QG.L.........PRL.L.....
ENSGGOP00000023118  .....LLSS.................LPN.................N-...L...FR.F.........VPL.T.....
ENSGGOP00000025923  .....LISF.................LPD.................N-...I...FR.F.........ASL.T.....
ENSGGOP00000027736  .....AIES.................LPP.................N-...I...FR.F.........VPL.T.....
ENSGGOP00000000821  .....DIWA.................LSK.................FT...F...RG.L.........KSL.T.....
ENSGGOP00000021010  .....EIGS.................ISK.................NA...L...RG.L.........RSL.T.....
ENSGGOP00000001364  .....KITS.................VPN.................EA...L...RY.L.........KNL.A.....
ENSGGOP00000020706  .....NLAS.................LEN.................FP...I...GH.L.........KTL.K.....
ENSGGOP00000021036  .....NLAS.................LEN.................FP...I...GH.L.........KTL.K.....
ENSGGOP00000020993  .....LIEV.................VTP.................TA...F...SE.C.........PSL.I.....
ENSGGOP00000002485  .....QIDT.................LSG.................F-...S...RE.M.........KSL.Q.....
ENSGGOP00000027543  .....RIGC.................LNA.................NI...F...RG.L.........TNL.A.....
ENSGGOP00000019774  .....NLRY.................IEP.................GA...F...IN.L.........PRL.K.....
ENSGGOP00000010786  .....GILQ.................IGW.................SD...F...HN.C.........LQL.E.....
ENSGGOP00000024131  .....QIDT.................LSG.................F-...S...RE.M.........KSL.Q.....
ENSGGOP00000002218  .....VIKR.................IES.................GA...F...RN.L.........SKL.R.....
ENSGGOP00000008273  .....NLRY.................IEP.................GA...F...IN.L.........PRL.K.....
ENSGGOP00000015431  .....YQKR.................VSFahlsla...........PS...F...GS.L.........VAL.K.....
ENSGGOP00000008661  .....SLTD.................LPG.................--...C...GS.F.........SSL.S.....
ENSGGOP00000027149  .....RLYR.................LDDms...............SI...V...QK.A.........PNL.K.....
ENSGGOP00000013614  .....QITF.................VRD.................--...V...DN.L.........PCL.Q.....
ENSGGOP00000001884  .....RLYR.................LDDms...............SI...V...QK.A.........PNL.K.....
ENSGGOP00000017691  .....RLYR.................LDDms...............SI...V...QK.A.........PNL.K.....
ENSGGOP00000017973  .....QLEM.................LQP.................ET...F...GD.L.........LRL.E.....
ENSGGOP00000000481  .....RISK.................IDS.................--...L...DA.L.........VKL.Q.....
ENSGGOP00000025013  .....RISK.................IDS.................--...L...DA.L.........VKL.Q.....
ENSGGOP00000019011  .....KITS.................VPN.................EA...L...RY.L.........KNL.A.....
ENSGGOP00000012497  .....RLGRkg...............IKQ.................EA...F...KD.M.........YDL.H.....
ENSGGOP00000017205  .....RLTSng...............LPV.................E-...L...KQ.L.........KNI.R.....
ENSGGOP00000004288  .....RLTSng...............LPV.................E-...L...KQ.L.........KNI.R.....
ENSGGOP00000012465  .....KIDA.................LPE.................LA...L...QF.L.........FSL.T.....
ENSGGOP00000000942  .....EIEH.................IPV.................WL...G...KK.L.........KSL.R.....
ENSGGOP00000012474  .....RLSA.................VPA.................EA...A...RF.L.........ENL.T.....
ENSGGOP00000000462  .....QVGS.................VDP.................QK...M...KM.M.........ENL.T.....
ENSGGOP00000022001  .....IITS.................LRM.................AP...A...YL.P.........RSL.A.....
ENSGGOP00000025605  .....IITS.................LRM.................AP...A...YL.P.........RSL.A.....
ENSGGOP00000005450  .....RISC.................IEE.................GA...F...RA.L.........RGL.E.....
ENSGGOP00000000638  .....QLIQ.................LPR.................S-...I...GN.L.........TQL.Q.....
ENSGGOP00000017288  .....HLLS.................LHK.................FT...F...AN.T.........TSL.R.....
ENSGGOP00000008256  .....NLTY.................IDP.................DA...L...KE.L.........PLL.K.....
ENSGGOP00000015431  .....CYYKnpcrqale.........VAP.................GA...L...LG.L.........GNL.T.....
ENSGGOP00000000795  .....NIEK.................IEN.................--...L...EG.C.........EEL.A.....
ENSGGOP00000007172  .....QLVQ.................IQP.................AH...F...SQ.C.........SNL.K.....
ENSGGOP00000027628  .....HIDD.................LSG.................--...L...IP.Lhgik.....HKL.R.....
ENSGGOP00000002833  .....FISS.................FPW.................SD...L...RN.L.........SAL.Q.....
ENSGGOP00000017434  .....KLYH.................LDGls...............DI...I...EK.A.........PKV.K.....
ENSGGOP00000010817  .....KIKA.................LPV.................Q-...F...CQ.L.........QEL.K.....
ENSGGOP00000011344  .....RIFG.................GLD.................ML...A...EK.L.........PNL.T.....
ENSGGOP00000020930  .....RIFG.................GLD.................ML...A...EK.L.........PNL.T.....
ENSGGOP00000015568  .....RLQSsg...............IQP.................AA...F...RA.M.........EKL.Q.....
ENSGGOP00000015042  .....RVSG.................GLE.................VL...A...EK.C.........PNL.T.....
ENSGGOP00000018300  .....NLTY.................IDP.................DA...L...KE.L.........PLL.K.....
ENSGGOP00000026851  .....QISS.................LQG.................--...L...EN.H.........DLL.E.....
ENSGGOP00000026693  .....RVSG.................GLE.................VL...A...EK.C.........PNL.T.....
ENSGGOP00000015068  .....NISD.................LSP.................--...L...CL.L.........EQL.E.....
ENSGGOP00000004548  .....HLEA.................LPP.................E-...I...GG.C.........VAL.S.....
ENSGGOP00000006033  .....QISE.................LAP.................DA...F...QG.L.........RSL.N.....
ENSGGOP00000027647  .....QISS.................LQG.................--...L...EN.H.........DLL.E.....
ENSGGOP00000027539  .....GLSDav...............LKD.................GY...F...RN.L.........KAL.T.....
ENSGGOP00000012360  .....QIRQ.................VEN.................--...L...LD.L.........PCL.Q.....
ENSGGOP00000006033  .....QISC.................IED.................GA...F...RA.L.........RDL.E.....
ENSGGOP00000028049  .....QISC.................IED.................GA...F...RA.L.........RDL.E.....
ENSGGOP00000027098  .....KLQQ.................LPA.................D-...F...GR.L.........VNL.Q.....
ENSGGOP00000011109  .....LIDH.................IAE.................GT...F...VQ.L.........HKL.V.....
ENSGGOP00000005584  .....SIST.................LEP.................--...V...SR.C.........QRL.S.....
ENSGGOP00000019188  .....GISS.................LHFpdagig...........CK...T...SM.F.........PSL.K.....
ENSGGOP00000015022  .....HLEY.................LPV.................S-...L...GS.M.........PNL.E.....
ENSGGOP00000021155  .....RICR.................IGE.................GL...D...QA.L.........PCL.T.....
ENSGGOP00000006065  .....KIKSrg...............IKA.................NA...F...KK.L.........NNL.T.....
ENSGGOP00000008763  .....GIEF.................IDE.................HA...F...KG.Va........ETL.Q.....
ENSGGOP00000008108  .....ALAH.................LSG.................AA...F...QG.Le........GTL.R.....
ENSGGOP00000013299  .....GISS.................LHFpdagig...........CK...T...SM.F.........PSL.K.....
ENSGGOP00000006171  .....KLQQ.................LPA.................D-...F...GR.L.........VNL.Q.....
ENSGGOP00000023255  .....SIST.................LEP.................--...V...SR.C.........QRL.S.....
ENSGGOP00000025379  .....RIWE.................IGA.................DT...F...SQ.L.........SSL.Q.....
ENSGGOP00000010879  .....RLTG.................LEP.................--...L...AT.C.........ENL.Q.....
ENSGGOP00000008240  .....AIEA.................IGP.................AT...F...AG.La........GGL.R.....
ENSGGOP00000004098  .....CISC.................IEN.................--...L...RS.L.........KKL.E.....
ENSGGOP00000017344  .....KIST.................IER.................GA...F...QD.L.........KEL.E.....
ENSGGOP00000018814  .....HLNA.................IEEpdd..............SL...A...RL.F.........PNL.R.....
ENSGGOP00000025873  .....HLNA.................IEEpdd..............SL...A...RL.F.........PNL.R.....
ENSGGOP00000004959  .....AIFE.................IEG.................--...L...HY.L.........PSL.H.....
ENSGGOP00000024368  .....RIFG.................GLD.................VL...A...EK.L.........PNL.T.....
ENSGGOP00000011594  .....IISG.................GLE.................VL...A...EK.C.........PNL.T.....
ENSGGOP00000014157  .....GLTS.................LPPnlavaeqeasvtsltskRY...I...LR.F.........PAL.E.....
ENSGGOP00000013487  .....GLRF.................VAP.................DA...F...HF.T.........PRL.S.....
ENSGGOP00000022399  .....QIKS.................LPN.................TK...F...WNgL.........KNL.K.....
ENSGGOP00000016688  .....KLLG.................PLE.................SLyvtA...NH.W.........PNL.I.....
ENSGGOP00000023599  .....QFQD.................FPE.................Q-...L...TS.L.........PAL.E.....
ENSGGOP00000013768  .....QFQD.................FPE.................Q-...L...TS.L.........PAL.E.....
ENSGGOP00000012563  .....KIQS.................IER.................HT...F...EP.L.........PFL.Q.....
ENSGGOP00000008281  .....LITS.................LKG.................--...I...QY.L.........CSL.Q.....
ENSGGOP00000021469  .....RIFG.................GLN.................MF...A...EK.L.........PNL.T.....
ENSGGOP00000006875  .....LLRA.................LDV.................GL...L...AN.L.........SAL.A.....
ENSGGOP00000017558  .....NITY.................IHP.................ST...F...EG.F.........VHL.E.....
ENSGGOP00000007076  .....GIQE.................FPE.................N-...I...KN.C.........KVL.T.....
ENSGGOP00000008661  .....QLQK.................ISC.................--...-...HP.I.........VSF.R.....
ENSGGOP00000002527  .....QLGD.................DLV.................--...L...PG.L.........PRL.H.....
ENSGGOP00000025482  .....GGLE.................VL-.................--...A...EK.C.........PNL.T.....
ENSGGOP00000028761  .....RIKA.................LPS.................G-...F...GA.H.........KHL.K.....
ENSGGOP00000010362  .....SLVS.................LEG.................--...I...QY.L.........TAL.E.....
ENSGGOP00000000179  .....IISG.................GLE.................VL...A...EK.C.........PNL.T.....
ENSGGOP00000024608  .....KIQS.................IER.................HT...F...EP.L.........PFL.Q.....
ENSGGOP00000025066  .....KLRS.................LPA.................E-...L...GN.M.........VSLsR.....
ENSGGOP00000023515  .....SLKNsg...............VPD.................D-...I...FK.L.........DDL.S.....
ENSGGOP00000003028  .....NLTT.................LHG.................E-...L...SS.L.........PSL.R.....
ENSGGOP00000023998  .....GLRS.................IQP.................RA...F...AK.N.........PHL.R.....
ENSGGOP00000009979  .....GLRS.................IQP.................RA...F...AK.N.........PHL.R.....
ENSGGOP00000024063  .....DLTT.................LPA.................S-...I...AN.L.........INL.R.....
ENSGGOP00000025398  .....HLET.................LPD.................--...N...LG.L.........SHL.R.....
ENSGGOP00000008650  .....QLRE.................LTL.................SG...-...--.-.........FSL.R.....
ENSGGOP00000025808  .....KEVG.................LPH.................--...L...PR.T.........SSI.Q.....
ENSGGOP00000003989  .....KLES.................AT-.................--...-...--.-.........---.-.....
ENSGGOP00000010116  .....GLEQ.................VPK.................G-...-...-L.P.........AKL.R.....
ENSGGOP00000012588  .....----.................---.................--...-...--.-.........---.R.....
ENSGGOP00000013959  .....GLKF.................VAH.................KA...F...LK.N.........SNL.Q.....
ENSGGOP00000024093  .....KIRY.................IER.................HT...F...ES.L.........PFL.Q.....
ENSGGOP00000015656  .....K---.................---.................--...-...--.-.........---.-.....
ENSGGOP00000027053  .....KIQP.................IER.................RT...F...EP.L.........PFL.Q.....
ENSGGOP00000026787  .....----.................---.................--...-...--.-.........---.T.....
ENSGGOP00000013969  .....ELTA.................VPS.................L-...G...AA.S.........SHV.V.....
ENSGGOP00000018989  .....ALSR.................LPP.................A-...A...LR.L.........ARL.E.....
ENSGGOP00000017510  svgleVLST.................IEP.................--...L...KK.L.........ENL.E.....
ENSGGOP00000028171  .....KV--.................---.................--...-...--.-.........---.-.....
ENSGGOP00000003513  .....HIES.................IMP.................R-...L...KP.Q.........THL.T.....
ENSGGOP00000026797  .....GLRE.................LPV.................TF...F...AH.L.........QKL.E.....
ENSGGOP00000016519  .....GLRE.................LPV.................TF...F...AH.L.........QKL.E.....
ENSGGOP00000025973  .....DL--.................---.................--...-...--.-.........---.-.....
ENSGGOP00000003012  .....DLQS.................YEP.................KS...L...KS.I.........QNV.S.....
ENSGGOP00000028210  .....PLTT.................VED.................PY...L...FE.L.........PAL.K.....
ENSGGOP00000025364  .....----.................---.................--...-...--.-.........---.-.....
ENSGGOP00000007122  .....SLSR.................IPS.................D-...-...--.I.........AKL.H.....


                                 100                      110                                       
                                   |                        |                                       
d1a9na_               ...ELILTNN.SLVELGD.............L..DPLASLK...............S.....LTY............L
ENSGGOP00000002818  ...TLWLDNN.RIRYLPD.............-..-SIVELT...............G.....LEE............L
ENSGGOP00000026867  ...ELSLRNN.ALSALSG.............-..DIFAASP...............A.....LYR............L
ENSGGOP00000014553  ...ELFLDSN.NISELPP.............-..QVFSQLF...............C.....LER............L
ENSGGOP00000006261  ...RLHLNSN.LLRAIDS.............-..RWFEMLP...............N.....LEI............L
ENSGGOP00000007172  ...VLILSRN.QISFISP.............-..GAFNGLT...............E.....LRE............L
ENSGGOP00000005919  ...TLYLFAN.NLSALPT.............-..EALAPLR...............A.....LQY............L
ENSGGOP00000024063  ...YLDVSKN.NIEMVEE.............-..-GISTCE...............N.....LQD............L
ENSGGOP00000013969  ...VLRLSHN.SISHIAE.............-..GAFKGLR...............S.....LRV............L
ENSGGOP00000007076  ...YLDVSKN.NIEMVEE.............-..-GISTCE...............N.....LQD............L
ENSGGOP00000015022  ...ELRLYQT.DLKEIPV.............-..VICKNLH...............H.....LEL............L
ENSGGOP00000010210  ...ILTLNNN.NISRILV.............-..TSFNHMP...............K.....IRT............L
ENSGGOP00000025646  ...RLHLNSN.KLKVIDS.............-..RWFDSTP...............N.....LEI............L
ENSGGOP00000008275  ...TLYLRFN.RITTVEK.............-..-DIKNLS...............K.....LSM............L
ENSGGOP00000004396  ...KLEVGDN.HLVFVAP.............-..GAFAGLA...............K.....LST............L
ENSGGOP00000027814  ...ILYLFNN.SLASLPG.............-..EALADLP...............S.....LEF............L
ENSGGOP00000009302  ...ILYLFNN.SLASLPG.............-..EALADLP...............S.....LEF............L
ENSGGOP00000010181  ...SLEVGDN.DLVYISH.............-..RAFSGLN...............S.....LEQ............L
ENSGGOP00000000462  ...DLDLSNN.HLTTVPA.............-..-SFSSLS...............S.....LVR............L
ENSGGOP00000012823  ...SLEVGDN.DLVYISH.............-..RAFSGLL...............S.....LEQ............L
ENSGGOP00000008393  ...ILHLRSN.SLKTVPI.............-..RVFQDCR...............N.....LDF............L
ENSGGOP00000017408  ...CLDVSEN.RLEELPA.............-..-ELGGLV...............L.....LTD............L
ENSGGOP00000003137  ...ELNLSHN.NLMSLPH.............-..DLFTPLH...............R.....LER............V
ENSGGOP00000019249  ...ELNLSHN.NLMSLPH.............-..DLFTPLH...............R.....LER............V
ENSGGOP00000013132  ...TLNLAHN.ALVYLPA.............-..MAFQGLL...............R.....VRW............L
ENSGGOP00000024818  ...TLNLAHN.ALVYLPA.............-..MAFQGLL...............R.....VRW............L
ENSGGOP00000023908  ...TLHLRSN.SLRTIPV.............-..RLFWDCR...............S.....LEF............L
ENSGGOP00000024673  ...CLYLGSN.NLTKVPS.............-..NAFEVLK...............S.....LRR............L
ENSGGOP00000026305  ...ELNLAHN.NLSSLPH.............-..DLFTPLR...............Y.....LVE............L
ENSGGOP00000009400  ...ELNLAHN.NLSSLPH.............-..DLFTPLR...............Y.....LVE............L
ENSGGOP00000007056  ...KLYISKN.HLVEIPP.............-..---NLPS...............S.....LVE............L
ENSGGOP00000005706  ...HLWLDDN.ALTEIPV.............-..RALNNLP...............A.....LQA............M
ENSGGOP00000023515  ...KLYLNSN.KLDFDGL.............P..SGIGKLT...............N.....LEE............F
ENSGGOP00000003028  ...KLYLNSN.KLDFDGL.............P..SGIGKLT...............N.....LEE............F
ENSGGOP00000002850  ...HLWLDDN.ALTEIPV.............-..QAFRSLS...............A.....LQA............M
ENSGGOP00000006625  ...EINLAHN.NLTLLPH.............-..DLFTPLH...............H.....LER............I
ENSGGOP00000005450  ...LLSLYDN.QITTVSP.............-..GAFDTLQ...............S.....LST............L
ENSGGOP00000019824  ...ELDLSYN.QLTRLDE.............-..SAFVGLS...............L.....LER............L
ENSGGOP00000001938  ...RLYLSHN.QLSEIPL.............-..---NLPK...............S.....LAE............L
ENSGGOP00000006377  ...WLYLSEN.ALSSLQP.............-..GALDDVE...............N.....LAK............F
ENSGGOP00000028264  ...RLYLSHN.QLSEIPL.............-..---NLPK...............S.....LAE............L
ENSGGOP00000021709  ...RLHLNSN.RLQMINS.............-..KWFDALP...............N.....LEI............L
ENSGGOP00000025918  ...SLHLRSN.SLRTIPV.............-..RIFQDCR...............N.....LEL............L
ENSGGOP00000008365  ...LLYLDRN.SIAFVED.............-..GTFQNLS...............G.....LLA............L
ENSGGOP00000006124  ...WLDLSHN.RVAGLLE.............-..DTFPGLL...............G.....LRV............L
ENSGGOP00000015799  ...TLDLKNN.EISWTIEdm...........N..GAFSGLD...............K.....LRR............L
ENSGGOP00000010984  ...VLNLEYN.QLTIFPK.............-..-ALCFLP...............K.....LIS............L
ENSGGOP00000012493  ...EFWMNDN.LLESWSD.............L..DELKGAR...............S.....LET............V
ENSGGOP00000018354  ...ELQFHRN.HIRSIAP.............-..GAFDRLP...............N.....LSY............L
ENSGGOP00000001578  ...TLHMRAN.AIQFVPV.............-..RIFQDCR...............S.....LKF............L
ENSGGOP00000004548  ...CLDVSEN.RLEELPA.............-..-ELGGLV...............L.....LTD............L
ENSGGOP00000013132  ...SLYLQKN.QLRALPA.............-..--LPSLS...............Q.....LEL............I
ENSGGOP00000024818  ...SLYLQKN.QLRALPA.............-..--LPSLS...............Q.....LEL............I
ENSGGOP00000025004  ...HLWLDDN.SLTEVPV.............-..HPLSNLP...............T.....LQA............L
ENSGGOP00000025833  ...HLWLDDN.SLTEVPV.............-..HPLSNLP...............T.....LQA............L
ENSGGOP00000016600  ...ALHLGNN.VLQSLPS.............-..-RVGELT...............N.....LTQ............I
ENSGGOP00000006124  ...RLFLKGN.SLVGIEE.............-..QSLWGLA...............E.....LLE............L
ENSGGOP00000005521  ...ELYLQNN.YLTDEGLd............N..ETFWKLS...............S.....LEY............L
ENSGGOP00000001854  ...RLDISNN.QLRMLTQ.............-..GVFDNLS...............N.....LKQ............L
ENSGGOP00000019138  ...ELKLQDN.ELRALPP.............-..---LRLP...............H.....LLL............L
ENSGGOP00000021712  ...CLDVSYN.NISMIPI.............-..-EIGLLQ...............N.....LQH............L
ENSGGOP00000015564  ...LLDLQHN.RLSDGVFk............P..DTFQGLK...............N.....LMQ............L
ENSGGOP00000012531  ...-------.-------.............-..--LVSLS...............F.....LKN............L
ENSGGOP00000020501  ...ELYLQNN.YLTDEGLd............N..ETFWKLS...............S.....LEY............L
ENSGGOP00000003727  ...ELHLDGN.KISRVDA.............-..ASLKGLN...............N.....LAK............L
ENSGGOP00000025379  ...TLDLNYN.ELQEFPV.............-..-AIRTLG...............R.....LQE............L
ENSGGOP00000025364  ...RLDMSNN.NLSNLPQ.............-..GIFDDLD...............N.....ITQ............L
ENSGGOP00000011582  ...ALYLQHN.EIQEVGS.............-..-SMRGLR...............S.....LIL............L
ENSGGOP00000023288  ...VLTLHGN.DISSVPE.............-..GSFNDLT...............S.....LSH............L
ENSGGOP00000010210  ...VLTLHGN.DISSVPE.............-..GSFNDLT...............S.....LSH............L
ENSGGOP00000019616  ...TLDLNYN.NLGEFPQ.............-..-AIKALP...............S.....LKE............L
ENSGGOP00000026995  ...RLSFSHN.KIEVLPS.............-..-HLFLCN...............K.....IRY............L
ENSGGOP00000003265  ...CLDVSEN.RLERLPE.............-..-EISGLT...............S.....LTD............L
ENSGGOP00000024614  ...RLHLEGN.KLQVLGK.............-..DLLLPQP...............D.....LRY............L
ENSGGOP00000025637  ...TLEVEGN.QLRDRDI.............P..LAFQPLC...............S.....LLY............L
ENSGGOP00000014142  ...DLDLSYN.NLRQVPW.............-..AGIGAMP...............A.....LHT............L
ENSGGOP00000013300  ...TLELEGN.NLSEANVn............P..LAFKPLK...............S.....LAY............L
ENSGGOP00000022805  ...HLALSYN.ALEALPE.............-..-ELFFCR...............K.....LRT............L
ENSGGOP00000025292  ...TLELEGN.NLSEANVn............P..LAFKPLK...............S.....LAY............L
ENSGGOP00000025973  ...RLDLSNN.NLTTLPR.............-..GLFDDLG...............N.....LAQ............L
ENSGGOP00000002611  ...FLSMVNN.YLEALPK.............-..QMCAQMP...............Q.....LNW............V
ENSGGOP00000015422  ...ELNLSAN.ALKTVDH.............S..WFGPLAS...............A.....LRI............L
ENSGGOP00000015431  ...ELNLSAN.ALKTVDH.............S..WFGPLAS...............A.....LRI............L
ENSGGOP00000000213  ...ELYLKGN.ELKTLPP.............-..GLLTPTP...............K.....LEK............L
ENSGGOP00000025405  ...ELYLKGN.ELKTLPP.............-..GLLTPTP...............K.....LEK............L
ENSGGOP00000022526  ...YLRLSHN.ELADSGI.............P..GNSFNVS...............S.....LVE............L
ENSGGOP00000014753  ...DLLLSSN.MLQQLPD.............-..-SIGLLK...............K.....LTT............L
ENSGGOP00000020501  ...ELYLTSN.RLRSRALg............P..RAWVDLA...............H.....LQL............L
ENSGGOP00000003295  ...QFNLSYN.QLSFVPE.............-..NLTDVVE...............K.....LEQ............L
ENSGGOP00000022737  ...DLDLSYN.NLRQVPW.............-..AGIGAMP...............A.....LHT............L
ENSGGOP00000007465  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000016887  ...ELDLSYN.NLETIPW.............-..DAVEKMV...............S.....LHT............L
ENSGGOP00000018050  ...ELDLSYN.NLETIPW.............-..DAVEKMV...............S.....LHT............L
ENSGGOP00000023473  ...ELDLSYN.NLETIPW.............-..DAVEKMV...............S.....LHT............L
ENSGGOP00000010984  ...KLNFSSN.QFIHFPV.............-..-ELCQLQ...............S.....LEQ............L
ENSGGOP00000024701  ...VLFLPRN.QIGFVPE.............-..KTFSSLK...............N.....LGE............L
ENSGGOP00000027247  ...IIDLGLN.NLNTLPA.............-..SVFNNQV...............S.....LKS............L
ENSGGOP00000020624  ...NLILKNN.QIRSLTK.............-..YFLQDAF...............Q.....LRY............L
ENSGGOP00000009427  ...LLDLQNN.KLVDNAFq............R..DTFKGLK...............N.....LMQ............L
ENSGGOP00000006033  ...LLSLHGN.DISVVPE.............-..GAFNDLS...............A.....LSH............L
ENSGGOP00000028049  ...LLSLHGN.DISVVPE.............-..GAFNDLS...............A.....LSH............L
ENSGGOP00000022833  ...CLDVSYN.NISMIPI.............-..-EIGLLQ...............N.....LQH............L
ENSGGOP00000008475  ...---LSHN.LIHRLVP.............HptRAGLPVP...............T.....IQS............L
ENSGGOP00000001704  ...QLDLHSN.VLMDIED.............-..GAFEGLP...............R.....LTH............L
ENSGGOP00000002826  fikFLYLSDN.FLTSLPQ.............-..EMVSYMP...............D.....LDS............L
ENSGGOP00000008650  ...ELNLSGN.KLKTIPT.............-..-TIANCK...............R.....LHT............L
ENSGGOP00000013968  ...LLILKQQ.GITSLQF.............-..------Q...............S.....LKE............I
ENSGGOP00000007909  ...LLDLAFT.RLHINAP.............Q..SPFQNLH...............F.....LQV............L
ENSGGOP00000003513  ...KLFLGYN.KIQDITE.............L..EKLDVIS...............T.....LRE............L
ENSGGOP00000016854  ...FLNASAN.KLESLPPa............T..LSEETNS...............I.....LQE............L
ENSGGOP00000022025  ...TLLLSHN.RISHLPS.............-..GFLSEVS...............S.....LKH............L
ENSGGOP00000012021  ...TLLLSHN.RISHLPS.............-..GFLSEVS...............S.....LKH............L
ENSGGOP00000027247  ...TLDLSHN.GLSSTKL.............-..GTQVQLE...............N.....LQE............L
ENSGGOP00000012881  ...VLVMRKN.KINHLNE.............-..NTFAPLQ...............K.....LDE............L
ENSGGOP00000013469  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000014079  ...ELNLSDNnNLEELPN.............-..DVFHGAS...............G.....PVI............L
ENSGGOP00000021874  ...VLVMRKN.KINHLNE.............-..NTFAPLQ...............K.....LDE............L
ENSGGOP00000020681  ...LLDLSRN.QLGTISR.............-..EALQPLA...............S.....LQV............L
ENSGGOP00000013987  ...LLDLSRN.QLGTISR.............-..EALQPLA...............S.....LQV............L
ENSGGOP00000024070  ...SLGISFN.NFSQIPE.............-..-VYEKLT...............M.....LDR............V
ENSGGOP00000013477  ...TLDLSYN.QLASLPP.............-..CAGPVLS...............S.....LRA............L
ENSGGOP00000005073  ...FLNASAN.KLESLPPa............T..LSEETNS...............I.....LQE............L
ENSGGOP00000018071  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000007465  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000027332  ...YLLLQHN.QLGSSGLp............A..GALRPLR...............G.....LHT............L
ENSGGOP00000013375  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000023252  ...YLLLQHN.QLGSSGLp............A..GALRPLR...............G.....LHT............L
ENSGGOP00000008663  ...DLDLSYN.NLHGLPW.............-..DSVRRMV...............N.....LHQ............L
ENSGGOP00000027539  ...YIDLQKN.HIGIIQD.............-..QTFKFLE...............K.....LQT............L
ENSGGOP00000008275  ...HLGLGEN.LLTHLPE.............-..-EIGTLE...............N.....LEE............L
ENSGGOP00000012531  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000009848  ...KLDVSHN.CLSDLKSa............I..KWFEACY...............S.....LRE............L
ENSGGOP00000005706  ...ALDLSWN.AIRSIHP.............-..EAFSTLR...............S.....LVK............L
ENSGGOP00000004424  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000004424  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000003450  ...LLHLEGN.LLHQLHPstfstft......F..LDYFRLS...............T.....IRH............L
ENSGGOP00000005521  ...ELYLTSN.RLRSRALg............P..RAWVDLA...............H.....LQL............L
ENSGGOP00000024070  ...ELNLSGN.KLKTIPT.............-..-TIANCK...............R.....LHT............L
ENSGGOP00000004344  ...FVDISAN.KFSSVPI.............-..-CVLRMS...............N.....LQW............L
ENSGGOP00000024903  ...VLDLTYN.NLSENSL.............P..GNFFYLT...............T.....LRA............L
ENSGGOP00000007876  ...SFNLSSN.QLLGVPP.............-..GLFANAR...............N.....ITA............L
ENSGGOP00000002850  ...SLNLAWN.KIAIIHP.............-..NAFSTLP...............S.....LIK............L
ENSGGOP00000001704  ...TLLLQGN.ALRDLPP.............-..YTFANLA...............S.....LQR............L
ENSGGOP00000024790  ...ELYLKGN.ELKTLPP.............-..GLLTPTP...............K.....LEK............L
ENSGGOP00000012480  ...RLFLHNN.RITHLVP.............-..GTFNHLE...............S.....MKR............L
ENSGGOP00000004216  ...SLHLEDN.ALKVLHN.............-..GTLAELQ...............G.....LPH............I
ENSGGOP00000026324  ...SLHLEDN.ALKVLHN.............-..GTLAELQ...............G.....LPH............I
ENSGGOP00000022546  ...YLDLSFN.DFDTMPI.............C..EEAGNMS...............H.....LEI............L
ENSGGOP00000006438  ...YLVLCDN.KIQSVPP.............-..-QLSQLH...............S.....LRS............L
ENSGGOP00000009953  ...LLNLNNN.HLTQLPQ.............-..-EVSRLK...............S.....LTY............M
ENSGGOP00000001696  ...ELDLSNN.SLQNFDY.............-..GVLEDLY...............F.....LKL............L
ENSGGOP00000027978  ...VLSLSHN.CLSQLPA.............-..-CFADLS...............R.....LRK............L
ENSGGOP00000023252  ...ELYLQHN.QLTDSGLd............A..TTFSKLH...............S.....LEY............L
ENSGGOP00000023288  ...LLSLYDN.KLQTISK.............-..GLFAPLQ...............S.....IQT............L
ENSGGOP00000000058  ...KLTASKN.CLEKLFEeen..........A..TNWIGLR...............K.....LQE............L
ENSGGOP00000022509  ...VLELNDN.NLRSLSV.............-..AALAALP...............A.....LRS............L
ENSGGOP00000027332  ...ELYLQHN.QLTDSGLd............A..TTFSKLH...............S.....LEY............L
ENSGGOP00000012870  ...HLDLSFN.AFDALPI.............C..KEFGNMS...............Q.....LKF............L
ENSGGOP00000010388  ...SLSLRSN.RLQNLDR.............-..LTFEPLA...............N.....LQL............L
ENSGGOP00000028222  ...SLRINNN.RLRTLAP.............-..GTFDALS...............A.....LSH............L
ENSGGOP00000010955  ...SLQLNHN.RLHTLAE.............-..GTFTPLT...............A.....LSH............L
ENSGGOP00000028499  ...SLQLNHN.RLHTLAE.............-..GTFTPLT...............A.....LSH............L
ENSGGOP00000009373  ...TLSLSGN.QLGALPP.............-..-QLCSLR...............H.....LDV............M
ENSGGOP00000015422  ...ELDMHGI.FFRSLDEtt...........L..RPLARLP...............M.....LQT............L
ENSGGOP00000026779  ...TLHAGSN.ALRLLPG.............-..-QLRRLQ...............E.....LRT............I
ENSGGOP00000011147  ...EVDLSRN.RLAHMPD.............-..-VFTPLK...............Q.....LIL............L
ENSGGOP00000013381  ...QLDVSSN.ELQSLPS.............-..-ELCGLS...............S.....LRD............L
ENSGGOP00000001892  ...ELDISCN.EIQVLPQ.............-..-QMGKLH...............S.....LRE............L
ENSGGOP00000023288  ...ILTLNNN.NISRILV.............-..TSFNHMP...............K.....IRT............L
ENSGGOP00000020624  ...VLRLHSN.SLQHVPP.............-..RWFKNIN...............K.....LQE............L
ENSGGOP00000021650  ...VLDLTYN.NLSENSL.............P..GNFFYLT...............T.....LRA............L
ENSGGOP00000018071  ...-------.-------.............-..-ALVSLS...............F.....FRK............L
ENSGGOP00000013375  ...-------.-------.............-..-ALVSLS...............F.....FRK............L
ENSGGOP00000007909  ...SLYLGSN.HISSIKF.............-..PKDFPAR...............N.....LKV............L
ENSGGOP00000020706  ...VLDYSLN.HIMTSKK.............Q..ELQHFPS...............S.....LAF............L
ENSGGOP00000021036  ...VLDYSLN.HIMTSKK.............Q..ELQHFPS...............S.....LAF............L
ENSGGOP00000025923  ...RLNLRNN.KFMYLPV.............S..GVLDQLQ...............S.....LTQ............I
ENSGGOP00000001368  ...ILAVQQN.QLQQLDR.............-..ALLESMP...............S.....VRL............L
ENSGGOP00000020939  ...TLDISTN.RLLTLPE.............-..-RLHMCL...............S.....LQY............L
ENSGGOP00000023533  ...TLDISTN.RLLTLPE.............-..-RLHMCL...............S.....LQY............L
ENSGGOP00000003534  ...VLELNDN.NLRSLSV.............-..AALAALP...............A.....LRS............L
ENSGGOP00000013469  ...-------.-------.............-..-------...............-.....---............L
ENSGGOP00000015192  ...TLDLSNN.QLSEIPA.............-..-ELADCP...............K.....LKE............I
ENSGGOP00000026520  ...TLDLSNN.QLSEIPA.............-..-ELADCP...............K.....LKE............I
ENSGGOP00000008114  ...DLDLSYG.GLAFLSL.............-..EALEGLP...............G.....LVT............L
ENSGGOP00000026663  ...RLNLSGN.LFSSLSQ.............-..GTFDYLA...............S.....LRS............L
ENSGGOP00000003265  ...ILKVDQN.RLTQLPE.............-..-AVGDCE...............S.....LTE............L
ENSGGOP00000005450  ...LLSLYDN.KIQSLAK.............-..GTFTSLR...............A.....IQT............L
ENSGGOP00000002218  ...RLNLRKN.YFLYLPV.............A..GVLEHLN...............A.....IVQ............I
ENSGGOP00000004826  ...SLSLQDN.ELAALAP.............-..GLLGRLP...............A.....LDA............L
ENSGGOP00000026086  ...FLDVSYN.RIPSMPMh............H..INLVPGK...............Q.....LRG............I
ENSGGOP00000022939  ...HLSLANN.HIKALPR.............-..DVFSDLD...............S.....LIE............L
ENSGGOP00000012492  ...ELDVSCN.EIQTIPS.............-..-QIGNLE...............A.....LRD............L
ENSGGOP00000024274  ...LLDLSSN.KLKNLPL.............-..PDLQKLP...............A.....WIKng..........L
ENSGGOP00000023118  ...RLNLRSN.HFTSLPV.............S..GVLDQLK...............S.....LIQ............I
ENSGGOP00000007876  ...ELDLQRN.YIFEIEG.............-..GAFDGLT...............E.....LRH............L
ENSGGOP00000010514  ...ELNLASN.RLQSLPA.............-..-SLVGLR...............S.....LRL............L
ENSGGOP00000023229  ...VLNLRNN.KISALDL.............-..KALEGLP...............H.....LRH............L
ENSGGOP00000028543  ...TLGLDHN.LLASVPA.............-..GAFSRLH...............K.....LAR............L
ENSGGOP00000016064  ...HLDLRGN.RLKVMPF.............A..GVLEHIG...............G.....IME............I
ENSGGOP00000016064  ...RLNLRNN.HFSHLPV.............K..GVLDQLP...............A.....FIQ............I
ENSGGOP00000022050  ...TLGLDHN.LLASVPA.............-..GAFSRLH...............K.....LAR............L
ENSGGOP00000007162  ...YLDLRNT.GLQTLDS.............-..AALYHLT...............T.....LET............L
ENSGGOP00000023394  ...KLSLHNN.YFMYLPV.............A..GVLDQLT...............S.....IIQ............I
ENSGGOP00000016854  ...YLGLSFN.EFTDIPE.............-..-VLEKLT...............A.....VDK............L
ENSGGOP00000027736  ...KVNLKTN.QFTHLPV.............S..NILDDLD...............L.....LTQ............I
ENSGGOP00000005073  ...YLGLSFN.EFTDIPE.............-..-VLEKLT...............A.....VDK............L
ENSGGOP00000025004  ...ILDLSRN.LIHEIHS.............-..RAFATLG...............P.....ITN............L
ENSGGOP00000025833  ...ILDLSRN.LIHEIHS.............-..RAFATLG...............P.....ITN............L
ENSGGOP00000002210  ...HLSLANN.NLQTLPK.............-..DIFKGLD...............S.....LTN............V
ENSGGOP00000010355  ...HLYLGCN.ELASFSF.............-..DHLHGLSat.............H.....LLT............L
ENSGGOP00000028049  ...FLSLYNN.TLQTIAK.............-..GTFSPLR...............A.....IQT............M
ENSGGOP00000023394  ...HLDLRGN.RLKTLPY.............E..EVLEQIP...............G.....IAE............I
ENSGGOP00000015593  ...ILYMSNN.LVKDWAE.............F..VKLAELP...............C.....LED............L
ENSGGOP00000012568  ...RLNISGN.IFSSLQP.............-..GVFDELP...............A.....LKV............V
ENSGGOP00000023118  ...HLDLRGN.RLKLLPY.............V..GLLQHMD...............K.....VVE............L
ENSGGOP00000025923  ...HLDIRGN.RIQKLPY.............I..GVLEHIG...............R.....VVE............L
ENSGGOP00000027736  ...HLDLRGN.QLQTLPY.............V..GFLEHIG...............R.....ILD............L
ENSGGOP00000000821  ...HLSLANN.NLQTLPR.............-..DIFRPLD...............I.....LND............L
ENSGGOP00000021010  ...HLSLANN.HLETLPR.............-..FLFRGLD...............T.....LTH............V
ENSGGOP00000001364  ...YLDLSSN.RLTTLPPdfpeswshlvttpS..GVLDLSP...............S.....RII............L
ENSGGOP00000020706  ...ELNVAHN.LIQSFKL.............P..EYFSNLT...............N.....LEY............L
ENSGGOP00000021036  ...ELNVAHN.LIQSFKL.............P..EYFSNLT...............N.....LEY............L
ENSGGOP00000020993  ...SIDLSSN.RLSRLDG.............-..ATFASLA...............S.....LMV............C
ENSGGOP00000002485  ...YLNLRGN.MVANLGE.............L..AKLRDLP...............K.....LRA............L
ENSGGOP00000027543  ...RLNLSGN.LFSSLSQ.............-..GTFDYLA...............S.....LRS............L
ENSGGOP00000019774  ...YLSICNT.GIRKFPD.............V..TKIFSSE...............S.....NFI............L
ENSGGOP00000010786  ...NLCLKSN.KIFKIHP.............-..QAFKDLK...............K.....LQV............I
ENSGGOP00000024131  ...YLNLRGN.MVANLGE.............L..AKLRDLP...............K.....LRA............L
ENSGGOP00000002218  ...VLILNDN.LIPMLPT.............-..-NLFKAV...............S.....LTH............L
ENSGGOP00000008273  ...YLSICNT.GIRKFPD.............V..TKIFSSE...............S.....NFI............L
ENSGGOP00000015431  ...ELDMHGI.FFRSLDEtt...........L..RPLARLP...............M.....LQT............L
ENSGGOP00000008661  ...VLIIDHN.SVSHPSA.............-..DFFQSCQ...............K.....MRS............I
ENSGGOP00000027149  ...ILNLSGN.ELKSERE.............L..DKIKGL-...............K.....LEE............L
ENSGGOP00000013614  ...HLFLSFN.NISSFDS.............V..SCLADSS...............S.....LSD............I
ENSGGOP00000001884  ...ILNLSGN.ELKSERE.............L..DKIKGL-...............K.....LEE............L
ENSGGOP00000017691  ...ILNLSGN.ELKSERE.............L..DKIKGL-...............K.....LEE............L
ENSGGOP00000017973  ...RLFLHNN.KLSKIPA.............-..GSFSNLD...............S.....LKR............L
ENSGGOP00000000481  ...VLSLGNN.RIDNMMN.............I..IYLRRFK...............C.....LRT............L
ENSGGOP00000025013  ...VLSLGNN.RIDNMMN.............I..IYLRRFK...............C.....LRT............L
ENSGGOP00000019011  ...YLDLSSN.RLTTLPPdfpeswshlvttpS..GVLDLSP...............S.....RII............L
ENSGGOP00000012497  ...HLYLTDN.NLDHIPL.............-..---PLPE...............N.....LRA............L
ENSGGOP00000017205  ...TVNLGLN.HLDSVPT.............-..-TLGALK...............E.....LHE............V
ENSGGOP00000004288  ...TVNLGLN.HLDSVPT.............-..-TLGALK...............E.....LHE............V
ENSGGOP00000012465  ...YLDLSSN.RLTVVSK.............-..SVFLNWPayqkcrqpdcgaeilS.....SLV............V
ENSGGOP00000000942  ...VLNLKGN.KISSLQD.............I..SKLKPLQ...............D.....LIS............L
ENSGGOP00000012474  ...FLDLSSN.QLTRLPQ.............-..ELIVSWA...............H.....LKTgifppghhprlvL
ENSGGOP00000000462  ...TLDLQNN.DLLQIPP.............-..-ELGNCV...............N.....LRT............L
ENSGGOP00000022001  ...ILSLAEN.EIRDLNE.............I..SFLASLT...............E.....LEQ............L
ENSGGOP00000025605  ...ILSLAEN.EIRDLNE.............I..SFLASLT...............E.....LEQ............L
ENSGGOP00000005450  ...VLTLNNN.NITTIPV.............-..SSFNHMP...............K.....LRT............F
ENSGGOP00000000638  ...TLNVKDN.KLKELPD.............-..-TLGELR...............S.....LRT............L
ENSGGOP00000017288  ...YLDLRNT.GLQTLDS.............-..AALYHLT...............T.....LET............L
ENSGGOP00000008256  ...FLGIFNT.GLKMFPD.............L..TKVYSTD...............I.....FFI............L
ENSGGOP00000015431  ...HLSLKYN.NLTVVPR.............-..---NLPS...............S.....LEY............L
ENSGGOP00000000795  ...KLDLTVN.FIGELSS.............I..KTLQHNI...............H.....LKE............L
ENSGGOP00000007172  ...ELQLHGN.HLEYIPD.............-..GAFDHLA...............G.....LTK............L
ENSGGOP00000027628  ...YIDLHSN.RIDSIHHl............L..QCMVGLH...............F.....LTN............L
ENSGGOP00000002833  ...LLKMNHN.RLGSLPR.............-..DALGALP...............D.....LRS............L
ENSGGOP00000017434  ...TLNLSKK.KLKSAWE.............-..LGKVKGL...............K.....LEE............L
ENSGGOP00000010817  ...NLKLDDN.ELIQFPC.............-..-KIGQLI...............N.....LRF............L
ENSGGOP00000011344  ...HLNLSGN.KLKDIST.............L..EPLKKLE...............C.....LKS............L
ENSGGOP00000020930  ...HLNLSGN.KLKDIST.............L..EPLKKLE...............C.....LKS............L
ENSGGOP00000015568  ...FLYLSDN.LLDSIPG.............-..---PLPL...............S.....LRA............V
ENSGGOP00000015042  ...HLNLSGN.KIKDLST.............I..EPLKKLE...............N.....LKS............L
ENSGGOP00000018300  ...FLGIFNT.GLKMFPD.............L..TKVYSTD...............I.....FFI............L
ENSGGOP00000026851  ...VINLEDN.KIAELRE.............I..EYIKNLP...............I.....LRV............L
ENSGGOP00000026693  ...HLNLSGN.KIKDLST.............I..EPLKKLE...............N.....LKS............L
ENSGGOP00000015068  ...VLDLEGN.SVEDLGQ.............V..RYLQLCP...............R.....LVM............L
ENSGGOP00000004548  ...VLSLRDN.RLAVLPP.............-..-ELAHTA...............E.....LHV............L
ENSGGOP00000006033  ...SLSFYGN.KCPEPPKslfeglfslq...L..GTFSPLR...............A.....IQT............M
ENSGGOP00000027647  ...VINLEDN.KIAELRE.............I..EYIKNLP...............I.....LRV............L
ENSGGOP00000027539  ...RLDLSKN.QIRSLYL.............H..PSFGKLN...............S.....LKS............I
ENSGGOP00000012360  ...FLDLSEN.LIETLKL.............-..--DEFPQ...............S.....LLI............L
ENSGGOP00000006033  ...VLTLNNN.NITRLSV.............-..ASFNHMP...............K.....LRT............F
ENSGGOP00000028049  ...VLTLNNN.NITRLSV.............-..ASFNHMP...............K.....LRT............F
ENSGGOP00000027098  ...HLDLLNN.KLVTLPV.............-..-SFAQLK...............N.....LKW............L
ENSGGOP00000011109  ...RLDMTSN.RLHKLPPdglflrs......Q..GTGPKPP...............T.....PLT............V
ENSGGOP00000005584  ...ELYLRRN.RIPNLAE.............L..FYLKGLP...............R.....LRV............L
ENSGGOP00000019188  ...YLVVNDN.QISQWSF.............F..NELEKLP...............S.....LQA............L
ENSGGOP00000015022  ...VLDCRHN.LLKQLPD.............-..-AICQAQ...............A.....LKE............L
ENSGGOP00000021155  ...ELILTNN.SLVELGD.............L..DPLASLK...............S.....LTY............L
ENSGGOP00000006065  ...FLYLDHN.ALESVPL.............-..---NLPE...............S.....LRV............I
ENSGGOP00000008763  ...TLDLSDN.RIQSVHK.............-..NAFNNLK...............A.....RAR............-
ENSGGOP00000008108  ...HLDLSAN.QLASVPV.............-..EAFVGLQ...............-.....-IQ............V
ENSGGOP00000013299  ...YLVVNDN.QISQWSF.............F..NELEKLP...............S.....LQA............L
ENSGGOP00000006171  ...HLDLLNN.KLVTLPV.............-..-SFAQLK...............N.....LKW............L
ENSGGOP00000023255  ...ELYLRRN.RIPNLAE.............L..FYLKGLP...............R.....LRV............L
ENSGGOP00000025379  ...ALDLSWN.AIRSIHP.............-..EAFSTLR...............S.....LVK............L
ENSGGOP00000010879  ...SLNAAGN.LLATPGQ.............L..QCLAGLP...............C.....LEY............L
ENSGGOP00000008240  ...LLDLSYN.RIQRIPK.............-..DALGKLS...............-.....-AK............I
ENSGGOP00000004098  ...KLYLGGN.YIAVIEG.............-..--LEGLG...............E.....LRE............L
ENSGGOP00000017344  ...RLRLNRN.HLQLFPE.............-..LLFLGTA...............K.....LY-............-
ENSGGOP00000018814  ...SISLHKS.GLQSWED.............I..DKLNSFP...............K.....LEE............V
ENSGGOP00000025873  ...SISLHKS.GLQSWED.............I..DKLNSFP...............K.....LEE............V
ENSGGOP00000004959  ...ILLLHHN.ELTNIDAt............V..KELKGML...............N.....LKI............L
ENSGGOP00000024368  ...RLNLSGN.KPKDTST.............L..EPLKKLE...............C.....LKS............L
ENSGGOP00000011594  ...YLNLSGS.KIKDLST.............V..EALQNLK...............N.....LKS............L
ENSGGOP00000014157  ...TLMLDDN.RLSNPSC.............F..ASLAGLR...............R.....LKK............L
ENSGGOP00000013487  ...RLNLSFN.ALESLSW.............-..-KTVQGL...............S.....LQE............L
ENSGGOP00000022399  ...LLYLHDN.GFAKLKN.............I..CVLSACP...............T.....LIA............L
ENSGGOP00000016688  ...SLDLGFN.DLTDLQSm............V..TSLRTLR...............H.....LRL............L
ENSGGOP00000023599  ...TINLEEN.EIVDVPV.............-..EKLAAMP...............A.....LRS............I
ENSGGOP00000013768  ...TINLEEN.EIVDVPV.............-..EKLAAMP...............A.....LRS............I
ENSGGOP00000012563  ...FINLGCN.LLTELSFgt...........F..QAWHGMQ...............F.....LHK............L
ENSGGOP00000008281  ...DLNLYYN.NIPSLVE.............V..SRLQPLP...............F.....LKE............L
ENSGGOP00000021469  ...HLNLSGK.NLKDIST.............L..EPLKKLD...............C.....LKS............L
ENSGGOP00000006875  ...ELDISNN.KISTLEE.............-..GIFANLF...............N.....LSE............I
ENSGGOP00000017558  ...ELDLGDN.RQLRTLA.............P..ETFQGLV...............K.....LHA............L
ENSGGOP00000007076  ...IVEASVN.PISKLPD.............-..-GFSQLL...............N.....LTQ............L
ENSGGOP00000008661  ...HLDLSFN.DFKALPI.............C..KEFGNLS...............Q.....LNF............L
ENSGGOP00000002527  ...TLTLNKN.RITDLEN.............LldHLAEVTP...............A.....LEY............L
ENSGGOP00000025482  ...HLNLSGN.KIKDLST.............I..EPLKQLE...............N.....LKS............L
ENSGGOP00000028761  ...TLLLERN.PIKMLPV.............-..-ELGSVT...............T.....LKA............L
ENSGGOP00000010362  ...SLNLYYN.CISSLAE.............V..FRLHALT...............E.....LVD............V
ENSGGOP00000000179  ...YLNLSGN.KIKDLST.............V..EALQNLK...............N.....LKS............L
ENSGGOP00000024608  ...FINLGCN.LLTELSFgt...........F..QAWHGMQ...............F.....LHK............L
ENSGGOP00000025066  ...ELLLNNN.LLRVLPY.............-..-ELGRLF...............Q.....LQT............L
ENSGGOP00000023515  ...VLDLSHN.QLTECPR.............-..-ELENAK...............N.....MLV............L
ENSGGOP00000003028  ...AIVARAN.SLKNSGV.............P..DDIFKLD...............D.....LSV............L
ENSGGOP00000023998  ...YINLSSN.RLTTLSW.............-..-QLFQTL...............S.....LRE............L
ENSGGOP00000009979  ...YINLSSN.RLTTLSW.............-..-QLFQTL...............S.....LRE............L
ENSGGOP00000024063  ...ELDVSKN.GIQEFPE.............-..-NIKNCK...............V.....LTI............V
ENSGGOP00000025398  ...VLRCANN.QLGDVTA.............-..--LCQFP...............K.....LEE............L
ENSGGOP00000008650  ...TLYASSN.RLTSVNV.............-..--YPVPS...............L.....LTS............L
ENSGGOP00000025808  ...ML-----.-------.............-..-------...............-.....---............-
ENSGGOP00000003989  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000010116  ...VLDLSCN.RLNRAPQ.............-..--PDELP...............E.....VDN............L
ENSGGOP00000012588  ...HLLLANN.SLQSVPP.............-..GAFDHLP...............Q.....LQT............L
ENSGGOP00000013959  ...HINFTRN.KLTSLSR.............-..-KHFRHL...............D.....LSE............L
ENSGGOP00000024093  ...YINLGCN.LITELSL.............-..ATFQAWH...............G.....MQ-............-
ENSGGOP00000015656  ...-------.-LYHLDG.............Ls.DIIEKAP...............K.....VKT............L
ENSGGOP00000027053  ...FTNLGCN.LLTELSF.............-..GTFQAWH...............G.....MQF............-
ENSGGOP00000026787  ...ELVLTGN.NLTALPP.............-..GLLDALP...............A.....LRT............A
ENSGGOP00000013969  ...SLFLQHN.KIRS---.............-..-------...............-.....---............-
ENSGGOP00000018989  ...QLDVRLN.ALAGLDP.............-..DELRALE...............RdgglpGPR............L
ENSGGOP00000017510  ...SLDLFNC.EVTNLND.............-..-------...............-.....---............-
ENSGGOP00000028171  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000003513  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000026797  ...VLNVLRN.PLSRVD-.............-..-------...............-.....---............-
ENSGGOP00000016519  ...VLNVLRN.PLSRVD-.............-..-------...............-.....---............-
ENSGGOP00000025973  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000003012  ...HLILHMK.QHLLLLE.............-..IFVDVTS...............S.....VEC............L
ENSGGOP00000028210  ...YLDMGTT.HI-----.............-..-------...............-.....---............-
ENSGGOP00000025364  ...-------.-------.............-..-------...............-.....---............-
ENSGGOP00000007122  ...NLVCRFN.LIHT---.............-..-------...............-.....---............-


                        120                                   130           140       150       160 
                          |                                     |             |         |         | 
d1a9na_               ..CILR......NP.VT............N...KKH......YRL..YVI..YKVPQVRVLDFQKVKLKERQEAEK--
ENSGGOP00000002818  ..VLQG......NQ.IA............V...LPD......---..---..--------------------------
ENSGGOP00000026867  ..DLDG......NG.WT............C...DCR......LRG..LKR..WM------------------------
ENSGGOP00000014553  ..WLQR......NA.IT............H...LPL......SIF..ASL..GNLTFLSLQWNMLRVLPA--------
ENSGGOP00000006261  ..MIGG......NK.VD............A...ILD......MNF..RPL..ANLRSLVLAGMNLREISDY-------
ENSGGOP00000007172  ..SLHT......NA.LQ............D...LDG......NVF..RML..ANLQNISLQNNRLR------------
ENSGGOP00000005919  ..RLND......NP.WV............C...DCR......ARP..LWA..WLQKFRGSSSEVPCSLPQRLA-----
ENSGGOP00000024063  ..LLSS......NS.LQ............Q...LPE......TIG..S-L..KNITTLKIDENQ--------------
ENSGGOP00000013969  ..DLDH......NE.IS............GtieDTS......GAF..SGL..DGLSKLTLFGNKI-------------
ENSGGOP00000007076  ..LLSS......NS.LQ............Q...LPE......TIG..S-L..KNITTLKIDENQ--------------
ENSGGOP00000015022  ..GLTG......NH.LK............C...LPK......EIV..NQT..KLREIYLKRNQ---------------
ENSGGOP00000010210  ..RLHS......NH.LY............C...DCH......LAW..LSD..WLRQRRTVGQFTLCM-----------
ENSGGOP00000025646  ..MIGE......NP.VI............G...ILD......MNF..KPL..ANLRSLVLAGMYLTDIPG--------
ENSGGOP00000008275  ..SIRE......NK.IK............Q...LPA......EIG..ELC..NLI-----------------------
ENSGGOP00000004396  ..TLER......CN.LS............T...VPG......LAL..ARL..PALVAL--------------------
ENSGGOP00000027814  ..RLNA......NP.WA............C...DCR......ARP..LWA..WFQ-----------------------
ENSGGOP00000009302  ..RLNA......NP.WA............C...DCR......ARP..LWA..WFQ-----------------------
ENSGGOP00000010181  ..TLEK......CN.LT............S...IPT......EAL..SHL..HGLIVLRLRHLNINAIR---------
ENSGGOP00000000462  ..NLSS......NE.LK............S...LPA......EIN..R-M..KRLKHLDCNSNLLETIP---------
ENSGGOP00000012823  ..TLEK......CN.LT............A...VPT......EAL..SHL..RSLISLHLKHLNIN------------
ENSGGOP00000008393  ..DLGY......NR.LR............S...LSR......NAF..AGL..LKLKELHLEHNQFSK-----------
ENSGGOP00000017408  ..LLSQ......NL.LR............R...LPD......GIG..Q--..--------------------------
ENSGGOP00000003137  ..HLNH......NP.WH............C...NCD......VLW..LSW..WL------------------------
ENSGGOP00000019249  ..HLNH......NP.WH............C...NCD......VLW..LSW..WL------------------------
ENSGGOP00000013132  ..RLSH......NA.LS............V...LAP......EAL..AGL..PALRRLSLHHNELQALPG--------
ENSGGOP00000024818  ..RLSH......NA.LS............V...LAP......EAL..AGL..PALRRLSLHHNELQALPG--------
ENSGGOP00000023908  ..DLST......NR.LR............S...LAR......NGF..AGL..IKLRELHLEHNQLTKI----------
ENSGGOP00000024673  ..SLSH......NP.IE............A...IQP......FAF..KGL..ANLEYLLLKNSRIR------------
ENSGGOP00000026305  ..HLHH......NP.WN............C...DCD......ILW..LAW..WLREYI--------------------
ENSGGOP00000009400  ..HLHH......NP.WN............C...DCD......ILW..LAW..WLREYI--------------------
ENSGGOP00000007056  ..RIHD......NR.IR............K...VPK......GVF..SGL..RNMNCIEMGGNP--------------
ENSGGOP00000005706  ..TLAL......NR.IS............H...IPD......YAF..QNL..TSLVVLHLHNNRIQHL----------
ENSGGOP00000023515  ..MAAN......NN.LE............L...IPE......S-L..CRC..PKLRKLVLNKNHLVTLPEA-------
ENSGGOP00000003028  ..MAAN......NN.LE............L...IPE......S-L..CRC..PKLRKLVLNKNHLVTLPEA-------
ENSGGOP00000002850  ..TLAL......NK.IH............H...IPD......YAF..GNL..SSLVVLHLHNNRIHSLG---------
ENSGGOP00000006625  ..HLHH......NP.WN............C...NCD......ILW..LSW..WI------------------------
ENSGGOP00000005450  ..NLLA......NP.FN............C...NCQ......LAW..LGG..WLRKRKIVTGNPRCQNPDF-------
ENSGGOP00000019824  ..NLGD......NR.VT............H...IAD......GVF..RFL..SNLQTLDLRNNEISWA----------
ENSGGOP00000001938  ..RIHE......NK.VK............K...IQK......DTF..KGM..NALHVLEMSANP--------------
ENSGGOP00000006377  ..HVDR......NQ.LS............S...YPS......AAL..SKL..RVVEELKLSHNPLKSIPDN-------
ENSGGOP00000028264  ..RIHE......NK.VK............K...IQK......DTF..KGM..NALHVLEMSANP--------------
ENSGGOP00000021709  ..MIGE......NP.II............R...IKD......MNF..KPL..INLRSLVIAGINLTEIPDN-------
ENSGGOP00000025918  ..DLGY......NR.IR............S...LAR......NVF..AGM..IRLKELHLEHNQFSK-----------
ENSGGOP00000008365  ..HLNG......NR.LT............V...LAW......AAF..QPG..FFLGRLFLFRNPWCCD----------
ENSGGOP00000006124  ..RLSH......NA.IA............S...LRP......RTF..KDL..HFLEELQLGHNR--------------
ENSGGOP00000015799  ..ILQG......NR.IR............S...ITK......KAF..TGL..DALEHLDLSDNAIMSLQGNA------
ENSGGOP00000010984  ..DLTG......NL.IS............S...LPK......EIR..---..--------------------------
ENSGGOP00000012493  ..YLER......NP.LQ............K...DPQ......YRR..KVM..LALPSVRQI-----------------
ENSGGOP00000018354  ..TLSR......NH.LA............F...LPS......ALF..LHS..HNLTLLTLFENPLAELPGVL------
ENSGGOP00000001578  ..DIGY......NQ.LK............S...LAR......NSF..AGL..FKLTELHLEHNDLVKV----------
ENSGGOP00000004548  ..LLSQ......NL.LR............R...LPD......GI-..---..--------------------------
ENSGGOP00000013132  ..DLSS......NP.FH............C...DCQ......LLP..LHR..--------------------------
ENSGGOP00000024818  ..DLSS......NP.FH............C...DCQ......LLP..LHR..--------------------------
ENSGGOP00000025004  ..TLAL......NK.IS............S...IPD......FAF..TNL..SSLVVLHLHNNKIKSLSQH-------
ENSGGOP00000025833  ..TLAL......NK.IS............S...IPD......FAF..TNL..SSLVVLHLHNNKIKSLSQH-------
ENSGGOP00000016600  ..ELRG......NR.LE............C...LP-......---..---..--------------------------
ENSGGOP00000006124  ..DLTS......NQ.LT............H...LPH......RLF..QGL..GKLEYLLLSRNRLA------------
ENSGGOP00000005521  ..DLSS......NN.LS............R...VPA......GLP..RSL..VLL-----------------------
ENSGGOP00000001854  ..TARN......NP.WF............C...DCS......IKW..VTE..WLKYIPS-------------------
ENSGGOP00000019138  ..DLSH......NS.LL............A...LEP......GI-..---..--------------------------
ENSGGOP00000021712  ..HITG......NK.VD............I...LPK......QLF..KC-..IKLRTLNLGQNCITSLPE--------
ENSGGOP00000015564  ..NLAH......NI.LR............K...MPP......RVP..TAI..---HQLYLDSNKI-------------
ENSGGOP00000012531  ..RLIL......GE.EQ............L...EGN......YS-..---..--------------------------
ENSGGOP00000020501  ..DLSS......NN.LS............R...VPA......GLP..RSL..VLL-----------------------
ENSGGOP00000003727  ..GLSF......NS.IS............A...VDN......GSL..ANT..PHLRELHLDNNKLTRVPG--------
ENSGGOP00000025379  ..GFHN......NN.IK............A...IPE......KAF..MGN..PLLQTIHFYDNPIQFV----------
ENSGGOP00000025364  ..ILRN......NP.WY............C...GCK......MKW..VRD..WLQSL---------------------
ENSGGOP00000011582  ..DLSY......NH.LR............K...VPD......GLP..S--..-ALEQLYMEHNNVYTVPDS-------
ENSGGOP00000023288  ..ALGT......NP.LH............C...DCS......LRW..---..--------------------------
ENSGGOP00000010210  ..ALGT......NP.LH............C...DCS......LRW..---..--------------------------
ENSGGOP00000019616  ..GFHS......NS.IS............V...IPD......GAF..DGN..PLLRTIHLYDNPLSFVGN--------
ENSGGOP00000026995  ..DLSY......ND.IR............F...IPP......EIG..VLQ..SL------------------------
ENSGGOP00000003265  ..VISQ......NL.LE............T...IPD......---..---..--------------------------
ENSGGOP00000024614  ..FLNG......NK.LA............R...VA-......---..---..--------------------------
ENSGGOP00000025637  ..RLDR......NR.LR............A...IPR......GLP..CSL..Q-------------------------
ENSGGOP00000014142  ..NLDH......NL.ID............A...LPP......GAF..AQL..GQLSRLDLTSNRLATLAP--------
ENSGGOP00000013300  ..RLGK......NK.FR............I...IPQ......GLP..G--..--------------------------
ENSGGOP00000022805  ..LLGD......NQ.LS............Q...LSP......H--..---..--------------------------
ENSGGOP00000025292  ..RLGK......NK.FR............I...IPQ......GLP..G--..--------------------------
ENSGGOP00000025973  ..LLRN......NP.WF............C...GCN......LMW..LRD..WVKARA--------------------
ENSGGOP00000002611  ..DLEG......NR.IK............Y...LTN......STF..LSC..DLLTVLFLPRNQIGFVPEKT------
ENSGGOP00000015422  ..DVSA......NP.LH............C...AC-......---..---..--------------------------
ENSGGOP00000015431  ..DVSA......NP.LH............C...AC-......---..---..--------------------------
ENSGGOP00000000213  ..SLAN......NN.LT............E...LPA......GLL..NGL..ENLDTLLLQENSLYTIPKGF------
ENSGGOP00000025405  ..SLAN......NN.LT............E...LPA......GLL..NGL..ENLDTLLLQENSLYTIPKGF------
ENSGGOP00000022526  ..DLSY......NK.L-............-...---......---..---..--------------------------
ENSGGOP00000014753  ..KVDD......NQ.LT............M...LPN......TI-..---..--------------------------
ENSGGOP00000020501  ..DIAG......NQ.LT............E...IPE......GLP..E--..-SLEYLYLQNNKISAVP---------
ENSGGOP00000003295  ..ILEG......NK.IS............G...ICS......P--..LRL..KELKILNLSKNHISSLSEN-------
ENSGGOP00000022737  ..NLDH......NL.ID............A...LPP......GAF..AQL..GQLSRLDLTSNRLATLAP--------
ENSGGOP00000007465  ..----......--.--............-...---......---..---..----------------A---------
ENSGGOP00000016887  ..SLDH......NM.ID............N...IPK......GTF..SHL..HKMTRLDVTSNKLQKLPP--------
ENSGGOP00000018050  ..SLDH......NM.ID............N...IPK......GTF..SHL..HKMTRLDVTSNKLQKLPP--------
ENSGGOP00000023473  ..SLDH......NM.ID............N...IPK......GTF..SHL..HKMTRLDVTSNKLQKLPP--------
ENSGGOP00000010984  ..NI--......--.--............-...---......---..---..--------------------------
ENSGGOP00000024701  ..DLSS......NM.IT............E...LSP......HLF..KDL..KLLQKLNLSSNPLMYL----------
ENSGGOP00000027247  ..NLQK......NL.IT............S...VEK......---..---..--------------------------
ENSGGOP00000020624  ..DLSS......NK.IQ............M...IQK......TSFpeNVL..NNLKMLLLHHNRFLCTCD--------
ENSGGOP00000009427  ..NMAK......NA.LR............N...MPP......RLP..ANT..---MQL--------------------
ENSGGOP00000006033  ..AIGA......NP.LY............C...DCN......MQW..LSD..W-------------------------
ENSGGOP00000028049  ..AIGA......NP.LY............C...DCN......MQW..LSD..W-------------------------
ENSGGOP00000022833  ..HITG......NK.VD............I...LPK......QLF..KC-..IKLRTLNLGQNCITSLPE--------
ENSGGOP00000008475  ..NLAW......NR.LH............A...VPN......LRD..LPL..RY------------------------
ENSGGOP00000001704  ..NLSR......NS.LT............C...ISD......FSL..---..--------------------------
ENSGGOP00000002826  ..YLHG......NP.WT............C...DCH......LKW..LSD..WIQEKP--------------------
ENSGGOP00000008650  ..VAHS......NN.IS............I...FPE......ILQ..LPQ..I-------------------------
ENSGGOP00000013968  ..SAGN......IY.IT............D...NSN......LCY..YHT..INWTTLF-------------------
ENSGGOP00000007909  ..NLTY......CF.LD............T...SNQ......HLL..AGL..PVLRHLNLKGNHF-------------
ENSGGOP00000003513  ..TVYG......NP.IC............R...KML......HRH..MLI..FRLPNLQMLDGSPVNSD---------
ENSGGOP00000016854  ..YLTN......NS.LT............D...KCV......PLL..TGH..PHLKILHMAYNRLQSFPA--------
ENSGGOP00000022025  ..DLSS......NL.LK............T...INK......---..---..--------------------------
ENSGGOP00000012021  ..DLSS......NL.LK............T...INK......---..---..--------------------------
ENSGGOP00000027247  ..LLSN......NK.IQ............A...LKS......EEL..YIFanSSLKKLELSSNQ--------------
ENSGGOP00000012881  ..DLGS......NK.IE............N...LPP......LIF..KDL..KELSQLNLSYNPIQKIQ---------
ENSGGOP00000013469  ..----......--.--............-...---......---..-V-..--------------------------
ENSGGOP00000014079  ..DISR......TR.IH............S...LPS......YGL..ENL..KKL-----------------------
ENSGGOP00000021874  ..DLGS......NK.IE............N...LPP......LIF..KDL..KELSQLNLSYNPIQKIQ---------
ENSGGOP00000020681  ..RLTE......NP.WR............C...DCA......LHW..LGA..WI------------------------
ENSGGOP00000013987  ..RLTE......NP.WR............C...DCA......LHW..LGA..WI------------------------
ENSGGOP00000024070  ..VMAG......NC.LE............V...LNL......GVL..NRM..NHIKHVDLRMNHLK------------
ENSGGOP00000013477  ..ALAG......NP.LQ............A...LQP......RAF..ACF..PALQLLNLS-----------------
ENSGGOP00000005073  ..YLTN......NS.LT............D...KCV......PLL..TGH..PHLKILHMAYNRLQSFPA--------
ENSGGOP00000018071  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000007465  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000027332  ..HLYG......NG.LD............R...VPP......ALP..RRL..RAL-----------------------
ENSGGOP00000013375  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000023252  ..HLYG......NG.LD............R...VPP......ALP..RRL..RAL-----------------------
ENSGGOP00000008663  ..SLDH......NL.LD............H...IAE......GTF..ADL..QKLARLDLTSNRLQKLPP--------
ENSGGOP00000027539  ..DLRD......NA.LT............T...IH-......---..-FI..PSIPDIFLSGNKLVTLP---------
ENSGGOP00000008275  ..YLND......NP.NL............H...SLP......FEL..ALC..SKLSIMSIE-----------------
ENSGGOP00000012531  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000009848  ..SLTG......NP.LL............Q...ETN......WRD..SLL..KVLPALRILNGNI-------------
ENSGGOP00000005706  ..DLTD......NQ.LT............T...LPL......AGL..GGL..MHL-----------------------
ENSGGOP00000004424  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000004424  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000003450  ..YLAE......NM.VR............T...LPA......SML..RNM..PLLENLYLQGNPWTCDCEM-------
ENSGGOP00000005521  ..DIAG......NQ.LT............E...IPE......GLP..E--..-SLEYLYLQNNKISAVP---------
ENSGGOP00000024070  ..VAHS......NN.IS............I...FPE......ILQ..LPQ..IQFVDLSCNDLTEI------------
ENSGGOP00000004344  ..DISS......NN.LT............D...LPQ......DID..RLE..ELQSFLLYKNK---------------
ENSGGOP00000024903  ..YLSD......ND.FE............I...LPP......DIG..K-L..TKLQILSLRDNDLISLP---------
ENSGGOP00000007876  ..DMSH......NQ.IS............L...CP-......---..---..--------------------------
ENSGGOP00000002850  ..DLSS......NL.LS............S...FPV......TGL..HGL..THLK----------------------
ENSGGOP00000001704  ..NLQG......NR.VS............-...---......---..---..--------------------------
ENSGGOP00000024790  ..SLAN......NN.LT............E...LPA......GLL..NGL..ENLDTLLLQENSLYTIPKG-------
ENSGGOP00000012480  ..RLDS......NT.LH............C...DCE......ILW..LAD..L-------------------------
ENSGGOP00000004216  rvFLDN......NP.WV............C...DCH......MAD..MVT..WLKETE--------------------
ENSGGOP00000026324  rvFLDN......NP.WV............C...DCH......MAD..MVT..WLKETE--------------------
ENSGGOP00000022546  ..GLSG......AK.IQ............K...S--......---..---..--------------------------
ENSGGOP00000006438  ..SLHN......NL.LT............Y...LPR......EIL..NLI..H-LEELSLR-----------------
ENSGGOP00000009953  ..SINY......NQ.LA............S...IPR......ELC..FL-..ENLVELQLNYNQLICIPEK-------
ENSGGOP00000001696  ..WLRD......NP.WR............C...DYN......IHY..LYY..WLK-----------------------
ENSGGOP00000027978  ..NLSN......NF.FA............H...IPM......CVF..SLK..EL------------------------
ENSGGOP00000023252  ..DLSH......NQ.LT............T...VP-......---..---..--------------------------
ENSGGOP00000023288  ..HLAQ......NP.FV............C...DCH......LKW..LAD..YLQDNPIETSGARCSSPRR-------
ENSGGOP00000000058  ..DISD......NK.LT............E...LPA......LFL..HSF..KSLNSLNVSRNNLKVFPD--------
ENSGGOP00000022509  ..RLDG......NP.WL............C...DCD......FAH..LFS..WIQE----------------------
ENSGGOP00000027332  ..DLSH......NQ.LT............T...VP-......---..---..--------------------------
ENSGGOP00000012870  ..GLST......TH.LE............K...SSV......LPI..AHL..NISKVLLVL-----------------
ENSGGOP00000010388  ..QVGD......NP.WE............C...DCN......LRE..FKH..WME-----------------------
ENSGGOP00000028222  ..QLYH......NP.FH............C...GCG......LVW..LQA..WAASTR--------------------
ENSGGOP00000010955  ..QIND......NP.FD............C...TCG......IVW..LKT..WALTTAV-------------------
ENSGGOP00000028499  ..QIND......NP.FD............C...TCG......IVW..LKT..WALTTAV-------------------
ENSGGOP00000009373  ..DLSK......NQ.IR............S...IPD......SV-..---..--------------------------
ENSGGOP00000015422  ..RLQM......NF.IN............Q...AQL......GIF..RAF..PGLRYVDLSDNRI-------------
ENSGGOP00000026779  ..WLSG......NR.LT............D...FPA......VLL..---..--------------------------
ENSGGOP00000011147  ..SLDK......NQ.WS............C...TCD......LHP..LAR..FLRNYIKSS-----------------
ENSGGOP00000013381  ..NVRR......NQ.LN............T...LPE......E--..---..--------------------------
ENSGGOP00000001892  ..NIRR......NN.LH............V...LPD......E--..---..--------------------------
ENSGGOP00000023288  ..RLHS......NH.LY............C...DCH......LAW..LSD..WLRQRRTVGQFTLCM-----------
ENSGGOP00000020624  ..DLSQ......NF.L-............-...---......---..---..--------------------------
ENSGGOP00000021650  ..YLSD......ND.FE............I...LPP......DIG..K-L..TKLQILSLRDNDLISLP---------
ENSGGOP00000018071  ..RLIR......GE.TL............E...IGN......YSF..YAL..DNQNLRQLWD----------------
ENSGGOP00000013375  ..RLIR......GE.TL............E...IGN......YSF..YAL..DNQNLRQLWD----------------
ENSGGOP00000007909  ..DFQN......NA.IH............Y...ISR......EDM..R--..--------------------------
ENSGGOP00000020706  ..NLTQ......ND.FA............C...TCE......HQS..FL-..--------------------------
ENSGGOP00000021036  ..NLTQ......ND.FA............C...TCE......HQS..FL-..--------------------------
ENSGGOP00000025923  ..DLEG......NP.WD............C...TCD......LVA..LKL..WV------------------------
ENSGGOP00000001368  ..FLKD......NL.WK............C...NCH......LLG..LKL..WLEKFVY-------------------
ENSGGOP00000020939  ..TVDR......NR.LW............Y...VPR......HLC..Q-L..--------------------------
ENSGGOP00000023533  ..TVDR......NR.LW............Y...VPR......HLC..Q-L..--------------------------
ENSGGOP00000003534  ..RLDG......NP.WL............C...DCD......FAH..LFS..WIQE----------------------
ENSGGOP00000013469  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000015192  ..NFRG......NK.LR............-...---......---..---..--------------------------
ENSGGOP00000026520  ..NFRG......NK.LR............-...---......---..---..--------------------------
ENSGGOP00000008114  ..QIGG......NP.WV............C...GCT......MEP..LLK..WLR-----------------------
ENSGGOP00000026663  ..EFQT......EY.LL............C...DCN......ILW..MHR..WVKEKNITVRDTRCV-----------
ENSGGOP00000003265  ..VLTE......NQ.LL............T...LPK......SIG..KL-..--------------------------
ENSGGOP00000005450  ..SLFQ......TP.--............-...---......---..---..--------------------------
ENSGGOP00000002218  ..DLNE......NP.WD............C...TCD......LVP..FKQ..WI------------------------
ENSGGOP00000004826  ..HLRG......NP.WG............C...GCA......LRP..LCA..WLRRH---------------------
ENSGGOP00000026086  ..YLHG......NP.FV............C...DCS......LYS..LLV..FWYR----------------------
ENSGGOP00000022939  ..DLRG......NK.FE............C...DCK......AKW..LYL..WLKMTNSTVSDVLCIGP---------
ENSGGOP00000012492  ..NVRR......NH.LV............H...LPE......EL-..---..--------------------------
ENSGGOP00000024274  ..YLHN......NP.LN............C...DCE......LYQ..---..--------------------------
ENSGGOP00000023118  ..DLHD......NP.WD............C...TCD......IVG..MKL..WV------------------------
ENSGGOP00000007876  ..SLAF......NN.LP............C...IVD......FGL..TQL..RVL-----------------------
ENSGGOP00000010514  ..VLHS......NL.LA............S...VPA......DL-..ARL..PLLTRLDLRDNQLRDLPP--------
ENSGGOP00000023229  ..YLDG......NP.WN............C...TCS......LL-..---..--------------------------
ENSGGOP00000028543  ..DMTS......NR.LT............T...IPP......DPL..F--..--------------------------
ENSGGOP00000016064  ..QLEE......NP.WN............C...TCD......LLP..LKA..WLDTITVFVGEIVCE-----------
ENSGGOP00000016064  ..DLQE......NP.WD............C...TCD......IMG..LKD..W-------------------------
ENSGGOP00000022050  ..DMTS......NR.LT............T...IPP......DPL..F--..--------------------------
ENSGGOP00000007162  ..FLSG......NP.WK............C...NCS......FLD..FAI..FLI-----------------------
ENSGGOP00000023394  ..DLHG......NP.WE............C...SCT......IVP..FKQ..WA------------------------
ENSGGOP00000016854  ..CMSG......NC.VE............T...LRL......QAL..RKM..PHIKHVDLRLNVI-------------
ENSGGOP00000027736  ..DLED......NP.WD............C...SCD......LVG..LQQ..WIQ-----------------------
ENSGGOP00000005073  ..CMSG......NC.VE............T...LRL......QAL..RKM..PHIKHVDLRLNVI-------------
ENSGGOP00000025004  ..DVSF......NE.LT............S...FPT......EGL..NGL..NQLK----------------------
ENSGGOP00000025833  ..DVSF......NE.LT............S...FPT......EGL..NGL..NQLK----------------------
ENSGGOP00000002210  ..DLRG......NS.FN............C...DCK......LKW..LVE..WLGHTNATVEDIYC------------
ENSGGOP00000010355  ..DLSS......NR.LG............His.VPE......LAA..LPA..FLKNGLYLHNN---------------
ENSGGOP00000028049  ..HLAQ......NP.FI............C...DCH......LKW..LAD..YLHTNPIETSGARCTSPRRLA-----
ENSGGOP00000023394  ..LLED......NP.WD............C...TCD......LLS..LKE..WL------------------------
ENSGGOP00000015593  ..VFVG......NP.LE............E...KH-......---..---..--------------------------
ENSGGOP00000012568  ..DLGT......EF.LT............C...DCH......LRW..LLP..WAQNRSLQLS----------------
ENSGGOP00000023118  ..QLEE......NP.WN............C...SCE......LIS..LKD..WL------------------------
ENSGGOP00000025923  ..QLED......NP.WN............C...SCD......LLP..LKA..WL------------------------
ENSGGOP00000027736  ..QLED......NK.WA............C...NCD......LLQ..LKT..WL------------------------
ENSGGOP00000000821  ..DLRG......NS.LN............C...DCK......VKW..LVE..WLAHTNTTVAPIYCASPP--------
ENSGGOP00000021010  ..DLRG......NP.FQ............C...DCR......VLW..LLQ..WMPT----------------------
ENSGGOP00000001364  ..GLQD......NP.WF............C...DCH......ISK..---..--------------------------
ENSGGOP00000020706  ..DLSS......NK.IQ............S...IYC......TDL..RVL..HQMPLLNLS-----------------
ENSGGOP00000021036  ..DLSS......NK.IQ............S...IYC......TDL..RVL..HQMPLLNLS-----------------
ENSGGOP00000020993  ..ELAG......NP.FN............C...ECD......LFG..FLA..WLVVFNNVTKNYDRLQ----------
ENSGGOP00000002485  ..VLLD......NP.CT............D...ETS......YRQ..EAL..VQMPYLERLDKEFYEEEE--------
ENSGGOP00000027543  ..EFQT......EY.LL............C...DCN......LLW..MHR..WVKERNITVRDTRCV-----------
ENSGGOP00000019774  ..EICD......NLhIT............T...IPG......NAF..QGM..--------------------------
ENSGGOP00000010786  ..DLSN......NA.VT............T...ILP......MMI..IAL..--------------------------
ENSGGOP00000024131  ..VLLD......NP.CT............D...ETS......YRQ..EAL..VQMPYLERLDKEFYEEEE--------
ENSGGOP00000002218  ..DLRG......NR.LK............V...LF-......---..---..--------------------------
ENSGGOP00000008273  ..EICD......NLhIT............T...IPG......NAF..QGM..--------------------------
ENSGGOP00000015431  ..RLQM......NF.IN............Q...AQL......GIF..RAF..PGLRYVDLSDNRI-------------
ENSGGOP00000008661  ..KAGD......NP.FQ............C...TCE......LRE..FVK..--------------------------
ENSGGOP00000027149  ..WLDG......NS.LC............D...TFR......DQ-..---..--------------------------
ENSGGOP00000013614  ..TFDG......NP.IA............Q...ESW......YKH..TVL..QNMMQLRQLDM---------------
ENSGGOP00000001884  ..WLDG......NS.LC............D...TFR......DQ-..---..--------------------------
ENSGGOP00000017691  ..WLDG......NS.LC............D...TFR......DQ-..---..--------------------------
ENSGGOP00000017973  ..RLDS......NA.LV............C...DCD......LMW..LGE..--------------------------
ENSGGOP00000000481  ..SLSR......NP.IS............E...AED......YKM..FIC..AYLPDLVYLDYRRI------------
ENSGGOP00000025013  ..SLSR......NP.IS............E...AED......YKM..FIC..AYLPDLVYLDYRRI------------
ENSGGOP00000019011  ..GLQD......NP.WF............C...DCH......ISK..---..--------------------------
ENSGGOP00000012497  ..HLQN......NN.IL............E...MHE......DTF..CNV..KNLTYI--------------------
ENSGGOP00000017205  ..GLHD......NL.LN............N...IPV......SMS..K--..--------------------------
ENSGGOP00000004288  ..GLHD......NL.LN............N...IPV......SMS..K--..--------------------------
ENSGGOP00000012465  ..ALHD......NP.WV............C...DCR......LRG..LVQ..F-------------------------
ENSGGOP00000000942  ..ILVE......NP.VV............T...LPH......YLQ..FTI..FHLRSLESLESQPVT-----------
ENSGGOP00000012474  ..GLQD......NP.WA............C...DCR......LYD..LV-..--------------------------
ENSGGOP00000000462  ..LLDG......NP.F-............-...---......---..---..--------------------------
ENSGGOP00000022001  ..SIMN......NP.CV............M...ATPsipgfdYRP..YIV..SWCLNLRFLDGYVISQKE--------
ENSGGOP00000025605  ..SIMN......NP.CV............M...ATPsipgfdYRP..YIV..SWCLNLRFLDGYVISQKE--------
ENSGGOP00000005450  ..RLHS......NH.LF............C...DCH......LAW..LSQ..WLRQR---------------------
ENSGGOP00000000638  ..NISG......NE.IQ............R...LPQ......MLA..HV-..--------------------------
ENSGGOP00000017288  ..FLSG......NP.WK............C...NCS......FLD..FA-..--------------------------
ENSGGOP00000008256  ..EITD......NP.YM............T...SIP......V--..---..--------------------------
ENSGGOP00000015431  ..LLSY......NR.IV............K...LAP......EDL..ANL..TALRVLDVGGNCR-------------
ENSGGOP00000000795  ..FLMG......NP.CA............S...FDH......YRE..FVV..ATLPQLKWLDGKEI------------
ENSGGOP00000007172  ..NLGK......NS.LT............H...I--......---..---..--------------------------
ENSGGOP00000027628  ..ILEKdgdd..NP.VC............Q...LPG......YRA..VIL..QTLPQLRILDCKN-------------
ENSGGOP00000002833  ..RINN......NR.LA............-...---......---..---..--------------------------
ENSGGOP00000017434  ..WLEG......NP.LC............S...TFS......DQS..---..--------------------------
ENSGGOP00000010817  ..SAAR......NK.LP............F...LPS......E--..---..--------------------------
ENSGGOP00000011344  ..DLFN......CE.VT............N...LND......YRE..SVF..KLLPQLTYLDGYD-------------
ENSGGOP00000020930  ..DLFN......CE.VT............N...LND......YRE..SVF..KLLPQLTYLDGYD-------------
ENSGGOP00000015568  ..HLQN......NL.IE............T...MQR......DVF..---..--------------------------
ENSGGOP00000015042  ..DLFN......CE.VT............N...LND......YRE..NVF..KLLPQLTYLDGYD-------------
ENSGGOP00000018300  ..EITD......NP.YM............T...SIP......V--..---..--------------------------
ENSGGOP00000026851  ..NLLK......NP.VQ............E...KSE......YWF..FVI..FMLLRLTELDQ---------------
ENSGGOP00000026693  ..DLFN......CE.VT............N...LND......YRE..NVF..KLLPQLTYLDGYD-------------
ENSGGOP00000015068  ..TLEG......NL.VC............L...QP-......---..---..--------------------------
ENSGGOP00000004548  ..DVAG......NR.LQ............S...LPF......AL-..---..--------------------------
ENSGGOP00000006033  ..HLAQ......NP.FI............C...DCH......LKW..LAD..YLHTNPIETSGARCTSPRRLA-----
ENSGGOP00000027647  ..NLLK......NP.VQ............E...KSE......YWF..FVI..FMLLRLTELDQKK-------------
ENSGGOP00000027539  ..DFSS......NQ.IF............L...VCE......HEL..---..--------------------------
ENSGGOP00000012360  ..NLSG......NS.CT............N...QDG......YRE..LVT..EALPLLLDLDGQPV------------
ENSGGOP00000006033  ..RLHS......NN.LY............C...DCH......LAW..LSD..WLRQR---------------------
ENSGGOP00000028049  ..RLHS......NN.LY............C...DCH......LAW..LSD..WLRQR---------------------
ENSGGOP00000027098  ..DLKD......NP.LD............-...---......---..---..--------------------------
ENSGGOP00000011109  ..SFGG......NP.LH............C...NCE......LLW..LRR..--------------------------
ENSGGOP00000005584  ..WLAE......NP.CC............G...TSPhr....YRM..TVL..RTLPRLQKLDNQAVT-----------
ENSGGOP00000019188  ..ACLR......NP.LT............K...ED-......---..---..--------------------------
ENSGGOP00000015022  ..RLED......NL.LT............H...LPE......NL-..---..--------------------------
ENSGGOP00000021155  ..SILR......NP.VT............N...KKH......YRL..YVI..YKVPQVRVLDFQKV------------
ENSGGOP00000006065  ..HLQF......NN.IA............S...ITD......DTF..C--..--------------------------
ENSGGOP00000008763  ..-IAN......NP.WH............C...DCT......LQQ..VLR..SMASNHETAHNVICK-----------
ENSGGOP00000008108  ..NLSA......NP.WH............C...DCA......LQE..---..--------------------------
ENSGGOP00000013299  ..ACLR......NP.LT............-...---......---..---..--------------------------
ENSGGOP00000006171  ..DLKD......NP.L-............-...---......---..---..--------------------------
ENSGGOP00000023255  ..WLAE......NP.CC............G...TSPhr....YRM..TVL..RTLPRLQKLDNQAVT-----------
ENSGGOP00000025379  ..DLTD......NQ.LT............T...LPL......AGL..GGL..MHL-----------------------
ENSGGOP00000010879  ..RLRDplarlsNP.LC............A...SPS......YWA..AVR..ELLPGLKVMDGER-------------
ENSGGOP00000008240  ..RLSH......NP.LH............C...ECA......LQE..AL-..--------------------------
ENSGGOP00000004098  ..HVEN......QR.LP............L...---......---..---..--------------------------
ENSGGOP00000017344  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000018814  ..RLLG......IP.LL............Q...---......---..---..--------------------------
ENSGGOP00000025873  ..RLLG......IP.LL............Q...---......---..---..--------------------------
ENSGGOP00000004959  ..SLYQ......NP.LC............Q...YNL......YRL..YII..YHLPGVELLDRNQVT-----------
ENSGGOP00000024368  ..DLFN......CE.VT............N...MND......YRE..-VF..KLLPQLTYVDGY--------------
ENSGGOP00000011594  ..DLFN......CE.IT............N...LED......YRE..SIF..ELLQQITYLDGF--------------
ENSGGOP00000014157  ..SLDE......NR.II............R...IPY......LQ-..---..--------------------------
ENSGGOP00000013487  ..VLSG......NP.LH............C...SCA......LRW..LQR..W-------------------------
ENSGGOP00000022399  ..TMFD......CP.VS............L...KKG......YRH..VLV..NSIWPLKALDHHVIS-----------
ENSGGOP00000016688  ..VLQG......NP.LA............L...VPY......YRG..LAI..DSLAQLCVLDDITVS-----------
ENSGGOP00000023599  ..NLRF......NP.L-............-...---......---..---..--------------------------
ENSGGOP00000013768  ..NLRF......NP.L-............-...---......---..---..--------------------------
ENSGGOP00000012563  ..ILNR......NP.LI............T...VED......PYL..FKL..SAFKYLDMG-----------------
ENSGGOP00000008281  ..DLRL......NP.VV............Rk..DTD......YRL..FAV..YTLQTLEKLDDRTV------------
ENSGGOP00000021469  ..DLFN......CE.VI............N...LND......YQE..GVF..KLLPQLTCLDT---------------
ENSGGOP00000006875  ..NLSG......NP.FE............C...DCG......LAW..LPR..WAE-----------------------
ENSGGOP00000017558  ..YLYK......CG.LG............A...LPA......GVF..---..--------------------------
ENSGGOP00000007076  ..YL--......--.--............-...---......---..---..--------------------------
ENSGGOP00000008661  ..GLSA......MK.LQ............K...LDL......LPI..AHL..HLSYILLDLRNYYIKENE--------
ENSGGOP00000002527  ..SLLG......NV.ACpnelvslekdeeD...YKR......YRC..FVL..YKLPNLRFLDAQK-------------
ENSGGOP00000025482  ..DLFN......CE.VT............N...LND......YRE..NVF..KLLLQLTYLDSCY-------------
ENSGGOP00000028761  ..NLRH......CP.LE............F...PP-......---..---..--------------------------
ENSGGOP00000010362  ..DFRL......NP.VV............Kv..EPD......YRL..FVV..HLLPKLQQLDDRPV------------
ENSGGOP00000000179  ..DLFN......CE.IT............N...LED......YRE..SIF..ELLQQITYLDGFD-------------
ENSGGOP00000024608  ..ILNR......NP.LI............T...VED......PYL..FKL..SAFKYLDMG-----------------
ENSGGOP00000025066  ..GLKG......NP.LS............Q...DI-......---..---..--------------------------
ENSGGOP00000023515  ..NLSH......NS.I-............-...---......---..---..--------------------------
ENSGGOP00000003028  ..DLSH......NQ.LT............E...CP-......---..---..--------------------------
ENSGGOP00000023998  ..QLEQ......NF.FN............C...SCD......IRW..MQL..WQEQ----------------------
ENSGGOP00000009979  ..QLEQ......NF.FN............C...SCD......IRW..MQL..WQEQ----------------------
ENSGGOP00000024063  ..EASV......NP.IS............K...LP-......---..---..--------------------------
ENSGGOP00000025398  ..SLEG......NP.FL............T...VND......NL-..---..--------------------------
ENSGGOP00000008650  ..DLSR......NL.LE............C...VPD......WA-..---..--------------------------
ENSGGOP00000025808  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000003989  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000010116  ..TLDG......NP.F-............-...---......---..---..--------------------------
ENSGGOP00000012588  ..DVTQ......NP.WH............C...DCS......LTY..LRL..WL------------------------
ENSGGOP00000013959  ..ILVG......NP.FT............C...SCD......IMW..I--..--------------------------
ENSGGOP00000024093  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000015656  ..NLSK......NK.AI............R...DC-......---..---..--------------------------
ENSGGOP00000027053  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000026787  ..HLGA......NP.WR............C...DCR......LVP..LRA..WLA-----------------------
ENSGGOP00000013969  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000018989  ..LLAD......NP.LR............C...GCA......ARP..LLA..WLRN----------------------
ENSGGOP00000017510  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000028171  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000003513  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000026797  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000016519  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000025973  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000003012  ..ELRD......TD.--............-...---......---..---..--------------------------
ENSGGOP00000028210  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000025364  ..----......--.--............-...---......---..---..--------------------------
ENSGGOP00000007122  ..----......--.--............-...---......---..---..--------------------------


                                                                                                    
                                                                                                    
d1a9na_               -mfk..........................................................................
ENSGGOP00000002818  -hfgqlsrvglwkikdnpliqppyevcmkg................................................
ENSGGOP00000026867  -gdwhsqgrlltvfvqcrhppalrgkyl..................................................
ENSGGOP00000014553  -glfahtpclvglslthnqletvaegafahlsnlrslmlsynaithlpagifrdleelvklylgsnnltalhpalfqn
ENSGGOP00000006261  -aleglqsleslsfydnqlarvprraleqvpglkfldlnknplqrvgpgdfanmlhlkelglnnmeelvsidkfalvn
ENSGGOP00000007172  -qlpgnifanvnglmtiqlqnnqlenlplgifdhlgklcelrlydnpwrcdsdilplrnwlllnqprlgtdtvpvcfs
ENSGGOP00000005919  -grdlkrlaandlq................................................................
ENSGGOP00000024063  -lmylpdsigglisveeldcsfnevealpssigqltnlrtfaadhnylqqlppeigswknitvlflhsnkletlpeem
ENSGGOP00000013969  -ksvakrafsgleglehlnlggnairsvqfdafvkmknlkelhissdsflcdcqlkwlppwligrmlqafvtatcahp
ENSGGOP00000007076  -lmylpdsigglisveeldcsfnevealpssigqltnlrtfaadhnylqqlppeigswknitvlflhsnkletlpeem
ENSGGOP00000015022  -fevfpqelcvlytleiidldenkigaipeeighltglqkfhmasnnlpvlpaslcqcsqlsvldlshnllhsipksl
ENSGGOP00000010210  -apvhlrgfnvadvqkkeyvcpaphseppscnansiscpspctcsnnivdcrgkglmeipanlpegiveirleqnsik
ENSGGOP00000025646  -nalvgldsleslsfydnklvkvpqlalqkvpnlkfldlnknpihkiqegdfknmlrlkelginnmgelvsvdryald
ENSGGOP00000008275  -tldvahnqlehlpkeignctqitnldlqhnelldlpdtignlsslsrlglrynrlsaiprslakcsaleelnlennn
ENSGGOP00000004396  -rlreldigrlpagalqglgqlkeleihlwpslealdpgslvglnlsslaitrcnlssvpfqalyhlsflrvldlsqn
ENSGGOP00000027814  -rarvsssdvtcatpperqgrdlral....................................................
ENSGGOP00000009302  -rarvsssdvtcatpperqgrdlral....................................................
ENSGGOP00000010181  -dysfkrlyrlkvleishwpyldtmtpnclyglnltslsithcnltavpylavrhlvylrflnlsynpistiegsmlh
ENSGGOP00000000462  -pelagmeslellylwrnklrflpefpscsllkelhvgenqiemleaehlkhlnsilvldlrdnklksvpdeiillqs
ENSGGOP00000012823  -smpvyafkrlfhlkhleidywplldmmpanslyglnltslsitntnlstvpflafkhlvylthlnlsynpistieag
ENSGGOP00000008393  -infahfprlfnlrsiylqwnrirsisqgltwtwsslhnldlsgndiqgiepgtfkclpnlqklnldsnkltnisqet
ENSGGOP00000017408  -lkqlsilkvdqnrlcevteaigdcenlseliltenllmalprslgkltkltnlnvdrnhlealppeiggcvalsvls
ENSGGOP00000003137  -ke...........................................................................
ENSGGOP00000019249  -ke...........................................................................
ENSGGOP00000013132  -pvlsqarglarlelghnpltyageedglalpglrellldggalqalgprafahcprlhtldlrgnqldtlpplqgpg
ENSGGOP00000024818  -pvlsqarglarlelghnpltyageedglalpglrellldggalqalgprafahcprlhtldlrgnqldtlpplqgpg
ENSGGOP00000023908  -nfahflrlsslhtlflqwnkisnltcgmewtwgtlekldltgneikaidltvfetmpnlkillmdnnklnsldskil
ENSGGOP00000024673  -nvtrdgfsginnlkhlilshndlenlnsdtfsllknliylkldrnriisidndtfenmgaslkilnlsfnnltdlhp
ENSGGOP00000026305  -ptnstccgrchapmhmrgrylvevdqasfqc..............................................
ENSGGOP00000009400  -ptnstccgrchapmhmrgrylvevdqasfqc..............................................
ENSGGOP00000007056  -lensgfepgafdglklnylriseakltgipkdlpetlnelhldhnkiqaieledllrysklyrlglghnqirmieng
ENSGGOP00000005706  -gthsfeglhnletldlnynelqefpvairtlgrlqelgfhnnnikaipekafmgnpllqtihfydnpiqfvgrsafq
ENSGGOP00000023515  -ihflteievldvrenpnlvmppkpadraaewynidfsl.......................................
ENSGGOP00000003028  -ihflteievldvrenpnlvmppkpadraaewynidfsl.......................................
ENSGGOP00000002850  -kkcfdglhsletldlnynnldefptairtlsnlkelgfhsnnirsipekafvgnpslitihfydnpiqfvgrsafqh
ENSGGOP00000006625  -kd...........................................................................
ENSGGOP00000005450  -lrqiplqdvafpdfrceegqeegsclprpqcpqecacldtvvrcsnkhlralpkgipknvtelyldgnqftlvpgql
ENSGGOP00000019824  -iedaseafagltsltklilntssllcdchlkwllqrlvdnnfqhsvnvscahpewlagqsil...............
ENSGGOP00000001938  -ldnngiepgafegvtvfhiriaeakltsvpkglpptllelhldynkistveledfkrykelqrlglgnnkitdieng
ENSGGOP00000006377  -afqsfgryletlwldntnlekfsdgaflgvttlkhvhlennrlnqlpsnfpfdsletlaltnnpwkctcqlrglrrw
ENSGGOP00000028264  -ldnngiepgafegvtvfhiriaeakltsvpkglpptllelhldynkistveledfkrykelqrlglgnnkitdieng
ENSGGOP00000021709  -alvglenlesisfydnrlikvphvalqkvvnlkfldlnknpinrirrgdfsnmlhlkelginnmpelisidslavdn
ENSGGOP00000025918  -lnlalfprlvslqnlylqwnkisvigqtmswtwsslqrldlsgneieafsgpsvfqcvpnlqrlnldsnkltfigqe
ENSGGOP00000008365  -crlewl.......................................................................
ENSGGOP00000006124  -irqlae.......................................................................
ENSGGOP00000015799  -fsqmkklqqlhlntssllcdcqlkwlpqwvaen............................................
ENSGGOP00000010984  -elknletllmdhnkltflaveifqllkikelqladnklevishkienfrelrilildknllknipekisccamlecl
ENSGGOP00000012493  -d............................................................................
ENSGGOP00000018354  -fgemgglqelwlnrtqlrtlpaaafrnlsrlrslgvtlsprlsalpqgafqglgelqvlalhsngltalpdgllrgl
ENSGGOP00000001578  -nfahfprlislhslclrrnkvaivvssldwvwnlekmdlsgneieymephvfetvphlqslqldsnrltyiepriln
ENSGGOP00000004548  -gqlkqlsilkvdqnrlce...........................................................
ENSGGOP00000013132  -wltgln.......................................................................
ENSGGOP00000024818  -wltgln.......................................................................
ENSGGOP00000025004  -cfdgldnletldlnynnlgefpqaikalpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnls
ENSGGOP00000025833  -cfdgldnletldlnynnlgefpqaikalpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnls
ENSGGOP00000016600  -velgecpllkr..................................................................
ENSGGOP00000006124  -elpadalgplqrafwldvshnrlealpnsllaplgrlrylslrnnslrtftpqppglerlwlegnpwdcgcplkalr
ENSGGOP00000005521  -hleknairsvdadvltpirsleylllhsnqlraqgihplafqglkrlhtvhlynnalervpsglprrvrtlmilhnq
ENSGGOP00000001854  -slnvrgfmcqgpeqvrgmavrelnmnllsc...............................................
ENSGGOP00000019138  -ldtanvealrlaglglqqldeglfsrlrnlhdldvsdnqlervppvirglrgltrlrlagntriaqlrpedlaglaa
ENSGGOP00000021712  -kvgqlsqltqlelkgncldrlpaqlglcrmlkk............................................
ENSGGOP00000015564  -etipngyfksfpnlafirlnynkltdrglpknsfnisnllvlhlshnrissvpainnrlehlylnnnsiekingtqi
ENSGGOP00000012531  -fyvldnqnlqqlwdwdhrnltikagkmyfafnpklcvseiyrmeevtgtkgrqskgdintrnngerascesdv....
ENSGGOP00000020501  -hleknairsvdadvltpirsleylllhsnql..............................................
ENSGGOP00000003727  -glaehkyiqvvylhnnnisvvgssdfcppghntkkasysgvslfsnpvqyweiqpstfrc.................
ENSGGOP00000025379  -grsafqylpklhtlslngatdiqefpdlkgttsleiltltragirllpsgmcqqlprlrvlelshnqieelpslhrc
ENSGGOP00000025364  -pvkvnvrglmcqapekvrgmaikdlnaelfdc.............................................
ENSGGOP00000011582  -yfrgapkllyvrlshnsltnnglasntfnssslleldlsynqlqkippvntnlenlylqgnrinefsissfctvvdv
ENSGGOP00000023288  -l............................................................................
ENSGGOP00000010210  -l............................................................................
ENSGGOP00000019616  -safhnlsdlhslvirgasmvqqfpnltgtvhlesltltgakissipn..............................
ENSGGOP00000026995  -qyfsitcnkveslpdelyfckklktlkigknslsvlspkignllflsyldvkgnhfeilppelgdcralkra.....
ENSGGOP00000003265  -g............................................................................
ENSGGOP00000024614  -agafqglrqldmldlsnnslasvpeglwaslgqpnwdmrdgfdisgnpwicdqnlsdlyrwlqaqkdkmfsqndtrc
ENSGGOP00000025637  -elhlgtnlieevaegalshihslsllvlshnwlqehrlaprawihlpkletldlsynrlvhvpsflprglrrltlhh
ENSGGOP00000014142  -dplfsrgrdaeaspaplvlsfsgnplhcncellwlrrlarpddletcasppglagryfwavpegefsceppli....
ENSGGOP00000013300  -sieelylennqieeiteicfnhtrkinvivlrynkieenriaplawinqenlesidlsynklyhvpsylpksllhlv
ENSGGOP00000022805  -vgalralsrlelkgnrlealpeelgncgglkk.............................................
ENSGGOP00000025292  -sieelylennqieeiteicfnhtrkinvivlrynkieenriaplawinqenlesidlsynklyhvpsylpksllhlv
ENSGGOP00000025973  -avvnvrglmcqgpekvrgmaikdit....................................................
ENSGGOP00000002611  -fsslknlgeldlssnmitelsphlfkdlkllqklnlssnplmylhknqfeslkqlqsldlerieipnintrmfqpmk
ENSGGOP00000015422  -g............................................................................
ENSGGOP00000015431  -g............................................................................
ENSGGOP00000000213  -fgshllpfaflhgnpwlcnceilyfrrwlqdnaenvy........................................
ENSGGOP00000025405  -fgshllpfaflhgnpwlcnceilyfrrwlqdnaenvy........................................
ENSGGOP00000022526  -kniptvnenlenyylevnqlekfdvksfckilgplsyskikhlrldgnrisetslppdmyeclr.............
ENSGGOP00000014753  -gnlslleefdcscneleslpstigylhslrtlavdenflpelpreigscknvtvmslrsnkleflpeeigqmqklrv
ENSGGOP00000020501  -anafnstpnlkgiflrfnklavgsvvdsafrrlkhlqvldiegnlef..............................
ENSGGOP00000003295  -fleacpkvesfsarmnflaampflppsmtilklsqnkfscipeailniphlrsldmssndiqylpgpahwkslnlre
ENSGGOP00000022737  -dplfsgvmqrspaplvlsfsgnplhcncellwlrrlarpddletcasppglagryfwavpegefsceppli......
ENSGGOP00000007465  -wpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslkeisdgdviisgnknlcyantinwkklfgtsgq
ENSGGOP00000016887  -dplfqraqvlatsgiispstfalsfggnplhcncellwlrrlsreddletcaspplltgryfwsipeeeflceppli
ENSGGOP00000018050  -dplfqraqvlatsgiispstfalsfggnplhcncellwlrrlsreddletcaspplltgryfwsipeeeflceppli
ENSGGOP00000023473  -dplfqraqvlatsgiispstfalsfggnplhcncellwlrrlsreddletcaspplltgryfwsipeeeflceppli
ENSGGOP00000010984  -sqikgrknnltalpsaiynlfslkeinfddnpllrp.........................................
ENSGGOP00000024701  -hknqfeslkqlqsldlerieipnintrmfqpmknlshiyfknfrycsyap...........................
ENSGGOP00000027247  -kvfgpafrnlteldmrfnpfdctcesiawfvnwinethtnipelsshylcntpphyhgfp.................
ENSGGOP00000020624  -avwf.........................................................................
ENSGGOP00000009427  -fldnnsiegipenyfnvipkvaflrlnhnklsdeglpsrgfdvssildlqlshnqltkvprisahlqhlhldhnkik
ENSGGOP00000006033  -vk...........................................................................
ENSGGOP00000028049  -vk...........................................................................
ENSGGOP00000022833  -kvgqlsqltqlelkgncldrlpaqlglcrmlk.............................................
ENSGGOP00000008475  -lsldgnplavigpgaftglgglthlslaslqrlpelapngfhelpglqvldlsgnpklnwagaevfsglsslqeldl
ENSGGOP00000001704  -qqlrvldlscnsieafqtasqpqaefqltwldlrenkllhfpdlaalprliylnlsnnlir................
ENSGGOP00000002826  -dvikckkdrspssaqqcplcmnprtskgkplamvsaaafqcakp.................................
ENSGGOP00000008650  -qfvdlscndlteilipealpatlqdldltgnt.............................................
ENSGGOP00000013968  -stinqrivirdnrkaenctaegmvcnhlcssdgcwgpgp......................................
ENSGGOP00000007909  -qdgtitktnllqtvgslevlilsscgllsidqqafhslgkmshvdlshnsltcdsidslshlkgiylnlaansinii
ENSGGOP00000003513  -drak.........................................................................
ENSGGOP00000016854  -skmakleeleeidlsgnklkaipttimncrrmhtviahsncievfpevmqlpeikcvdlscnelsevtlpenlppkl
ENSGGOP00000022025  -saletktttklsmlelhgnpfectcdig.................................................
ENSGGOP00000012021  -saletktttklsmlelhgnpfectcdig.................................................
ENSGGOP00000027247  -ikefspgcfyaigrlfglflnnvqlgpslteklclelantsirnlslsnsqlsttsnttflglkwtnltmldlsynn
ENSGGOP00000012881  -anqfdylvklkslslegieisniqqrmfrplmnlshiyfkkfqycgyaph...........................
ENSGGOP00000013469  -ldnqnlqqlgswvaagltipvgkiyfafnprlclehiyrleevtgtrgrqnkaeinprtngdraacqt.........
ENSGGOP00000014079  -ra...........................................................................
ENSGGOP00000021874  -anqfdylvklkslslegieisniqqrmfrplmnlshiyfkk....................................
ENSGGOP00000020681  -keggqrlltsrdrkimcaepprlalqslldvshsslicippsvhv................................
ENSGGOP00000013987  -keggqrlltsrdrkimcaepprlalqslldvshsslicippsvhv................................
ENSGGOP00000024070  -tmvienlegnkhvthvdlrdnrltdldlsslcsleqlhcgrnqlreltlsgfslrtlyassnrltsvnvypvpsllt
ENSGGOP00000013477  -ctalgrgaqggiaeaafagedgaplvtlevldlsgtflervesgwirdlpkltslylrkmpqlttlegdifkmtpnl
ENSGGOP00000005073  -skmakleeleeidlsgnklkaipttimncrrmhtviahsncievfpevmqlpeikcvdlscnelsevtlpenlppkl
ENSGGOP00000018071  -lfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknnelcylatidwsrildsvednyivlnkdd
ENSGGOP00000007465  -lsnydanktglkelpmrnlqeilhgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngs
ENSGGOP00000027332  -vlphnhvaalgardlvatpgltelnlaynrlasahvhhrafrrlralrsldlagnqltrlpmglptglrtlqlqrnq
ENSGGOP00000013375  -lfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknnelcylatidwsrildsvednyivlnkdd
ENSGGOP00000023252  -vlphnhvaalgardlvatpgltelnlaynrlasahvhhrafrrlralrsldlagnqltrlpmglptglrtlqlqrnq
ENSGGOP00000008663  -dpifarsqasaltatpfapplsfsfggnplhcncellwlrrlerdddletcgspgglkgryfwhvreeefvc.....
ENSGGOP00000027539  -kinltanlihlsenrlenldilyfllrvphlqililnqnrlsscsgdqtpsenpslerlflgenmlqlawetelcwd
ENSGGOP00000008275  -ncplshlpp....................................................................
ENSGGOP00000012531  -femtnlkdiglynlrnitrgairieknadlcylstvdwslildavsnnyivgnkppkecgdlcpgtmee........
ENSGGOP00000009848  -l............................................................................
ENSGGOP00000005706  -klkgnlalsqafskdsfpklrilevpyayqccp............................................
ENSGGOP00000004424  -tlqglgiswlglrslrelgsglalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgeglachqlcarghc
ENSGGOP00000004424  -ivrgtqlfednyalavldngdplnnttpvtgaspgglrelqlrslteilkggvliqrnpelcyqdtilwkdifhknn
ENSGGOP00000003450  -rwflew.......................................................................
ENSGGOP00000005521  -anafnstpnlkgiflrfnklavgsvvdsafrrlkhlqvldiegnlef..............................
ENSGGOP00000024070  -lipealpatlqdldltgntnlvlehktldifshittlkidqk...................................
ENSGGOP00000004344  -ltylpysmlnlkkltllvvsgdhlvelptalcdsstplkfvslmdnpid............................
ENSGGOP00000024903  -keigeltqlkelhiqgnrltvlppelgnldltgqkqvfkaennpwvtpi............................
ENSGGOP00000007876  -lpaasdrvgppscvdfrnmaslrslslegcglgalpdcpfrgtsltyldlssnwgvlngslaplqdvaptlqvlslr
ENSGGOP00000002850  -ltgnhalqslissenfpelkviempyayqccaf............................................
ENSGGOP00000001704  -pcggpdepgpsgcvafsgitslrslslvdneiellragaflhtplteldlssnpglevatgalggleaslevlalqg
ENSGGOP00000024790  -ffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvy.......................................
ENSGGOP00000012480  -lktyaesgnaqaaatceyprriqgrsvatitpeelncerprit..................................
ENSGGOP00000004216  -vvqgkdrltcaypekmrnrvllelnsadldc..............................................
ENSGGOP00000026324  -vvqgkdrltcaypekmrnrvllelnsadldc..............................................
ENSGGOP00000022546  -dfqkiahlhlntvflgfrtlshyeegslpilnttklhivlpmdtnfwvllrdgiktskilemtnidgksqfvsyemq
ENSGGOP00000006438  -gnplvvrfvrdltydpptllelaartikirnisytpydlpgnllrylgsasncpn......................
ENSGGOP00000009953  -ikflkklqklllarnnigvlpeelcdlkklrildiagniiqifpsgfqdlklrefycegnplflqqpvistqqenvw
ENSGGOP00000001696  -hh...........................................................................
ENSGGOP00000027978  -iflhvgsnrleniaesiqhlaslqifiaegnnihsfprslclvtslellnlnnndiqtlpselhllcrlvriawnpm
ENSGGOP00000023252  -a............................................................................
ENSGGOP00000023288  -lankrisqikskkfrc.............................................................
ENSGGOP00000000058  -pwacplkcckasrnaleclpdkmavfwknhlkdvdfsentlkevplglfqldalmflrlqgnqlaalppqekwtcrq
ENSGGOP00000022509  -nasklpkgldeiqcslpmesrrisl....................................................
ENSGGOP00000027332  -a............................................................................
ENSGGOP00000012870  -getygekedpeglqdfnteslhivfptnkefhfildvsvktvanlelsnikcvlednkcsyflsilaklqtnpklss
ENSGGOP00000010388  -wfsyrggrldqlactlpkelrgkdmrmvpmemfny..........................................
ENSGGOP00000028222  -vslpepdsiacasppalqgvpvyrlpalp................................................
ENSGGOP00000010955  -sipeqdniactsphvlkgtplsrlpplpcsap.............................................
ENSGGOP00000028499  -sipeqdniactsphvlkgtplsrlpplpcsap.............................................
ENSGGOP00000009373  -gelqvielnlnqnqisqisvkisccprlkilrleenclelsmlpqsilsdsqicllavegnlf..............
ENSGGOP00000015422  -sgase........................................................................
ENSGGOP00000026779  -hmpflevidvdwnsiryfpslahlsslklviydhnpcrn......................................
ENSGGOP00000011147  -ahtlrnakdlnc.................................................................
ENSGGOP00000013381  -lgdlplvrldfscnrvsripvsfcrlrhlqvilldsnplqspp..................................
ENSGGOP00000001892  -lgdlplvkldfscnkvteipvcyrklhhlqviildnnplqvppaqiclkgkvhifkylniqaccrmdkkpdsldlps
ENSGGOP00000023288  -apvhlrgfnvadvqkkeyvc.........................................................
ENSGGOP00000020624  -akeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvfkelksfnlsplhnlqnlevld
ENSGGOP00000021650  -keigeltqlkelhiqgnrltvlpp.....................................................
ENSGGOP00000018071  -wskhnltitqgklffhynpklclseihkmeevsgtkgrqerndialktngdqascene...................
ENSGGOP00000013375  -wskhnltitqgklffhynpklclseihkmeevsgtkgrqerndialktngdqascene...................
ENSGGOP00000007909  -sleqainlslnfngnnvkgielgafdstvfqslnfggtpnlsvifnglqnsttqslwlgtfediddedissamlkgl
ENSGGOP00000020706  -qwikdqrqllvevermecatpsdkqgmpv................................................
ENSGGOP00000021036  -qwikdqrqllvevermecatpsdkqgmpv................................................
ENSGGOP00000025923  -eklsd........................................................................
ENSGGOP00000001368  -kggitdgiicespdtwkgkdllriph...................................................
ENSGGOP00000020939  -pslnelsmagnrlaflpldlgrsrelqyvyvdnnihlkglp....................................
ENSGGOP00000023533  -pslnelsmagnrlaflpldlgrsrelqyvyvdnnihlkgl.....................................
ENSGGOP00000003534  -nasklpkgldeiqcslpmesrrislrelseasf............................................
ENSGGOP00000013469  -fpnlavirgtrlflgyalvifemphlrdvalpalgavlrgavrveknqelchlstidwgllqpapganhivgnklge
ENSGGOP00000015192  -dkrlek.......................................................................
ENSGGOP00000026520  -dkrlek.......................................................................
ENSGGOP00000008114  -nr...........................................................................
ENSGGOP00000026663  -ypks.........................................................................
ENSGGOP00000003265  -kklsnlnadrnklvslpkeiggccsltvfcvrdnrltripaevsqatelhvldvagnrllhlplsltalklkalwls
ENSGGOP00000005450  -.............................................................................
ENSGGOP00000002218  -etissvsvvgdvlcrspenlthrdvrtielevlc...........................................
ENSGGOP00000004826  -plpaseaetvlc.................................................................
ENSGGOP00000026086  -rhfssvmdfkndytcrlwsdsrhsrqv..................................................
ENSGGOP00000022939  -peyq.........................................................................
ENSGGOP00000012492  -aelplirldfscnkittipvcyrnlrhlqtitldnnplqsppaqicikgkvhifkylniqackiapdlpdydrrplg
ENSGGOP00000024274  -lfshwqyrqlssvmdfqedlycmnskklhnv..............................................
ENSGGOP00000023118  -eqlkmgvlvdevickapkkfa........................................................
ENSGGOP00000007876  -nvsynvlewflaaggeaafeletldlshnqllffpllpqrsklrtlllrdnnm........................
ENSGGOP00000010514  -elldapfvrlqgnplge............................................................
ENSGGOP00000023229  -kare.........................................................................
ENSGGOP00000028543  -srlpllarprgspasalvlafggnplhcncelvwlrrlareddleacasppalggryfwavge..............
ENSGGOP00000016064  -tpfrlhgkdvtqltrqdlc..........................................................
ENSGGOP00000016064  -tehanspviinevtcespakhag......................................................
ENSGGOP00000022050  -srlpllarprgspasalvlafggnplhcncelvwlrrlareddleacasppalggryfwavge..............
ENSGGOP00000007162  -vfhmdpsddlnatcvepteltgwpi....................................................
ENSGGOP00000023394  -erlgsevlmsdlkcetpvnffrkdfmllsnde.............................................
ENSGGOP00000016854  -rkliadevdflqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkgly..................
ENSGGOP00000027736  -klskntvtddilctsprhldkk.......................................................
ENSGGOP00000005073  -rkliadevdflqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkgly..................
ENSGGOP00000025004  -lvgnlklkealaakdfvnlrslsvpyayqccafwgcdsyanlnt.................................
ENSGGOP00000025833  -lvgnlklkealaakdfvnlrslsvpyayqccafwgcdsyanlnt.................................
ENSGGOP00000002210  -egppeyk......................................................................
ENSGGOP00000010355  -plpcdcrlyhllqrwhqrg..........................................................
ENSGGOP00000028049  -nkrigqikskkfrc...............................................................
ENSGGOP00000023394  -enipknaligrvvceaptrlqgkdlnetteqdlc...........................................
ENSGGOP00000015593  -saennwieeatkrvpklkkldgtpvik..................................................
ENSGGOP00000012568  -ertlcayps....................................................................
ENSGGOP00000023118  -dsisysalvgdvvcetpfrlhgrdldevskqelc...........................................
ENSGGOP00000025923  -enmpyniyigeaicetpsdlygrllketnkqelcp..........................................
ENSGGOP00000027736  -enmppqsiigdvvcnsppffkgsilsrlkkesic...........................................
ENSGGOP00000000821  -rf...........................................................................
ENSGGOP00000021010  -vnasvgtgacagpa...............................................................
ENSGGOP00000001364  -mielskvvdpaivlldplmtcseperltgilfqraelehclkpsvm...............................
ENSGGOP00000020706  -ldlslnpmtfiqpgafkeirlhkltlrnnfdslnvmktciqglagl...............................
ENSGGOP00000021036  -ldlslnpmtfiqpgafkeirlhkltlrnnfdslnvmktciqglagl...............................
ENSGGOP00000020993  -cesprefagypll................................................................
ENSGGOP00000002485  -r............................................................................
ENSGGOP00000027543  -ypks.........................................................................
ENSGGOP00000019774  -nnesvtlklygngfeevqshafngttltslelkenvhlekmhngafrgatgpktldisstklqalpsyglesiqrl.
ENSGGOP00000010786  -efphlvvdladnnwqcddsvavfq.....................................................
ENSGGOP00000024131  -r............................................................................
ENSGGOP00000002218  -yrgmldhigrslmelqleenpwnctceivqlkswleripytalvgditcetpfhfhgkdlreirktel.........
ENSGGOP00000008273  -nnesvtlklygngfeevqshafngttltslelkenvhlekmhngafrgatgpktldisstklqalpsyglesiqrl.
ENSGGOP00000015431  -sg...........................................................................
ENSGGOP00000008661  -nidqvssevvegwldsykcdypesyrgtllkdfhmselscn....................................
ENSGGOP00000027149  -styisairerfpkllrldghelppp....................................................
ENSGGOP00000013614  -kr...........................................................................
ENSGGOP00000001884  -styisairerfpkllrldghelppp....................................................
ENSGGOP00000017691  -styisairerfpkllrldghelppp....................................................
ENSGGOP00000017973  -llqgfaqhghtqaaatceypmrlhgravasvtaeefncqspritf................................
ENSGGOP00000000481  -ddh..........................................................................
ENSGGOP00000025013  -ddh..........................................................................
ENSGGOP00000019011  -mielskvvdpaivlldplmtcseperltgilfqraelehclkpsvm...............................
ENSGGOP00000012497  -rkaledirldgnpinlsktpqaymclprl................................................
ENSGGOP00000017205  -lpklkklnikrnpfpkpsesemfidsirrlenlyv..........................................
ENSGGOP00000004288  -lpklkklnikrnpfpkpsesemfidsirrlenlyv..........................................
ENSGGOP00000012465  -vksitlpvilvnsylicqgplskagqlfhetelsacmkp......................................
ENSGGOP00000000942  -tq...........................................................................
ENSGGOP00000012474  -hlldgwapnlafietelrcasprslagvafsqlelrkc.......................................
ENSGGOP00000000462  -r............................................................................
ENSGGOP00000022001  -slk..........................................................................
ENSGGOP00000025605  -slk..........................................................................
ENSGGOP00000005450  -ptiglftqcsgpa................................................................
ENSGGOP00000000638  -rtlemlsldas..................................................................
ENSGGOP00000017288  -ifl..........................................................................
ENSGGOP00000008256  -nafqglcnetltlklynngftsvqgyafngtkldavylnknkyltvidkdafggvysgpsfldvsqtsvtalpskgl
ENSGGOP00000015431  -rc...........................................................................
ENSGGOP00000000795  -eps..........................................................................
ENSGGOP00000007172  -s............................................................................
ENSGGOP00000027628  -ifge.........................................................................
ENSGGOP00000002833  -ge...........................................................................
ENSGGOP00000017434  -ayvsiireyfpkllrldgqela.......................................................
ENSGGOP00000010817  -frnlsleyldlfgnifeqpkvlpviklqapltlle..........................................
ENSGGOP00000011344  -redq.........................................................................
ENSGGOP00000020930  -redq.........................................................................
ENSGGOP00000015568  -cdpeehkhtrrqledirldgnpinlslfpsayfclp.........................................
ENSGGOP00000015042  -rddk.........................................................................
ENSGGOP00000018300  -nafqglcnetltlklynngftsvqgyafngtkldavflgkikhltvidkdafggvysgpsfldvsqtsvtalpskgl
ENSGGOP00000026851  -kk...........................................................................
ENSGGOP00000026693  -rddk.........................................................................
ENSGGOP00000015068  -apgptnkvprgynyraevrklipqlqvldevp.............................................
ENSGGOP00000004548  -thlnlkalwlaenqa..............................................................
ENSGGOP00000006033  -nkrigqikskkfrc...............................................................
ENSGGOP00000027647  -ikv..........................................................................
ENSGGOP00000027539  -eplqgktlsffslaanslysrvsvdwgkcmnpfrnmvleildvsgngwtvditgnfsna..................
ENSGGOP00000012360  -ve...........................................................................
ENSGGOP00000006033  -prvglytqcmgpsh...............................................................
ENSGGOP00000028049  -prvglytqcmgpsh...............................................................
ENSGGOP00000027098  -pvl..........................................................................
ENSGGOP00000011109  -ltreddletcatpehltdryfwsipeeeflcepplit........................................
ENSGGOP00000005584  -ee...........................................................................
ENSGGOP00000019188  -keaetarlliiasigqlktl.........................................................
ENSGGOP00000015022  -dslvnlkvltlmdnpmeeppkevcae...................................................
ENSGGOP00000021155  -kl...........................................................................
ENSGGOP00000006065  -kandtsyirdrieeirlegnp........................................................
ENSGGOP00000008763  -ts...........................................................................
ENSGGOP00000008108  -vlrqvrlvp....................................................................
ENSGGOP00000013299  -.............................................................................
ENSGGOP00000006171  -d............................................................................
ENSGGOP00000023255  -ee...........................................................................
ENSGGOP00000025379  -klkgnlalsqafskdsfpklrilevpya.................................................
ENSGGOP00000010879  -vig..........................................................................
ENSGGOP00000008240  -welkldpdsvdeiachtsv..........................................................
ENSGGOP00000004098  -gekllfdprtlhslakslcilnisnnniddirdleilenlnqliavdnqllhvkdlefllnklmklwkidlngnpvc
ENSGGOP00000017344  -rl...........................................................................
ENSGGOP00000018814  -pytteerrklviarlpsvsklngs.....................................................
ENSGGOP00000025873  -pytteerrklviarlpsvsklngs.....................................................
ENSGGOP00000004959  -ek...........................................................................
ENSGGOP00000024368  -dqed.........................................................................
ENSGGOP00000011594  -dqedn........................................................................
ENSGGOP00000014157  -qvqlydesvdwnggrgsphkepqfmlqskprmledsdeqldytvlpmkkdvdrtevvfssypgfstsettkicslpp
ENSGGOP00000013487  -eeeglggvpeqklqchgqgpl........................................................
ENSGGOP00000022399  -de...........................................................................
ENSGGOP00000016688  -pn...........................................................................
ENSGGOP00000023599  -n............................................................................
ENSGGOP00000013768  -n............................................................................
ENSGGOP00000012563  -ttqvplttienilvmtveleklilpsh..................................................
ENSGGOP00000008281  -re...........................................................................
ENSGGOP00000021469  -ydp..........................................................................
ENSGGOP00000006875  -eqqvrvvqpeaatcagp............................................................
ENSGGOP00000017558  -grarslw......................................................................
ENSGGOP00000007076  -n............................................................................
ENSGGOP00000008661  -teslqilnaktlhlvfhptslfavqvnisvntlgclqltniklnddncqvfikflseltrgptllnftlnhiettwk
ENSGGOP00000002527  -vtrq.........................................................................
ENSGGOP00000025482  -wdh..........................................................................
ENSGGOP00000028761  -qlvv.........................................................................
ENSGGOP00000010362  -res..........................................................................
ENSGGOP00000000179  -qedn.........................................................................
ENSGGOP00000024608  -ttqvplttienilvmtveleklilpshmtcclcqfkn........................................
ENSGGOP00000025066  -lnlyqdpdgtrkllnfmldnlavhpeqlpprpwit..........................................
ENSGGOP00000023515  -.............................................................................
ENSGGOP00000003028  -r............................................................................
ENSGGOP00000023998  -geaklnsqnlyci................................................................
ENSGGOP00000009979  -geaklnsqnlyci................................................................
ENSGGOP00000024063  -.............................................................................
ENSGGOP00000025398  -kvsfllptlrkvn................................................................
ENSGGOP00000008650  -ceakkievldvsynlltevpvrilsslslrklmlghnh.......................................
ENSGGOP00000025808  -vpwteksplcatlncqslhsiairdcfpkllrldgqelspp....................................
ENSGGOP00000003989  -qdfcldg......................................................................
ENSGGOP00000010116  -lvp..........................................................................
ENSGGOP00000012588  -edrtpeallqvrca...............................................................
ENSGGOP00000013959  -ktlqeak......................................................................
ENSGGOP00000024093  -fl...........................................................................
ENSGGOP00000015656  -fpkllrldgq...................................................................
ENSGGOP00000027053  -l............................................................................
ENSGGOP00000026787  -grperapyrdlrcvapp............................................................
ENSGGOP00000013969  -v............................................................................
ENSGGOP00000018989  -atervpdsrrlrcaapralldrplldldgarlrca..........................................
ENSGGOP00000017510  -.............................................................................
ENSGGOP00000028171  -msagemdkwkgiepgekcadrspvcttfsdtssnrnsilelfpkllcldgqq.........................
ENSGGOP00000003513  -s............................................................................
ENSGGOP00000026797  -g............................................................................
ENSGGOP00000016519  -g............................................................................
ENSGGOP00000025973  -de...........................................................................
ENSGGOP00000003012  -ld...........................................................................
ENSGGOP00000028210  -t............................................................................
ENSGGOP00000025364  -s............................................................................
ENSGGOP00000007122  -symtpktkllscglldklkfs........................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  ..............................................................................
ENSGGOP00000026867  ..............................................................................
ENSGGOP00000014553  lsklellslsknqlttlpdgifdtnynlfnlalhgnpwqcdchlaylfnwlqqytdrllniqty..............
ENSGGOP00000006261  lpeltklditnnprlsfihprafhhlpqmetlmlnnnalsalhqqtveslpnlqevglhgnpircdcvirwana....
ENSGGOP00000007172  pasvrgqsl.....................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  gdmqklkvinlsdnrlknlpfsftklqqltamwlsdnqsk......................................
ENSGGOP00000013969  eslkgqsi......................................................................
ENSGGOP00000007076  gdmqklkvinlsdnrlknlpfsftklqqltamwlsdnqsk......................................
ENSGGOP00000015022  aelrkmteiglsgnrlekvprlicrwtslhllylgntglhrlpgsfrclinlrfldlsqnhldhcplqicalknlevl
ENSGGOP00000010210  aipagaftqykklkridisknqisdiapdafqglksltslvlygnkiteiakglfdglvslqllllnankinclrvnt
ENSGGOP00000025646  nlpeltkleatnnpklsyihrlafrsvpaleslmlnnnalnaiyqktveslpnlreisihsnplrcdcvihwinsnkt
ENSGGOP00000008275  istlpesllsslvklnsltlarncfqlypvggpsqfstiyslnmehnrinkipfgifsrakvlsklnmkdnqltslp.
ENSGGOP00000004396  pisaiparrlsplvrlqelrlsgacltsiaahafhgltafhlldvadnalqtleetafpspdklvtlrlsgnpltcdc
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ellrlqeiqlvggqlavvepyafrglnylrvlnvsgnqlttleesvfhsvgnletlildsnplacdcrllw.......
ENSGGOP00000000462  lerldlsnndisslpyslgnlhlkflalegnplrtirr........................................
ENSGGOP00000012823  mfsdlirlqelhivgaqlrtiephsfqglrflrvlnvsqnlletleenvfsspralevlsinnnplacdcrllw....
ENSGGOP00000008393  vnawislisitlsgnmwecsrsicplfywlknf.............................................
ENSGGOP00000017408  lrdnrlavlppelahtaelhvldvagnrlqslpfalthlnlkalwlae..............................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  qlrrlrlqgnplwcgcqarpllewlarar.................................................
ENSGGOP00000024818  qlrrlrlqgnplwcgcqarpllewlarar.................................................
ENSGGOP00000023908  nslrslttvglsgnlwecsaricalaswlg................................................
ENSGGOP00000024673  rvlkplsslihlqansnpwecnckllglrdwlassaitlniycqnppsmrgralryini...................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  slsflptlrelhldnnklarvpsglpdlkllqvvylhsnnitkvgvndfcpvgfgvkrayyngislfnnpvpy.....
ENSGGOP00000005706  ylpklhtlslng..................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  lpelrtltlngasqitefpd..........................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  stfkylqlvdlsnnkisslsnssftnmsqlttlilsynalrcipplafqglrslrllslhgndistlqegifadvtsl
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  slaniprvreihlennklkkipsglpelkylqiiflhsnsiarvgvndfcptvpkmkkslysaislfnnpvkywe...
ENSGGOP00000006377  le............................................................................
ENSGGOP00000028264  slaniprvreihlennklkkipsglpelkylqiiflhsnsiarvgvndfcptvpkmkkslysaislfnnpvkywe...
ENSGGOP00000021709  lpdlrkieatnnprlsyihpnaffrlpkleslmlnsnalsalyhgtieslpnlkeisihsnpircdcvirwinmn...
ENSGGOP00000025918  ildswislndislagniwecsrnicslvnwlks.............................................
ENSGGOP00000008365  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  slsdnkltelpkyihklnnlrklhvnrnnmv...............................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  gklrqvslrrnrlralpralfrnlssl...................................................
ENSGGOP00000001578  swksltsitlagnlwdcgrn..........................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000025004  dlhslvirgasmvqqfpnl...........................................................
ENSGGOP00000025833  dlhslvirgasmvqqfpn............................................................
ENSGGOP00000016600  ..............................................................................
ENSGGOP00000006124  dfalqnpsavprfvrai.............................................................
ENSGGOP00000005521  itgigredfattyfleelnlsynritspqvhrdafrklrllrsldlsgnrlhtlpp......................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  lqeldvsnlslqalpgdlsglfprlrllaaarnpfncvcplswf..................................
ENSGGOP00000021712  ..............................................................................
ENSGGOP00000015564  cpndlvafhdfssdlenvphlrylrldgnylkppipldlm......................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  qklee.........................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  vnfsklqvlrldgneikrs...........................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  agpeavkgqtllav................................................................
ENSGGOP00000025637  nhieripgyafahmkpgleflhlshnrlqadsihsmsflglraslaellldhnqlqaiprgllglkglqvlglshnri
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  llgnqieripgyvfghmepgleylylsfnkladdgmdrvsfygayhslrelfldhndlksippgiqemkalhflrlnn
ENSGGOP00000022805  ..............................................................................
ENSGGOP00000025292  llgnqieripgyvfghmepgleylylsfnkladdgmdrvsfygayhslrelfldhndlksippgiqemkalhflrlnn
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  nlshiyfknfrycsyap.............................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  lnlsdnrlknlpfsftklkelaalwlsdnqskalip..........................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  llfshnqisildlsekaylwsrveklhlshnklkeippeigclenltsldvsynlelrsfpnemgklskiwdlpldel
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ktkiisnrgensckatgqvchalcspegcwgpep............................................
ENSGGOP00000016887  tr............................................................................
ENSGGOP00000018050  tr............................................................................
ENSGGOP00000023473  tr............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000009427  svnvsvicpspsmlpaerdsfsygphlrylrldgneikppipmalmtcfrl...........................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  sgtnlvplpealllhlpalqsvsvg.....................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  sprllpilsqqstinlshnpldctcsnihfvtwykenlhklegseettcanppslrgvklsd................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000016854  qeldltgnprlvldhktl............................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  lnvvgndsfawlphleyffleynniqhlfshslhglfnvrylnl..................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  sldlsrnllecvpdwaceakkievldvsynlltevpgsplrilssl................................
ENSGGOP00000013477  qqldcqdspalasvathifqdtphlqvllfqncnlssfppwtldssqvlsinlfgnpltcscdlswllt.........
ENSGGOP00000005073  qeldltgnprlvldhktl............................................................
ENSGGOP00000018071  neecgdicpgtakgkt..............................................................
ENSGGOP00000007465  cwgageencqk...................................................................
ENSGGOP00000027332  lrmlepeplagldqlrelslahnrlrvgdigpgtwhelqalqvrh.................................
ENSGGOP00000013375  neecgdicpgtakgkt..............................................................
ENSGGOP00000023252  lrmlepeplagldqlrelslahnrlrvgdigpgtwhelqalqvrh.................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  vfeglshlqvlylnnnylnslppgvfshltalrglslnsnrltvlshndlpanleildisrnqllapdpdvfvslsvl
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  wgpgp.........................................................................
ENSGGOP00000004424  qlaltlidtnrsrachpcspvckgsrcwgessedcqs.........................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  nmglhssfmaldfsgfgnlrdldlsgnclttfprfggslaletldlrrnsltalpqkavsqqlsrglrtiylsqnpyd
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  nglmvlqvdlpcficlkrlnlaenrlshlpawtqavslevldlrnnsfsllpgsamggletslrrlylqgnplscc..
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  rnlslenaktsvlllnkvdllwddlflilqfvwhtsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvf
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  ..............................................................................
ENSGGOP00000027978  dkglhishnplskplp..............................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  lktldlsrnqlgknedglktkriaffttrgrqrsgteaacvlefpaflseslevlclndnhldtvppsvcllkslsel
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  ltlnniettwnsffrilqlvwhttvwyfsisnvklqgqldfrdfdysgtslkalsihqvvsdvfsfpqsdiyeifsnm
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ls............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  lgtnfikianlsmfkqfkrlkvidlsvnkisp..............................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  cemsveslnlqkhhfsdissttfqcftqlqeldltathlkglpsgikglnllkklvlsvnhfdqlcqisaanfpslth
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ecadvcpgvlgaagepcakttfsghtdyrcwtsshcqrvcpcphgmactargecchteclggc...............
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  dnqsq.........................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  fgscheelyssrpygaldsgfnsvdsgdkrwsgneptdefsdlplrvaeitkeqrlrresqyqenrgslvvtnggdtv
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  ..............................................................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ehlkeli.......................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ehlkeli.......................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  lkpkyrdrlilvskslefld..........................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................
ENSGGOP00000024368  ..............................................................................
ENSGGOP00000011594  ..............................................................................
ENSGGOP00000014157  ifeilpvkslkarnqtlappfpelrylslaynkitkedavlpvalfpslcefvfhnnplv..................
ENSGGOP00000013487  ..............................................................................
ENSGGOP00000022399  ..............................................................................
ENSGGOP00000016688  ..............................................................................
ENSGGOP00000023599  ..............................................................................
ENSGGOP00000013768  ..............................................................................
ENSGGOP00000012563  ..............................................................................
ENSGGOP00000008281  ..............................................................................
ENSGGOP00000021469  ..............................................................................
ENSGGOP00000006875  ..............................................................................
ENSGGOP00000017558  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000008661  clvrvfqflwpkpveylniynltiiesireedftyskttlkaltiehitnqvflfsqtalytvfsemnimmltisdtp
ENSGGOP00000002527  ..............................................................................
ENSGGOP00000025482  ..............................................................................
ENSGGOP00000028761  ..............................................................................
ENSGGOP00000010362  ..............................................................................
ENSGGOP00000000179  ..............................................................................
ENSGGOP00000024608  ..............................................................................
ENSGGOP00000025066  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000023998  ..............................................................................
ENSGGOP00000009979  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000025398  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000025808  ..............................................................................
ENSGGOP00000003989  ..............................................................................
ENSGGOP00000010116  ..............................................................................
ENSGGOP00000012588  ..............................................................................
ENSGGOP00000013959  ..............................................................................
ENSGGOP00000024093  ..............................................................................
ENSGGOP00000015656  ..............................................................................
ENSGGOP00000027053  ..............................................................................
ENSGGOP00000026787  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000018989  ..............................................................................
ENSGGOP00000017510  ..............................................................................
ENSGGOP00000028171  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000026797  ..............................................................................
ENSGGOP00000016519  ..............................................................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000003012  ..............................................................................
ENSGGOP00000028210  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000007122  ..............................................................................


                                                                                                    
                                                                                                    
d1a9na_               ..............................................................................
ENSGGOP00000002818  ..............................................................................
ENSGGOP00000026867  ..............................................................................
ENSGGOP00000014553  ..............................................................................
ENSGGOP00000006261  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000005919  ..............................................................................
ENSGGOP00000024063  ..............................................................................
ENSGGOP00000013969  ..............................................................................
ENSGGOP00000007076  ..............................................................................
ENSGGOP00000015022  glddnkigqlpselgslsklkilgltgneflsfpeevlslasleklyi..............................
ENSGGOP00000010210  fqdlqnlnllslydnklqtiskglfaplqsiqtlhlaqnpfvcdchlkwladylqdnpietsgarc............
ENSGGOP00000025646  nirf..........................................................................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000004396  rllwl.........................................................................
ENSGGOP00000027814  ..............................................................................
ENSGGOP00000009302  ..............................................................................
ENSGGOP00000010181  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000012823  ..............................................................................
ENSGGOP00000008393  ..............................................................................
ENSGGOP00000017408  ..............................................................................
ENSGGOP00000003137  ..............................................................................
ENSGGOP00000019249  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000023908  ..............................................................................
ENSGGOP00000024673  ..............................................................................
ENSGGOP00000026305  ..............................................................................
ENSGGOP00000009400  ..............................................................................
ENSGGOP00000007056  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000023515  ..............................................................................
ENSGGOP00000003028  ..............................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000006625  ..............................................................................
ENSGGOP00000005450  shlaiganplycdchlrwlsswvk......................................................
ENSGGOP00000019824  ..............................................................................
ENSGGOP00000001938  ..............................................................................
ENSGGOP00000006377  ..............................................................................
ENSGGOP00000028264  ..............................................................................
ENSGGOP00000021709  ..............................................................................
ENSGGOP00000025918  ..............................................................................
ENSGGOP00000008365  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000015799  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000012493  ..............................................................................
ENSGGOP00000018354  ..............................................................................
ENSGGOP00000001578  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000013132  ..............................................................................
ENSGGOP00000024818  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000016600  ..............................................................................
ENSGGOP00000006124  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000001854  ..............................................................................
ENSGGOP00000019138  ..............................................................................
ENSGGOP00000021712  ..............................................................................
ENSGGOP00000015564  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003727  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000025364  ..............................................................................
ENSGGOP00000011582  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000010210  ..............................................................................
ENSGGOP00000019616  ..............................................................................
ENSGGOP00000026995  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000024614  ..............................................................................
ENSGGOP00000025637  rqvplnsicdtrmaqdsnlisthlennlidrrrip...........................................
ENSGGOP00000014142  ..............................................................................
ENSGGOP00000013300  nkirnilpeeicnaeedddsnlehlhlennyikireipsy......................................
ENSGGOP00000022805  ..............................................................................
ENSGGOP00000025292  nkirnilpeeicnaeedddsnlehlhlennyikireipsy......................................
ENSGGOP00000025973  ..............................................................................
ENSGGOP00000002611  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000213  ..............................................................................
ENSGGOP00000025405  ..............................................................................
ENSGGOP00000022526  ..............................................................................
ENSGGOP00000014753  ..............................................................................
ENSGGOP00000020501  ..............................................................................
ENSGGOP00000003295  rlnfdfkhig....................................................................
ENSGGOP00000022737  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000016887  ..............................................................................
ENSGGOP00000018050  ..............................................................................
ENSGGOP00000023473  ..............................................................................
ENSGGOP00000010984  ..............................................................................
ENSGGOP00000024701  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000009427  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000022833  ..............................................................................
ENSGGOP00000008475  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000002826  ..............................................................................
ENSGGOP00000008650  ..............................................................................
ENSGGOP00000013968  ..............................................................................
ENSGGOP00000007909  ..............................................................................
ENSGGOP00000003513  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000022025  ..............................................................................
ENSGGOP00000012021  ..............................................................................
ENSGGOP00000027247  ..............................................................................
ENSGGOP00000012881  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000014079  ..............................................................................
ENSGGOP00000021874  ..............................................................................
ENSGGOP00000020681  ..............................................................................
ENSGGOP00000013987  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000013477  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000007465  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000008663  ..............................................................................
ENSGGOP00000027539  dithnkficecelstfinwlnhtnvtiagppadiycvypdslsgvsl...............................
ENSGGOP00000008275  ..............................................................................
ENSGGOP00000012531  ..............................................................................
ENSGGOP00000009848  ..............................................................................
ENSGGOP00000005706  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000004424  ..............................................................................
ENSGGOP00000003450  ..............................................................................
ENSGGOP00000005521  ..............................................................................
ENSGGOP00000024070  ..............................................................................
ENSGGOP00000004344  ..............................................................................
ENSGGOP00000024903  ..............................................................................
ENSGGOP00000007876  ccgvdgwealr...................................................................
ENSGGOP00000002850  ..............................................................................
ENSGGOP00000001704  ..............................................................................
ENSGGOP00000024790  ..............................................................................
ENSGGOP00000012480  ..............................................................................
ENSGGOP00000004216  ..............................................................................
ENSGGOP00000026324  ..............................................................................
ENSGGOP00000022546  yiqqdkiyllltkmdienltisnaqmphmlfpnyptkfqylnfanniltdelfkrtiqlphlktlvlngnkletlslv
ENSGGOP00000006438  ..............................................................................
ENSGGOP00000009953  ..............................................................................
ENSGGOP00000001696  ..............................................................................
ENSGGOP00000027978  ..............................................................................
ENSGGOP00000023252  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000000058  ylgnnpglrelpselgqlgnlwqldtedltisnvp...........................................
ENSGGOP00000022509  ..............................................................................
ENSGGOP00000027332  ..............................................................................
ENSGGOP00000012870  niknftvsgtpmvhmlcpskispflhldfsnnlltdtvfencghlteletlilqmnqlkelskiaemttqmkslqqld
ENSGGOP00000010388  ..............................................................................
ENSGGOP00000028222  ..............................................................................
ENSGGOP00000010955  ..............................................................................
ENSGGOP00000028499  ..............................................................................
ENSGGOP00000009373  ..............................................................................
ENSGGOP00000015422  ..............................................................................
ENSGGOP00000026779  ..............................................................................
ENSGGOP00000011147  ..............................................................................
ENSGGOP00000013381  ..............................................................................
ENSGGOP00000001892  ..............................................................................
ENSGGOP00000023288  ..............................................................................
ENSGGOP00000020624  ..............................................................................
ENSGGOP00000021650  ..............................................................................
ENSGGOP00000018071  ..............................................................................
ENSGGOP00000013375  ..............................................................................
ENSGGOP00000007909  lyirgnvkklhlgvgcleklgnlqtldlshndi.............................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000001368  ..............................................................................
ENSGGOP00000020939  ..............................................................................
ENSGGOP00000023533  ..............................................................................
ENSGGOP00000003534  ..............................................................................
ENSGGOP00000013469  ..............................................................................
ENSGGOP00000015192  ..............................................................................
ENSGGOP00000026520  ..............................................................................
ENSGGOP00000008114  ..............................................................................
ENSGGOP00000026663  ..............................................................................
ENSGGOP00000003265  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000004826  ..............................................................................
ENSGGOP00000026086  ..............................................................................
ENSGGOP00000022939  ..............................................................................
ENSGGOP00000012492  ehdldqidyidsctaeeeeaevrqpkgpdsdslssqfmayieqrrishegspvkpvairefqktedmrrylhqnrvpv
ENSGGOP00000024274  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000007876  ..............................................................................
ENSGGOP00000010514  ..............................................................................
ENSGGOP00000023229  ..............................................................................
ENSGGOP00000028543  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000016064  ..............................................................................
ENSGGOP00000022050  ..............................................................................
ENSGGOP00000007162  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000016854  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000005073  ..............................................................................
ENSGGOP00000025004  ..............................................................................
ENSGGOP00000025833  ..............................................................................
ENSGGOP00000002210  ..............................................................................
ENSGGOP00000010355  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000023394  ..............................................................................
ENSGGOP00000015593  ..............................................................................
ENSGGOP00000012568  ..............................................................................
ENSGGOP00000023118  ..............................................................................
ENSGGOP00000025923  ..............................................................................
ENSGGOP00000027736  ..............................................................................
ENSGGOP00000000821  ..............................................................................
ENSGGOP00000021010  ..............................................................................
ENSGGOP00000001364  ..............................................................................
ENSGGOP00000020706  ..............................................................................
ENSGGOP00000021036  ..............................................................................
ENSGGOP00000020993  ..............................................................................
ENSGGOP00000002485  ..............................................................................
ENSGGOP00000027543  ..............................................................................
ENSGGOP00000019774  ..............................................................................
ENSGGOP00000010786  ..............................................................................
ENSGGOP00000024131  ..............................................................................
ENSGGOP00000002218  ..............................................................................
ENSGGOP00000008273  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000008661  ..............................................................................
ENSGGOP00000027149  ..............................................................................
ENSGGOP00000013614  ..............................................................................
ENSGGOP00000001884  ..............................................................................
ENSGGOP00000017691  ..............................................................................
ENSGGOP00000017973  ..............................................................................
ENSGGOP00000000481  ..............................................................................
ENSGGOP00000025013  ..............................................................................
ENSGGOP00000019011  ..............................................................................
ENSGGOP00000012497  ..............................................................................
ENSGGOP00000017205  ..............................................................................
ENSGGOP00000004288  ..............................................................................
ENSGGOP00000012465  ..............................................................................
ENSGGOP00000000942  ..............................................................................
ENSGGOP00000012474  ..............................................................................
ENSGGOP00000000462  ..............................................................................
ENSGGOP00000022001  ..............................................................................
ENSGGOP00000025605  ..............................................................................
ENSGGOP00000005450  ..............................................................................
ENSGGOP00000000638  ..............................................................................
ENSGGOP00000017288  ..............................................................................
ENSGGOP00000008256  ..............................................................................
ENSGGOP00000015431  ..............................................................................
ENSGGOP00000000795  ..............................................................................
ENSGGOP00000007172  ..............................................................................
ENSGGOP00000027628  ..............................................................................
ENSGGOP00000002833  ..............................................................................
ENSGGOP00000017434  ..............................................................................
ENSGGOP00000010817  ..............................................................................
ENSGGOP00000011344  ..............................................................................
ENSGGOP00000020930  ..............................................................................
ENSGGOP00000015568  ..............................................................................
ENSGGOP00000015042  ..............................................................................
ENSGGOP00000018300  ..............................................................................
ENSGGOP00000026851  ..............................................................................
ENSGGOP00000026693  ..............................................................................
ENSGGOP00000015068  ..............................................................................
ENSGGOP00000004548  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000027647  ..............................................................................
ENSGGOP00000027539  ..............................................................................
ENSGGOP00000012360  ..............................................................................
ENSGGOP00000006033  ..............................................................................
ENSGGOP00000028049  ..............................................................................
ENSGGOP00000027098  ..............................................................................
ENSGGOP00000011109  ..............................................................................
ENSGGOP00000005584  ..............................................................................
ENSGGOP00000019188  ..............................................................................
ENSGGOP00000015022  ..............................................................................
ENSGGOP00000021155  ..............................................................................
ENSGGOP00000006065  ..............................................................................
ENSGGOP00000008763  ..............................................................................
ENSGGOP00000008108  ..............................................................................
ENSGGOP00000013299  ..............................................................................
ENSGGOP00000006171  ..............................................................................
ENSGGOP00000023255  ..............................................................................
ENSGGOP00000025379  ..............................................................................
ENSGGOP00000010879  ..............................................................................
ENSGGOP00000008240  ..............................................................................
ENSGGOP00000004098  ..............................................................................
ENSGGOP00000017344  ..............................................................................
ENSGGOP00000018814  ..............................................................................
ENSGGOP00000025873  ..............................................................................
ENSGGOP00000004959  ..............................................................................