SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

L domain-like alignments in Pan troglodytes 76_2.1.4

These alignments are sequences aligned to the 0053105 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2ifga3               cpdaccphgssglrctrdgaldslhh....................................................
ENSPTRP00000001468  vldyshcslqqvpkevfnfertleelyldanqieelpkqlfncqalrklsipdndlsnlpttiaslvnlkeldiskng
ENSPTRP00000034204  anlgdiealnlgnngleevpeglgsalgslrvlvlrrnrfarlppavaelgh..........................
ENSPTRP00000050882  pyakniifvetsfttletrafgsnpnltkvvflntqlcqfrpdafgglprledlevtgssflnlstnifsnltslgkl
ENSPTRP00000027103  lssnqlvqiqpahfsqcsnlkelqlhgnhleyipdgafdhlvgltklnlgknslthisprvfqhlgnlqvlrlyenrl
ENSPTRP00000051281  pwytprssyreattvdcndlfltavppalpagtqtlllqsnsivrvdqselg..........................
ENSPTRP00000051241  sshvvslflqhnkirsvegnqlkaylslevldlslnnitevrntcfphgppikelnlagnrigtlelgafdglsrsll
ENSPTRP00000049843  pgacvcynepkvttscpqqglqavpvgipatsqriflhgnrishvpaasfracrnltilwlhsnvlaridaaaftgla
ENSPTRP00000028996  ngiqefpeniknckvltiveasvnpisklpdgfsqllnltqlylndafleflpan.......................
ENSPTRP00000008989  vcpfrcqchlrvvqcsdlgldkvpkdlppdttlldlqnnkiteikdgdfknlknlhalilvnnkiskvspgaftplvk
ENSPTRP00000051884  nynelteipyfgeptsnitllslvhniipeinaqalqfypalgsldlssniiseiktssfprmqlkylnlsnnrittl
ENSPTRP00000060321  klnnlrklhvnrnnmvkitdsishlnnicslefsgniitdvpieikncqkiikielsynkimyfplglcaldslyyls
ENSPTRP00000029913  cptkctcsaasvdchglglravprgiprnaerldldrnnitritkmdfaglknlrvlhlednqvsvierg........
ENSPTRP00000026857  ffidasnqsltaipleiftf..........................................................
ENSPTRP00000017393  cectaqtravactrrrltavpdgipararllelsrnrirclnpgdlaalpaleeldlsenaiahvepgafanlprlrv
ENSPTRP00000008774  hlqslrevklnnneletipnlgpvsanitllslagnriveilpehlkefqsletldlssnniselqtafpalqlkyly
ENSPTRP00000025115  qlcvceirpwftpqstyreattvdcndlrltripsnlssdtqvlllqsnniaktvdel....................
ENSPTRP00000005186  ensmrldlskrsihilpssikeltqltelylysnklqslpaevgclvnlmtlalsensltslpdsldnlkklrmldlr
ENSPTRP00000001472  gtsvpqgllkaarksgqlnlsgrnlsevpqcvwrinvdipeeanqnlsfgaterwweqtdltkliisnnklqsltddl
ENSPTRP00000002213  cdctsqpqavlcghrqleavpgglpldtelldlsgnrlwglqrgmlsrlsllqeldlsynqlstlepgafhglqsllt
ENSPTRP00000051339  cecsaqdravlchrkrfvavpegiptetrlldlgknriktlnqdefasfphleelelnenivsavepgafnnlfnlrt
ENSPTRP00000060625  cpvacscsnqasrvictrrdlaevpasipvntrylnlqengiqvirtdtfkhlrhleilqlsknlvrkievgafnglp
ENSPTRP00000020782  acpkncrcdgkivyceshafadipenisggsqglslrfnsiqklksnqfaglnqliwlyldhnyissvdedafqgirr
ENSPTRP00000047233  cscvsvenvlyvncekvsvyrpnqlkppwsnfyhlnfqnnflnilypntflnfshavslhlgnnklqnieggaflgls
ENSPTRP00000027104  kmvlleqlfldhnalrgidqnmfqklvnlqelalnqnqldflpaslftnlenlklldlsgnnlthlpkgllgaqakle
ENSPTRP00000035643  cecsaqnksvschrrrliaipegipietkildlsknrlksvnpeefisyplleeidlsdniianvepgafnnlfnlrs
ENSPTRP00000049653  cpqacicdnsrrhvacrhqnltevpdaipeltqrldlqgnllkvipaaafqgvphlthldlrhcqvelvaeg......
ENSPTRP00000019491  cpvacscsnqasrvictrrdlaevpasipvntrylnlqengiqvirtdtfkhlrhleilqlsknlvrkievgafnglp
ENSPTRP00000029568  acppkcrcekllfycdsqgfhsvpnatdkgslglslrhnhitelerdqfasf..........................
ENSPTRP00000042428  lsslpslraivaranslkns..........................................................
ENSPTRP00000061216  lllhkeilgcssvcqlctgrqincrnlglssipknfpestvflyltgnnisyineseltglhslvalyldnsnilyvy
ENSPTRP00000033656  ncpsvcscsnqfskvvctrrglsevpqgipsntrylnlmenniqmiqadtfrhlhhlevlqlgrnsirqievgafngl
ENSPTRP00000014575  gcprdcvcypapmtvscqahnfaaipegipvdservflqnnrisllqpgrfspamvtlwmysnnityihpgtfegfvh
ENSPTRP00000003094  lwlddnalteilvral..............................................................
ENSPTRP00000015086  nslknsgvp.....................................................................
ENSPTRP00000006103  cpsvcscsnqfskvicvrknlrevpdgistntrllnlhenqiqiikvnsfkhlrhleilqlsrnhirtieigafngla
ENSPTRP00000015965  cpqnchchgdlqhvicdkvglqkipkvsektkllnlqrnnfpvlaans..............................
ENSPTRP00000036080  pmcpfgcqcysrvvhcsdlgltsvptni..................................................
ENSPTRP00000008874  lrvdcsdlglselpsnlsvftsyldlsmnnisqllpnplpslrfleelrlagnaltyipkgaftglyslkvlmlqnnq
ENSPTRP00000047686  tprsiymeastvdcndlglltfparlpantqilllqtnniakieystd..............................
ENSPTRP00000037431  cstvergcsvrcdragllrvpaelpceavsidldrnglrflgerafgtlpslrrlslrhnnlsfitpgafkglprlae
ENSPTRP00000060321  tvnleakglqefpkdilkikyvkylyldknqiktfqgadsgdllgleilslqenglsslpseiqllhnlrilnvshnh
ENSPTRP00000004388  cpkgcrcegkmvycesqklqeipssisagclglslrynslqklkynq...............................
ENSPTRP00000022464  edvdlnhyrigkiegfevlkkvknlclrqnlikcienleelqslreldlydnqikkienlealteleildisfnllrn
ENSPTRP00000020795  lcrcegrllycealnlteaphnlsgllglslrynslselragq...................................
ENSPTRP00000049653  cpracvcvpesrhsscegcglqavprgfpndtqlldlrrnhfpsvpraafpglghlvslhlqhcgiaeleagalaglg
ENSPTRP00000035343  iplwrcnrhvesvdkrhcslqavpeeiyrysrsleellldanqlrelpkpffrllnlrklglsdneiqrlppevanfm
ENSPTRP00000001283  vvscprdcacsqegvvdcggidlrefpgdlpehtnhlslqnnqlekiypeelsrlhrletlnlqnnrltsrglpekaf
ENSPTRP00000061095  tslrwlklnrtglcylpeelaalqklehlsvshnnlttlhgelsslpslraivaranslknsgvpddifklddlsvld
ENSPTRP00000048194  dismnnitqlpedafknfpfleelqlagndlsfihpkalsglkelkvltlqnnqlktvpseai...............
ENSPTRP00000036665  lelhlfmlsgipdtvfdlvelevlklelipdvtippsiaqltglkelwlyhtaakieapalaflrenlralhikftdi
ENSPTRP00000011222  fpaelhnvqsvhtvylygnqldefpmnlpknvrvlhlqenniqtisraalaqllkleelhlddnsistvgvedgafre
ENSPTRP00000047055  pvqclcqgleldcdetnlravpsvssnvtamslqwnlirklppdc.................................
ENSPTRP00000001626  hlfmlsgvpdavfdltdldvlklelipeakipakisqmtnlqelhlchcpakveqtafsflrdhlrclhvkftdvaei
ENSPTRP00000017670  gpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylkirrsyalvslsffr
ENSPTRP00000053783  qpqtvfctarqgttvprdv...........................................................
ENSPTRP00000012792  gpcpkvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvkirhshalvslsflk
ENSPTRP00000013006  svfcssrnltrlpdgvpggtqalwldgnnlssippaafqnlsslgflnlqggqlgslepqallglenlchlhlernql
ENSPTRP00000042859  psalycdsrnlrkvpvi.............................................................
ENSPTRP00000007033  rsilasplgfytalrhldlstneisflqp.................................................
ENSPTRP00000042754  mcpfgchchlrvvqcsdlglksvpkei...................................................
ENSPTRP00000022750  ipsdlknllkveriylyhnsldefptnlpkyvkelhlqennirtitydslskipyleelhlddnsvsavsieegafrd
ENSPTRP00000001624  nrlelplimlsglpdtvfeitelqslkleiiknvmipatiaqldnlqelslhqcsvkihsaalsflkenlkvlsvkfd
ENSPTRP00000017533  vhlaveffnlthlpanllqgasklqelhlssngleslspeflqpvpqlrvldltrnaltglppglfqasaaldtlvlk
ENSPTRP00000031252  iplwrcnrhvesidkrhcslvyvpeeiyryarsleellldanqlrelpeqffqlvklrklglsdneiqrlppeianfm
ENSPTRP00000036079  cfcptnfpssmycdnrklkaipnipmhiqqlylqfneieavtansfinathlkeinlshnkiksqkidygvfaklpnl
ENSPTRP00000003137  fppfvpsrmkyvyfqnnqitsiqegvfdnatgllwialhgnqitsdkvgrkvfsklrhlerlyldhnnltrmpgpl..
ENSPTRP00000009804  pqycdcketelecvngdlksvpmisnnvtllslkknkihslpdk..................................
ENSPTRP00000059190  pcvcqnlseslstlcahrgllfvppnvdrrtvelrladnfiqalgppdfrnmtglvdltlsrnaitrigarafgdles
ENSPTRP00000018046  lhnnqlsnaglppd................................................................
ENSPTRP00000048004  qdlktkvnvqviylyendldefpinlprslrelhlqdnnvrtiardslariplleklhlddnsvstvsieedafadsk
ENSPTRP00000041179  ftldlsrnnlvtvqpemfaqlshlqclrlshncisqavngsqflpltglqvldlshnkldlyhehsftelprlealdl
ENSPTRP00000017706  rlelalcmlpglpdtvfelseveslrleaicditfppglsqlvhlqelsllhsparlpfslqvflrdhlkvmrvkcee
ENSPTRP00000053173  vskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltqlnldrceltklqvdgtlpvlgtld
ENSPTRP00000008987  gqsspncapecncpesypsamycdelklksvpmvppgikylylrnnqidhidekafenvtdlqwlildhnllenskik
ENSPTRP00000008254  dslrssklqshmrhsdsisslasereyitsldlsanelrdidalsqkccisghlehleklelhqnaltsfpqqlcetl
ENSPTRP00000036082  tiscinamltqipplta.............................................................
ENSPTRP00000060795  rsdhgssiscqppaeipsylpadtvhlaveffnlthlpanllqgasklqelhlssngleslspeflqpvpqlrvldlt
ENSPTRP00000032807  kcegpcrkvcngigigefkdtlsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgfl
ENSPTRP00000055467  lcakkgllfvppnidrrtvelrladnfvtnikrkdf..........................................
ENSPTRP00000022026  ralrkyyencevvmgnleitsiehnrdlsflrsvrevtgyvlvalnqfrylplenlriirgtklyedryalaiflnyr
ENSPTRP00000047494  fmsvnescykygqtldlsknsiffvkssdfqhlsflkclnlsgnlisqtlngsefqplgelryldfsnnrldllhsta
ENSPTRP00000046894  dcfadlacpekchcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkinfsnnkitdieeg
ENSPTRP00000008986  ecfcppnfptalycenrglkeipai.....................................................
ENSPTRP00000047783  lfdsfsltrvdcsglgphimpvpipl....................................................
ENSPTRP00000014225  sqristvdlscysleevpehlfysqd....................................................
ENSPTRP00000026754  tevhctfryltsipdsippnverinlgynslvrlmetdfsgltklellmlhsngihtipdkt................
ENSPTRP00000028569  slaslpkiddfsfqwlkclehlnmedndipgiksnmftglinlkylslsnsfsslrtltnetfvslahsplhilnltk
ENSPTRP00000022026  pctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpeklnvfrtvreitgfl
ENSPTRP00000028569  ctvthevadcshlkltqvpddlptnitvlnlthnqlrrlpasn...................................
ENSPTRP00000017119  flqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkalyassnelvqldvypvpnylsymdvsrnrl
ENSPTRP00000047493  kaldlslnsiffigpnqfenlpdiaclnlsansnaqvlsgtefsaiphvkyldltnnrldfdnasaltelsdlevldl
ENSPTRP00000018633  lsvlcpgagllfvppsldrraaelrladnfiasvrrrdlanmtgllhlslsrntirhvaagaf...............
ENSPTRP00000020457  richcsnrvflcqeskvteipsdl......................................................
ENSPTRP00000035431  tvecgalrlrvvplgippgtqtlflqdnniarlepgalaplaalrrlylhnnslraleag..................
ENSPTRP00000017670  evcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylllfrvygleslkdlfpnltvir
ENSPTRP00000029007  sveslnlqehrfsdissttfqcftqlqeldltathlkglpsgikglnllkklvlsvnhfdqlcqisaanfpslthlyv
ENSPTRP00000022692  glpaadatalslanrnlerlpgclprtlrsldashnllralstselghleqlqvltlrhnriaalrwgpggpaglhtl
ENSPTRP00000032807  cqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialntveriplenlqiir
ENSPTRP00000003935  evdmsdrgisnmldvnglftlshitqlvlshnklttvppniaelknlevlnffnnqieelptqis.............
ENSPTRP00000030995  cpkycvcqnlseslgtlcpskgllfvppdidrrtvelrlggnfiihisrqdfanmtglvdltlsrntishiqpfs...
ENSPTRP00000029913  cpekcrcegtivdcsnqklaripshlpeyvtdlrlndnevsvleatg...............................
ENSPTRP00000014225  slrtlyassnrltavnvypipslltsldlsrnllecvpdwaceakkievldvsynlltevpvrilsslslrklmlghn
ENSPTRP00000005186  stiyslnmehnrinkipfgifsrakvlsklnmkdnqltslpldfgtwtsmvelnlatnqltkipedvs..........
ENSPTRP00000037057  acphpcacyvpsevhctfrslasvpagiakhverinlgfnsiqalsetsfagltklellmihgneipsipdgal....
ENSPTRP00000015508  rhlyqgcqvvqgnleltylptnaslsflqdiqevqgyvliahnqvrqvplqrlrivrgtqlfednyalavldngdpln
ENSPTRP00000012792  cgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrvagleslgdlfpnltvirgwk
ENSPTRP00000015508  pcarvcyglgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetleeitgylyisa
ENSPTRP00000018786  icqnvaptltmlcaktgllfvppaidrrvvelrltdnfiaavrrrdfanmtslvhltlsrntigqvaagafadlralr
ENSPTRP00000025606  rqsslpkdrgkrssafvfelsgehwtelpdslkeqthlrewhisntliqiiptyiql.....................
ENSPTRP00000012830  vkwshlrlpwvdldwlid............................................................
ENSPTRP00000034664  vrcmhlmldhipqvpqqttvldlrfnrireipgs............................................
ENSPTRP00000026322  llrlllphnrlvslpralgsgfphlqlldvsgnaltalgpellalrglrtllaknnrlggpsalpkglaqsplcrslq
ENSPTRP00000008962  leilrcgpwdtlqqvttvtfqdlpgcvlstlaectnlqflslrrcgltslhslsnckklkyidaqenhieaiecenle
ENSPTRP00000046894  hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippg...............................
ENSPTRP00000031403  qcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrppl.....................
ENSPTRP00000015314  cicterhrhvdcsgrnlttlpsglqeniihlnlsynhftdlhnqltqytnlrtldisnnrleslpahlprslwnmsaa
ENSPTRP00000027161  nlweefsss.....................................................................
ENSPTRP00000044034  lrevpeglpanvttlslsankitvlrrg..................................................
ENSPTRP00000033466  pcdvytylhekyldcqerklvyvlpgwpqdllhmllarnkirilknnmfskfkklksldlqqneiskieseaffglnk
ENSPTRP00000027515  tncsnmslrkvpadlt..............................................................
ENSPTRP00000008874  nnldefptairtlsnlkelgfhsnnirsipekafvgnpslitihfydnpiqfvgrsafqhlpelrtltlngasqitef
ENSPTRP00000001496  aapmttrvliitdgylssiestnlsllfnlallslsrngiedvqedalhgltmlrtlllehnqissssltdht.....
ENSPTRP00000000339  hacpagcactdphtvdcrdrglpsvpdpfpldvrkllvagnriqripedf............................
ENSPTRP00000027516  drsknglihvpkdls...............................................................
ENSPTRP00000049501  gmtdipdflw....................................................................
ENSPTRP00000007737  levdcsglglttvppdvpaatrtllllnnklsalpsw.........................................
ENSPTRP00000027179  vlslsgrklrefprgaanh...........................................................
ENSPTRP00000033370  tlnlsnrrlkhfprgaarsydlsditqa..................................................
ENSPTRP00000011913  fqlkdrgltefpadlqkl............................................................
ENSPTRP00000041364  dlrempldkmvdlsgsqlrrfplhvcsfr.................................................
ENSPTRP00000012439  cayrdlesvppgfranvttlslsanrlpglpeg.............................................
ENSPTRP00000002493  glcpkecrvgtktidsiqaaqdlvgcthegsfiltfrqgynlepqlqhslglvetitgflkikhsfalvslgffknlk
ENSPTRP00000009963  ansgglnlsarklkefprtaapghd.....................................................
ENSPTRP00000047494  tldvpknhvivdctdkhlteipggiptnttnltltinhipdispasfhrldhlveidfrcncvpiplgsknnmcikrl
ENSPTRP00000029007  keanktyncenlglseipdtlpntteflefsfnflptihnrt....................................
ENSPTRP00000012803  lekhknlflnyrnlhhfplellkde.....................................................
ENSPTRP00000002493  evcpsldirsevaelrqlencsvveghlqillmftatgedfrglsfprltqvtdylllfrvygleslrdlfpnlavir
ENSPTRP00000006306  gtscpvlctcrnqvvdcssqrlfsvppdlpmdtrnlslahnritavppgylt..........................
ENSPTRP00000052915  lpprlftlpllhylevsgcgslrapgpglaqglpqlhslvlrrnalgpglspelgplpalrvldlsgnalealppgqg
ENSPTRP00000047302  vsgiiicdfpgsgdildttqpd........................................................
ENSPTRP00000031252  pesiga........................................................................
ENSPTRP00000027465  nr............................................................................
ENSPTRP00000026832  fnnisellprplnakklylssnliqkiyrsdfwnfssldllhlgnnrisyvqdg........................
ENSPTRP00000008307  cptacicatdivsctnknlskvpgnlfrlikrldlsynriglldsewipvsfaklntlilrhnnitsistgs......
ENSPTRP00000027477  di............................................................................
ENSPTRP00000047493  aflnlknlrelllednqlpqipsglpesltelsliqnniynitkegisrlinlknlylawncyfnkvcektniedgvf
ENSPTRP00000001819  vscpaaclcasnilscskqqlpnvphslpsytalldlshnnlsrlraewtptrltqlhslllshnhlnfisse.....
ENSPTRP00000010126  qisdlglnvncqerkiesiaelqpkpynpkkmyltenyiavvrrtdfleatgldllhlgnnrismiqdr.........
ENSPTRP00000041179  rhfpqlhpntfshlsrleglvlkdsslswlnaswfrglgnlrvldlsenflykcitnpkafqgltqlrklnlsfnyqk
ENSPTRP00000036986  dcpevctcvpgglascsalslpavpaglslrlrallldhnrvralppg..............................
ENSPTRP00000033769  ltlsgcnlidvsilcgyvhlqkldlsankiedlscvscmpyllelnasqnnlttffnfkppknlkkadfshnriseic
ENSPTRP00000048194  lgefpqaikalpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnlsdlhslvirgasmvqqfpn
ENSPTRP00000057473  ycpipcnckvlspsglliycqernieslsdlrpppqnprklilagniihslmksdlveyftlemlhlgnnrievleeg
ENSPTRP00000002701  skcpnnclcqaqevictgkqlteypldiplntrrlflnenritslpamhlg...........................
ENSPTRP00000010123  nnrnvssladlkpklsnvqelflrdnkihsirkshfvdyknlilldlgnnniatvennt...................
ENSPTRP00000017119  vasqrissvdlsccslehlpanlfysqdlthlnlkqnflrqnpslpaarglnelqrftk...................
ENSPTRP00000004835  p.............................................................................
ENSPTRP00000025772  lhncpykcicaadllsctglglqdvpaelpaatadldlshnalqrlrpgwlaplfqlralhldhneldalgrgv....
ENSPTRP00000010123  hvdcekkgftslqrftaptsqfyhlflhgnsltrlfpnefanfynavslhmennglheivpg................
ENSPTRP00000011064  piekmdasls....................................................................
ENSPTRP00000027161  sslppqarmlildanplktqwnhslqpyplleslslhschlerisrga..............................
ENSPTRP00000010126  lseispprfpiyhlllsgnllnrlypnefvnytgasilhlgsnviqdietg...........................
ENSPTRP00000054912  pse...........................................................................
ENSPTRP00000034515  gt............................................................................
ENSPTRP00000018540  s.............................................................................
ENSPTRP00000057473  qlsllnngltmlhtndfsgltnaisihlgfnniadieig.......................................
ENSPTRP00000027614  secqwneyiltncsftgkcdipvdisqtaatvdvsfnffrvllqshtkkeewkikhldlsnnliskitlspfaylhal
ENSPTRP00000024687  ipqhinstvhdlrlnenklkavlysslnrf................................................
ENSPTRP00000025967  dkcycqsstnfvdcsqqglaeipshlppqtrtlhlqdnqihhlpaf................................
ENSPTRP00000026832  pcycevkeslfhihcdskgftnisqitefwsrpfklylqrnsmrklysnsflhlnnavsinlgnnalqdiqtg.....
ENSPTRP00000007855  klevkerdltdiyllrsyihlryvdisenhltdlsplnylthllwlkadgnrlrsaqmnelpylqiasfaynqitdte
ENSPTRP00000027517  mnimmltisdtpfihmlcphapstfkflnftqnvftdsifekcstlvkletlilqknglkdlfkvglmtkdmpsleil
ENSPTRP00000001283  prrvrtlmilhnqitgigredfattyfleelnlsynritspqvhrda...............................
ENSPTRP00000020451  ta............................................................................
ENSPTRP00000006511  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee...................
ENSPTRP00000012374  gdhinlvssslssfpilqrsseekilysdrlslerqkltvcpiingedhlrllnfqhnfitriqnisnlqklisldly
ENSPTRP00000056400  lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie....................
ENSPTRP00000053355  elptnlpvdtvklriektvirrisae....................................................
ENSPTRP00000041711  ldfrnilridnlwq................................................................
ENSPTRP00000038049  lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie....................
ENSPTRP00000050575  rtlqctsvslgkipgnlseefkqvriensplfempqgs........................................
ENSPTRP00000008984  fptcllctcisttvycddheldaipplpkntayfysrfnrikkinknd..............................
ENSPTRP00000049006  kyienlek......................................................................
ENSPTRP00000060814  kr............................................................................
ENSPTRP00000004277  kr............................................................................
ENSPTRP00000027103  psectcsrasqvectgarivavptplpwnamslqilnthitelnes................................
ENSPTRP00000051190  glqklgpnlpceadihtlildknqiiklenlekckrliqlsvannrlvrmmgvakltllrvlnlphnsigcveglke.
ENSPTRP00000055643  pmlctcysspptvscqannfssvpl.....................................................
ENSPTRP00000001472  ihaiitlkildysdkqatlipdevfdavksniitsinfsknqlceipkrmvelkemvsdvdlsfnklsfislelcv..
ENSPTRP00000004702  ppdtsrlrlertairrvpge..........................................................
ENSPTRP00000013006  g.............................................................................
ENSPTRP00000043808  ldiskcelseipfgafatckvlqk......................................................
ENSPTRP00000041179  pcelqphglvncnwlflksvphfsmaaprgnvtslslssnrihhlhdsdfahlpslrhlnlkwncppvglspmhfpch
ENSPTRP00000035210  vif...........................................................................
ENSPTRP00000011214  vtckdiqrips...................................................................
ENSPTRP00000010702  svmrlahrgcnvdtpvstltpvktsefenfktkmvitskkdyplsknfpyslehlqtsycglvrvdmrm.........
ENSPTRP00000041754  elieqaaqytnavrd...............................................................
ENSPTRP00000050767  ppniaelknlevlnflnnqieklptqis..................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  krrihlelrnrtpaavrelvldncksndgkiegltaef........................................
ENSPTRP00000039448  rihlelrnrtpsdvkelvldnsrsnegklegltdefeeleflstinvgltsianlpk.....................
ENSPTRP00000035343  lgglvl........................................................................
ENSPTRP00000035630  ytlipadikkdvtildlsynqitlngtdtrvlqt............................................
ENSPTRP00000024055  se............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ptcllcvclsgsvyceevdidavpplpkesaylyarfnkikkltakd...............................
ENSPTRP00000025359  v.............................................................................
ENSPTRP00000044819  lptclvcvclgssvycddidledipplp..................................................
ENSPTRP00000002116  lelrnrspeevtelvldnclcvngeieglndtfk............................................
ENSPTRP00000053040  tf............................................................................
ENSPTRP00000007526  svlvlnscgitcagdekeiaafca......................................................
ENSPTRP00000024064  t.............................................................................
ENSPTRP00000034772  etis..........................................................................
ENSPTRP00000030128  slsa..........................................................................
ENSPTRP00000048131  dvf...........................................................................
ENSPTRP00000044257  esilllklrglgl.................................................................
ENSPTRP00000003094  pchcqedgimlsad................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  lgnfgv........................................................................
ENSPTRP00000007000  hsviyinasenllple..............................................................
ENSPTRP00000040371  lp............................................................................
ENSPTRP00000009462  vtlvdkdllkf...................................................................
ENSPTRP00000015329  n.............................................................................
ENSPTRP00000027832  sls...........................................................................
ENSPTRP00000052190  iregqkdfvfvkf.................................................................
ENSPTRP00000015874  ekm...........................................................................
ENSPTRP00000046801  tldlaecklvsfpigiykvlrnvsgq....................................................
ENSPTRP00000014047  ldeegirrlgaltleqpe............................................................
ENSPTRP00000061088  pepntyhgt.....................................................................
ENSPTRP00000050620  hfa...........................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  avdkskrglihvpkdl..............................................................
ENSPTRP00000028616  dlaelrslsipgtyqe..............................................................
ENSPTRP00000027104  gl............................................................................
ENSPTRP00000005408  i.............................................................................
ENSPTRP00000045137  rn............................................................................
ENSPTRP00000043320  rrihlelrnrtpsdv...............................................................
ENSPTRP00000028996  v.............................................................................
ENSPTRP00000015086  lpfv..........................................................................
ENSPTRP00000036008  e.............................................................................
ENSPTRP00000047976  srlkeltledlkitgtmpplpleatglalsslrlrnvswatgrswlaelqqwlkpglkvlsiaqahspafsceqvraf
ENSPTRP00000060126  t.............................................................................
ENSPTRP00000042428  vlp...........................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  i.............................................................................
ENSPTRP00000047493  nisk..........................................................................
ENSPTRP00000034915  lik...........................................................................
ENSPTRP00000018267  lnfsgls.......................................................................
ENSPTRP00000048004  tcps..........................................................................
ENSPTRP00000051241  r.............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  gkyv..........................................................................
ENSPTRP00000028379  s.............................................................................
ENSPTRP00000022750  cp............................................................................
ENSPTRP00000015475  t.............................................................................
ENSPTRP00000028379  clelrdtdldtfrfselstgetnslikkftfrnvkitdeslfqvmkllnqisgllelefddctlngvgnfrasdndrv


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  vqefpenikcckcltiieasvnpisklpdgftqllnltqlylndafleflpanfgr......................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  tlnfnmlealpeglfqhlaaleslhlqgnqlqalprrlfqplthlktlnlaqnllaqlpeelfhpltslqtlklsnna
ENSPTRP00000027103  tdipmgtfdglvnlqelalqqnqigllspglfhnnhnlqrlylsnnhisqlppsifmqlpqlnrltlfgnslkelspg
ENSPTRP00000051281  ..............................................................................
ENSPTRP00000051241  tlrlsknritqlpvrafklprltqldlnrnrirliegltfqglnslevlklqrnniskltdgafwglskmhvlhleyn
ENSPTRP00000049843  lleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelgpgl..................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  lerlylsknqlkelpekmpktlqelraheneitkvrkvtfnglnqmivielgtnplkssgieng..............
ENSPTRP00000051884  eagcfdnlsssllvvklnrnrismippkifklphlqflelkrnrikivegltfqgldslrslkmqrngisklkdgaff
ENSPTRP00000060321  vngnyiseipvdisfskqllhlelsenkllifsehfcslinlkyldlgknqikkipasisnmislhvlilccnkfetf
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000026857  ..............................................................................
ENSPTRP00000017393  lrlrgnqlklippgvftrldnltlldlsenklvilldytfqdlhslrrlevgdndlvfvsrrafagllaleeltlerc
ENSPTRP00000008774  lnsnrvtsmepgyfdnlantllvlklnrnrisaippkmfklpqlqhlelnrnkiknvdgltfqglgalkslkmqrngv
ENSPTRP00000025115  ..............................................................................
ENSPTRP00000005186  hnklreipsvvyrldslttlylrfnrittvekdiknlsklsmlsirenkikqlpaeig....................
ENSPTRP00000001472  r.............................................................................
ENSPTRP00000002213  lrlqgnrlrimgpgvfsglsaltlldlrlnqivlfldgafgelgslqklevgdnhlvfvapgafaglaklstltlerc
ENSPTRP00000051339  lglrsnrlkliplgvftglsnltkldisenkivilldymfqdlynlkslevgdndlvyishrafsglnsleqltlekc
ENSPTRP00000060625  slntlelfdnrlttvptqafeylsklrelwlrnnpiesipsyafnrvpslrrldlgelkrleyisea...........
ENSPTRP00000020782  lkelilssnkitylhnktfhpvpnlrnldlsynklqtlqseqfkglrkliilhlrsnslktvpirvfqdcrnldfldl
ENSPTRP00000047233  alkqlhlnnnelkilradtflgienleylqadynlikyiergafnklhklkvlilndnlisflpdnifrfaslthldi
ENSPTRP00000027104  rlllhsnrlvsldsgplnslgaltelqfhrnhirsiapgafdrlpnlssltlsrnhlaflpsalflhshnltlltlfe
ENSPTRP00000035643  lrlkgnrlklvplgvftglsnltkldisenkivilldymfqdlhnlkslevgdndlvyishrafsgllsleqltlekc
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  slntlelfdnrlttvptqafeylsklrelwlrnnpiesipsyafnrvpslrrldlgelkrleyisea...........
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000061216  pkafvqlrhlyflflnnnfikrldpgifkgllnlrnlylqsnqvsfvprgvfndlvsvqylnlqrnrltvlgsgtfvg
ENSPTRP00000033656  aslntlelfdnwltvipsgafeylsklrelwlrnnpiesipsyafnrvpslmrldlgelkkleyiseg..........
ENSPTRP00000014575  leeldlgdnrqlrtlapetfqglvklhalylykcglsalpag....................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000006103  nlntlelfdnrlttipngafvylsklkelwlrnnpiesipsyafnripslrrldlgelkrlsyiseg...........
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  lrqvptea......................................................................
ENSPTRP00000047686  ..............................................................................
ENSPTRP00000037431  lrlahngdlrylhartfaalsrlrrldlaacrlfsvperllaelpalrelaafdnlfrrvpgalrglanlthahlerg
ENSPTRP00000060321  ishipkeisqlgnirqlffynnyienfptdle..............................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  iegvdk........................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  rliylylsdnqlaglsaaalegaprlgylylernrflqvpgaalralpslfslhlqdnavdrlapgdlggtralrwvy
ENSPTRP00000035343  qlveldvsrndipeipesikfckaleiadfsgnplsrlpdgftqlrslahlalndvslqalpgdvg............
ENSPTRP00000001283  ehltnlnylylannkltlaprflpnalisvdfaanyltkiygltfgqkpnlrsvylhnnkladaglpdnmfngssnve
ENSPTRP00000061095  lshnqltecprelenaknmlvlnlshnrqlpamtalqtlhlrstqrtqsnlptsleglsnladvdlscndltrvpecl
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  keiplwiyslktleelhltgnlsaennryividglrelkrlkvlrlksnlsklpqvvtdvgvhlqklsinnegtkliv
ENSPTRP00000011222  aislkllflsknhlssvpvglpvdlqelrvdenriavisdm.....................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  pawvyllknlrelylignlnsennkmigleslrelrhlkilhvksnltkvpsnitdvaphltklvihndgtkllvlns
ENSPTRP00000017670  klrlirgetleignysfya...........................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  nlr...........................................................................
ENSPTRP00000013006  rslalgtfahtptlaslglsnnrlsrledglfeglgslwdlnlgwnslavlpda........................
ENSPTRP00000042859  ..............................................................................
ENSPTRP00000007033  ..............................................................................
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  snylrllflsrnhlstipwglprtieelrlddnristisspsl...................................
ENSPTRP00000001624  dmrelppwmyglrnleelylvgslshdisrnvtleslrdlkslkilsiksnvskipqavvdvsshlqkmcihndgtkl
ENSPTRP00000017533  enqlevlevswlhglkalghldlsgnrlrklppglla.........................................
ENSPTRP00000031252  qlveldvsrneipeipesisfckalqvadfsgnpltrlpesfpelqnltclsvndislqslpeni.............
ENSPTRP00000036079  lqlhlehnnleefp................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  lrslhldgnrlvelgtgsl...........................................................
ENSPTRP00000018046  ..............................................................................
ENSPTRP00000048004  qlkllflsrnhlssipsg............................................................
ENSPTRP00000041179  synsqpfgmqgvghnfsfvahlrtlrhlslahnnihsqvsqqlcstslraldfsgnalghmwaegdlylhffqglsgl
ENSPTRP00000017706  lrevplwvfglrgleelhleglfpqelaraatleslrelkqlkvlslrsnagkvpasvtdvaghlqrlslhndgarlv
ENSPTRP00000053173  lshnqlqslpllgq................................................................
ENSPTRP00000008987  grvfsklkqlkklhinhnnltesvgpl...................................................
ENSPTRP00000008254  kslthldlhsnkftsfpsyllkmscianldvsrndigpsvvldptvkcptlkqfnlsynqlsfvpenltdvvekleql
ENSPTRP00000036082  ..............................................................................
ENSPTRP00000060795  rnalvlkenqlevlevswlhglkalghldlsgnrlrklppglla..................................
ENSPTRP00000032807  liqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslg..................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  kdgnfglqelglknlteilngg........................................................
ENSPTRP00000047494  feelhklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslrtlefrgnhldvlwregd
ENSPTRP00000046894  afegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgndsfiglssvrllslydnqittvapgafdtlh
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  nkiskiesdafswlghlevldlglneigqeltgqewrglenifeiylsynkylqltrnsfalvpslqrlmlrrvalkn
ENSPTRP00000022026  niqswppnmtdfsvfsnlvtiggrvly...................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  envpewvcesrklevldighnqicelparlfcnsslrkllaghnqlarlperler.......................
ENSPTRP00000047493  synshyfriagvthhlefiqnftnlkvlnlshnniytltdkynleskslvelvfsgnrldilwndddnryisifkglk
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  gsr...........................................................................
ENSPTRP00000029007  rgnvkklhlgvgcleklgnletldlshndieasdccslqlknlshlqtlnlshneplglqsqafkecpqlelldlaft
ENSPTRP00000022692  dlsynqlaalppcagpalsslralalagnplralqprafacfpalqllnlsctalgrgaqggiaeaafagedgap...
ENSPTRP00000032807  gnmyyensyalavlsnydanktglkelpmrnlqeilhg........................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  hvqnlptlvehip.................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  nttpvtgaspgglrelqlrslteilkggv.................................................
ENSPTRP00000012792  lfynyalvif....................................................................
ENSPTRP00000015508  wpdslpdlsvfqnlqvirgrilhngaysltlqglgi..........................................
ENSPTRP00000018786  alhldsnrlaevrgdql.............................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  ..............................................................................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  vlnlsgncfqevpaslle............................................................
ENSPTRP00000008962  nlcvvllnknqltslhgldgctniqclelshnkitrigysffleenlvdntgfchhlgtstsylslaqvwiptglcws
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  nnniklldksdtayq...............................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  lttlllqhnqikvlteevfiytpllsylrlydnpwhctceietlismlqiprnrnlgnyakcespqeqknkklrqiks
ENSPTRP00000027515  ..............................................................................
ENSPTRP00000008874  pdltg.........................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  ..............................................................................
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  ..............................................................................
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  lirgdamvdgnytlyv..............................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  qikprsfsgltylkslyldgnqlleipqglppslqllsleannifsirkenltelanieilylgqncyyrnpcyvsys
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  gtrlflgyalvife................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  lgpaepp.......................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  etltnlellslsfnslshvppk........................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  rvsfahlslapsfgslvalkeldmhgiffrsldettlrplarlpmlqtlrlqmnfinqaqlgifrafpglryvdlsdn
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  dlsayhaltklildgneieeisglem....................................................
ENSPTRP00000048194  ltg...........................................................................
ENSPTRP00000057473  s.............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  evlnlsnnaihslsldllspksswvkrhrssfrnr...........................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  gish..........................................................................
ENSPTRP00000027517  dvswnslesgrhkenctwv...........................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  dnqieeisglstlrclrvlllgknrikkisnle.............................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  mtiepstflavptleelnlsynnimtvpa.................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  paltsldlsdnpglgergliaalcphkfpaiqnlalrntgmetptgvcaalaaagvqp....................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  idpgkvetltirrlhiprfylfyd......................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  ..............................................................................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  lsglpqgvfgklgslqelfldsnniselppqvfsqlfclerlwlqrnaithlplsifaslgnltflslqwnmlrvlpa
ENSPTRP00000027103  ifgpmpnlrelwlydnhisslpdnvfs...................................................
ENSPTRP00000051281  ..............................................................................
ENSPTRP00000051241  slvevnsgslygltalhqlhlsnnsiarihrkgwsfcqklhelvlsfnnltrldeeslae..................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  glnnmeelelehnnltrvnkgwlyglqmlqqlyvsqnaierispdawefcqrlseldlsynqltrldes.........
ENSPTRP00000060321  prelct........................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000026857  ..............................................................................
ENSPTRP00000017393  nltalsgeslghlrslgalrlrhlaiasledqnfrrlpgllhleidnwplleevaagslrgl................
ENSPTRP00000008774  tklmdgafwglsnmeilqldhnnlteitkgwlygllmlqelhlsqnainrispdawefcqklseldltfnhlsrldds
ENSPTRP00000025115  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000002213  nlstvpglalarlpalvalrlreldigrlpagalrglgqlkeleihlwpslealdpgslvgl................
ENSPTRP00000051339  nltsiptealshlhglivlrlrhlninairdysfkrlyrlkvleishwpyldtmtpnclygl................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  gynrlrslsrnafag...............................................................
ENSPTRP00000047233  rgnriqklpyigvlehigryniyigeaicetpsalygrllketnkqelfpmgtgsdfdvrilppsqlengyttpnght
ENSPTRP00000027104  nplaelpgvlfgemgglqelwlnrtqlrtlpaaafrnlsrlrslgvtlsp............................
ENSPTRP00000035643  nltavptealshlrslislhlkhlninnmpvyafkrlfhlkhleidywplldmmpanslygl................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000061216  mvalrildlsnnnilrisesgfqhlenlaclylgsnnltkvpsnafevlkslrrlslshnpieaiqpf..........
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  ..............................................................................
ENSPTRP00000037431  rieavassslqglrrlrslslqanrvravhaga.............................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  ..............................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  lsgnritevslgalgpa.............................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  vlilssnflrhvpk................................................................
ENSPTRP00000061095  y.............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  lnslkkmanltelelircdleriphsifslhnlqeidlkdnnlktieeii............................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  lkkmmnvaelelqnceleriphaif.....................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  ..............................................................................
ENSPTRP00000007033  ..............................................................................
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  vmlnnlkk......................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  iwldlsqnrlhtllpqtlcn..........................................................
ENSPTRP00000017706  alnslkklaalrelelvacgleriphavfslgalqeldlkdnhlrsieeils..........................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  ..............................................................................
ENSPTRP00000008254  ilegnkisricsplrlkelkilnlsknhisslsenfleacpkvesfsarmnflaampf....................
ENSPTRP00000036082  ..............................................................................
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  nrylqlfknllkleeldisknslsflpsgvfdg.............................................
ENSPTRP00000046894  slstlnllanpfncncylawlgewlrkkrivtgnprcqkpyflkeipiqdvaiqdftcddgnddnscsplsrcptect
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  vdssps........................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  nltrldlslnrlkhipneafln........................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  rlhinapqspfqnlhflqvlnltycfldtsnqhlla..........................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  ..............................................................................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  wipitsltknsdcnflishlywncgleslknlqqlildhnqlintkglcdtptivyldcshnhltdvegvencg....
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  eqlcneeekeqldpkpqvsgrppvikpevdstfchnyvfp......................................
ENSPTRP00000027515  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  ..............................................................................
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  ..............................................................................
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  iekdaflnltklkvlslkdnnvtavptv..................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  risgaseltatmgeadggekvwlqpgdlapapvdtpssedfkpncstln.............................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  ..............................................................................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  glfahtpclvglslthnqle..........................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051281  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000026857  ..............................................................................
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  s.............................................................................
ENSPTRP00000025115  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  ..............................................................................
ENSPTRP00000047233  tqtslhrlvtkppkttnpskisgivagkalsnrnlsqivsyqtrvppltpcpapcfckthpsdlglsvncqekniqsm
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000061216  ..............................................................................
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  ..............................................................................
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  ..............................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000061095  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  ..............................................................................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  ..............................................................................
ENSPTRP00000007033  ..............................................................................
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  ..............................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  ..............................................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  ..............................................................................
ENSPTRP00000008254  ..............................................................................
ENSPTRP00000036082  ..............................................................................
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  cldtvvrcsnkglkvlpkgiprdvte....................................................
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  ..............................................................................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  ..............................................................................
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  ..............................................................................
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                10        20        
                                                                                 |         |        
d2ifga3               ..................................................--------------------...---..
ENSPTRP00000001468  ..................................................-----LVKLRILELRENHLK...TLP..
ENSPTRP00000034204  ..................................................-------HLTELDVSHNRLT...ALG..
ENSPTRP00000050882  ..................................................--------------------...---..
ENSPTRP00000027103  ..................................................--------------------...---..
ENSPTRP00000051281  ..................................................----YLANLTELDLSQNSFS...DAR..
ENSPTRP00000051241  ..................................................-----LSSLSVLRLSHNSIS...HIA..
ENSPTRP00000049843  ..................................................--FRGLAALQYLYLQDNALQ...ALP..
ENSPTRP00000028996  ..................................................--FGRLTKLQILELRENQLK...MLP..
ENSPTRP00000008989  ..................................................-AFQGMKKLSYIRIADTNIT...SIP..
ENSPTRP00000051884  ..................................................-AFVGLSLLERLNLGDNRVT...HIA..
ENSPTRP00000060321  ..................................................-----LENLQVLDLSENQLQ...KIS..
ENSPTRP00000029913  ..................................................-AFQDLKQLERLRLNKNKLQ...VLP..
ENSPTRP00000026857  ..................................................------TELEEVHLENNQIE...EIP..
ENSPTRP00000017393  ..................................................-------NLTSLSVTHTNIT...AVP..
ENSPTRP00000008774  ..................................................--FLGLSLLSTLHIGNNRVS...YIA..
ENSPTRP00000025115  ..................................................---QQLFNLTELDFSQNNFT...NIK..
ENSPTRP00000005186  ..................................................----ELCNLITLDVAHNQLE...H--..
ENSPTRP00000001472  ..................................................----LLPALTVLDIHDNQLT...SLP..
ENSPTRP00000002213  ..................................................-------NLSSLAITRCNLS...SVP..
ENSPTRP00000051339  ..................................................-------NLTSLSITHCNLT...AVP..
ENSPTRP00000060625  ..................................................-AFEGLVNLRYLNLGMCNLK...DIP..
ENSPTRP00000020782  ..................................................--------------------...---..
ENSPTRP00000047233  selipkplnakklhvngnsikdvdvsdftdfegldllhlgsnqitvikgd-VFHNLTNLRRLYLNGNQIE...RLY..
ENSPTRP00000027104  ..................................................-----------------RLS...ALP..
ENSPTRP00000035643  ..................................................-------NLTSLSITNTNLS...TVP..
ENSPTRP00000049653  ..................................................-AFRGLGRLLLLNLASNHLR...ELP..
ENSPTRP00000019491  ..................................................-AFEGLVNLRYLNLGMCNLK...DIP..
ENSPTRP00000029568  ..................................................------SQLTWLHLDHNQIS...TVK..
ENSPTRP00000042428  ..................................................--------------------...GVP..
ENSPTRP00000061216  ..................................................-AFKGLANLEYLLLKNSRIR...NVT..
ENSPTRP00000033656  ..................................................-AFEGLFNLKYLNLGMCNIK...DMP..
ENSPTRP00000014575  ..................................................-VFGGLHSLQYLYLQDNHIE...YLQ..
ENSPTRP00000003094  ..................................................---NNLPALQAMTLAFNRIS...HIP..
ENSPTRP00000015086  ..................................................--------------------...---..
ENSPTRP00000006103  ..................................................-AFEGLSNLRYLNLAMCNLR...EIP..
ENSPTRP00000015965  ..................................................--FRAMPNLVSLHLQHCQIR...EVA..
ENSPTRP00000036080  ..................................................-----PLDTRMLDLQNNKIK...EIK..
ENSPTRP00000008874  ..................................................--LQNLRSLQSLRLDANHIS...YVP..
ENSPTRP00000047686  ..................................................----FPVNLTGLDLSQNNLS...SVT..
ENSPTRP00000037431  ..................................................--FGDCGVLEHLLLNDNLLA...ELP..
ENSPTRP00000060321  ..................................................----CLGNLEILSLGKNKLR...HIP..
ENSPTRP00000004388  ..................................................--FKGLNQLTWLYLDHNHIS...NID..
ENSPTRP00000022464  ..................................................-----LTRLKKLFLVNNKIS...KIE..
ENSPTRP00000020795  ..................................................--FTGLMQLTWLYLDHNHIC...SVQ..
ENSPTRP00000049653  ..................................................------RELEKLHLDRNQLR...EVP..
ENSPTRP00000035343  ..................................................----NLANLVTLELRENLLK...SLP..
ENSPTRP00000001283  ..................................................---HLPPALYKLHLKNNKLE...KIP..
ENSPTRP00000061095  ..................................................----TLPSLRRLNLSSNQIT...ELS..
ENSPTRP00000048194  ..................................................---RGLSALQSLRLDANHIT...SVP..
ENSPTRP00000036665  ..................................................--------------------...---..
ENSPTRP00000011222  ..................................................-AFQNLTSLERLIVDGNLLTnk.GIA..
ENSPTRP00000047055  ..................................................--FKNYHDLQKLYLQNNKIT...SIS..
ENSPTRP00000001626  ..................................................----SLSNLQELDLKSNNIR...TIE..
ENSPTRP00000017670  ..................................................--------------------...---..
ENSPTRP00000053783  ..................................................-----PPDTVGLYVFENGIT...MLD..
ENSPTRP00000012792  ..................................................--------------------...---..
ENSPTRP00000013006  ..................................................-AFRGLGSLRELVLAGNRLA...YLQ..
ENSPTRP00000042859  ..................................................-----PPRIHYLYLQNNFIT...ELP..
ENSPTRP00000007033  ..................................................--------------------...---..
ENSPTRP00000042754  ..................................................-----SPDTTLLDLQNNDIS...ELR..
ENSPTRP00000022750  ..................................................---QGLTSLKRLVLDGNLLNnh.GLG..
ENSPTRP00000001624  ..................................................-----MTNLTELELVHCDLE...RIP..
ENSPTRP00000017533  ..................................................----NFTLLRTLDLGENQLE...TLP..
ENSPTRP00000031252  ..................................................---GNLYNLASLELRENLLT...YLP..
ENSPTRP00000036079  ..................................................--FPLPKSLERLLLGYNEIS...KLQ..
ENSPTRP00000003137  ..................................................-----PRSLRELHLDHNQIS...RVP..
ENSPTRP00000009804  ..................................................--------------------...---..
ENSPTRP00000059190  ..................................................---RGPVNLQHLILSGNQLG...RIA..
ENSPTRP00000018046  ..................................................-AFRGSEAIATLSLSNNRLS...YLP..
ENSPTRP00000048004  ..................................................----LPHTLEELRLDDNRIS...TIP..
ENSPTRP00000041179  ..................................................----LPKSLQVLRLRDNYLA...YFK..
ENSPTRP00000017706  ..................................................--FQHCRKLVTLRLWHNQIA...YVP..
ENSPTRP00000053173  ..................................................----TLPALTVLDVSFNRLT...SLP..
ENSPTRP00000008987  ..................................................-----PKSLEDLQLTHNKIT...KLG..
ENSPTRP00000008254  ..................................................----LPPSMTILKLSQNKFS...CIP..
ENSPTRP00000036082  ..................................................------PQITSLELTGNSIA...SIP..
ENSPTRP00000060795  ..................................................----NFTLLRTLDLGENQLE...TLP..
ENSPTRP00000032807  ..................................................--------------------...---..
ENSPTRP00000055467  ..................................................---ANMTSLVDLTLSRNTIS...FIT..
ENSPTRP00000022026  ..................................................--------------------...---..
ENSPTRP00000047494  ..................................................----MPPNLKNLSLAKNGLK...SFS..
ENSPTRP00000046894  ..................................................--------------------...---..
ENSPTRP00000008986  ..................................................-----PSRIWYLYLQNNLIE...TIP..
ENSPTRP00000047783  ..................................................-------DTAHLDLSSNRLE...MVN..
ENSPTRP00000014225  ..................................................--------ITYLNLRHNFMQ...LER..
ENSPTRP00000026754  ..................................................--FSDLQALQVLKMSYNKVR...KLQ..
ENSPTRP00000028569  ..................................................-PFQPLRNLTILDLSNNNIA...NIN..
ENSPTRP00000022026  ..................................................--------------------...---..
ENSPTRP00000028569  ..................................................--FTRYSQLTSLDVGFNTIS...KLE..
ENSPTRP00000017119  ..................................................------TSVEVLDVQHNQLL...ELP..
ENSPTRP00000047493  ..................................................----LPASLTELHINDNMLK...FFN..
ENSPTRP00000018633  ..................................................---ADLRALRALHLDGNRLT...SLG..
ENSPTRP00000020457  ..................................................-----PRNAVELRFVLTKLR...VIQ..
ENSPTRP00000035431  ..................................................-AFRAQPRLLELALTSNRLR...GLR..
ENSPTRP00000017670  ..................................................--------------------...---..
ENSPTRP00000029007  ..................................................----GLPVLRHLNLKGNHFQdgtITK..
ENSPTRP00000022692  ..................................................-----LVTLEVLDLSGTFLE...RVE..
ENSPTRP00000032807  ..................................................--------------------...---..
ENSPTRP00000003935  ..................................................----SLQKLKHLNLGMNRLN...TLP..
ENSPTRP00000030995  ..................................................--FLDLESLRSLHLDSNRLP...SLG..
ENSPTRP00000029913  ..................................................-IFKKLPNLRKINLSNNKIK...EVR..
ENSPTRP00000014225  ..................................................--------LEVLDLQHNALT...RLP..
ENSPTRP00000005186  ..................................................----GLVSLEVLILSNNLLK...KLP..
ENSPTRP00000037057  ..................................................---RDLSSLQVFKFSYNKLR...VIT..
ENSPTRP00000015508  ..................................................--------------------...---..
ENSPTRP00000012792  ..................................................--------------------...---..
ENSPTRP00000015508  ..................................................--------------------...---..
ENSPTRP00000018786  ..................................................---RGLGNLRHLILGNNQIR...RVE..
ENSPTRP00000025606  ..................................................-----FQAMRILDLPKNQIS...HLP..
ENSPTRP00000012830  ..................................................----ISCQITELDLSANCLA...TLP..
ENSPTRP00000034664  ..................................................-AFKKLKNLNTLLLNNNHIR...KIS..
ENSPTRP00000026322  ..................................................-----LRALQTLSLGGNQLQ...SIP..
ENSPTRP00000008962  ..................................................-------LLQILKLQGNYLS...ELP..
ENSPTRP00000046894  ..................................................-AFSPYKKLRRIDLSNNQIS...ELA..
ENSPTRP00000031403  ..................................................------AELAALNLSGSRLD...EVR..
ENSPTRP00000015314  ..................................................------WNLKYLDVSKNMLE...KVV..
ENSPTRP00000027161  ..................................................----DLADLRFLDMSQNQFQ...YLP..
ENSPTRP00000044034  ..................................................-AFADVTQVTSLWLAHNEVR...TVE..
ENSPTRP00000033466  ..................................................--------IQTLDCKRKELK...KVP..
ENSPTRP00000027515  ..................................................------PATTTLDLSYNLLF...QLQ..
ENSPTRP00000008874  ..................................................-----TANLESLTLTGAQIS...SLP..
ENSPTRP00000001496  ..................................................--FSKLHSLQVLVLSNNALR...TLR..
ENSPTRP00000000339  ..................................................--FIFYGDLVYLDFRNNSLR...SLE..
ENSPTRP00000027516  ..................................................------QKTTILNISQNYIS...ELW..
ENSPTRP00000049501  ..................................................----GLSEVQKLNLSHNQLR...VLP..
ENSPTRP00000007737  ..................................................-AFANLSSLQRLDLSNNFLD...RLP..
ENSPTRP00000027179  ..................................................----DLTDTTRADLSRNRLS...EIP..
ENSPTRP00000033370  ..................................................------------DLSRNRFP...EVP..
ENSPTRP00000011913  ..................................................-----TSNLRTIDLSNNKIE...SLP..
ENSPTRP00000041364  ..................................................-------ELVKLYLSDNHLN...SLP..
ENSPTRP00000012439  ..................................................-AFREVPLLQSLWLAHNEIR...TVA..
ENSPTRP00000002493  ..................................................--------------------...---..
ENSPTRP00000009963  ..................................................-----LSDTVQADLSKNRLV...EVP..
ENSPTRP00000047494  ..................................................----LPSTLTELYLYNNMIA...KIQ..
ENSPTRP00000029007  ..................................................--FSRLMNLTFLDLTRCQIN...WIH..
ENSPTRP00000012803  ..................................................----GLQYLERLYMKRNSLT...SLP..
ENSPTRP00000002493  ..................................................--------------------...---..
ENSPTRP00000006306  ..................................................----CYMELQVLDLHNNSLM...ELP..
ENSPTRP00000052915  ..................................................----GLPQLQSLNLSGNRLR...ELP..
ENSPTRP00000047302  ..................................................-------------LSRNRFT...EIP..
ENSPTRP00000031252  ..................................................-----LLHLKDLWLDGNQLS...ELP..
ENSPTRP00000027465  ..................................................--------TVTLILSNNKIS...ELK..
ENSPTRP00000026832  ..................................................-AFINLPNLKSLFLNGNDIE...KLT..
ENSPTRP00000008307  ..................................................--FSTTPNLKCLDLSSNKLK...TVK..
ENSPTRP00000027477  ..................................................---------SSLSLVNGTFS...EIK..
ENSPTRP00000047493  ..................................................----LPSSLRKLFLSNTQIK...YIS..
ENSPTRP00000001819  ..................................................-AFSPVPNLRYLDLSSNQLR...TLD..
ENSPTRP00000010126  ..................................................-AFGDLTNLRRLYLNGNRIE...RLS..
ENSPTRP00000041179  ..................................................---------FTLDLSRNNLV...TVQ..
ENSPTRP00000036986  ..................................................-AFAGAGALQRLDLRENGLH...SVH..
ENSPTRP00000033769  ..................................................-----CNNLIHLSLANNKIT...TIN..
ENSPTRP00000048194  ..................................................-----TVHLESLTLTGTKIS...SIP..
ENSPTRP00000057473  ..................................................--FMNLTRLQKLYLNGNHLT...KLS..
ENSPTRP00000002701  ..................................................----LLSDLVYLDCQNNRIR...EVM..
ENSPTRP00000010123  ..................................................--FKNLLDLRWLYMDSNYLD...TLS..
ENSPTRP00000017119  ..................................................--------LKSLNLSNNHLG...DFP..
ENSPTRP00000004835  ..................................................------PDVISLSFVRSGFT...EIS..
ENSPTRP00000025772  ..................................................--FANASGLRLLDLSSNTLR...ALG..
ENSPTRP00000010123  ..................................................-AFLGLQLVKRLHINNNKIK...SFR..
ENSPTRP00000011064  ..................................................----MLANCEKLSLSTNCIE...KIA..
ENSPTRP00000027161  ..................................................--FQEQGHLRSLVLGDNRLS...EKYre
ENSPTRP00000010126  ..................................................-AFHGLRGLRRLHLNNNKLE...LLR..
ENSPTRP00000054912  ..................................................--------VISLTLVNAAFS...EIQ..
ENSPTRP00000034515  ..................................................---------VTLLLSNNKIT...GLR..
ENSPTRP00000018540  ..................................................------PTLLSLSLVRTGVT...QLK..
ENSPTRP00000057473  ..................................................-AFNGLGLLKQLHINHNSLE...ILK..
ENSPTRP00000027614  ..................................................-----FPLLKVLILQRNKLS...DTP..
ENSPTRP00000024687  ..................................................------GNLTDLNLTKNEIS...YIE..
ENSPTRP00000025967  ..................................................-AFRSVPWLMTLNLSNNSLS...NLA..
ENSPTRP00000026832  ..................................................-AFNGLKILKRLYLHENKLD...VFR..
ENSPTRP00000007855  ..................................................------PRLETLNLKGNSIH...MVT..
ENSPTRP00000027517  ..................................................------ESIVVLNLSSNMLT...DSV..
ENSPTRP00000001283  ..................................................--FRKLRLLRSLDLSGNRLH...TLP..
ENSPTRP00000020451  ..................................................-------GLTRLSLAYLPVK...VIP..
ENSPTRP00000006511  ..................................................--------------------...---..
ENSPTRP00000012374  ..................................................----NLKSLDVLDLHGNQIT...KIE..
ENSPTRP00000056400  ..................................................--------------------...---..
ENSPTRP00000053355  ..................................................-AFYYLVELQYLWVTYNSVA...SID..
ENSPTRP00000041711  ..................................................-----FENLRKLQLDNNIIE...KIE..
ENSPTRP00000038049  ..................................................--------------------...---..
ENSPTRP00000050575  ..................................................--FINMSTLEYLWLNFNNIS...VIH..
ENSPTRP00000008984  ..................................................--FASLSDLKRIDLTSNLIS...EID..
ENSPTRP00000049006  ..................................................-----CVKLEVLNLSYNLIG...KIE..
ENSPTRP00000060814  ..................................................-----------LDLSKMGIT...TFP..
ENSPTRP00000004277  ..................................................-----------LDLSKMGIT...TFP..
ENSPTRP00000027103  ..................................................-PFLNISALIALRIEKNELS...RIM..
ENSPTRP00000051190  ..................................................-----LVHLEWLNLAGNNLK...AME..
ENSPTRP00000055643  ..................................................---SLPPSTQRLFLQNNLIR...TLR..
ENSPTRP00000001472  ..................................................-----LQKLTFLDLRNNFLN...SLP..
ENSPTRP00000004702  ..................................................-AFRPLGRLEQLWLPYNALS...ELN..
ENSPTRP00000013006  ..................................................-----LAELLELDLTSNQLT...HLP..
ENSPTRP00000043808  ..................................................---------KVLIVHTNHLT...SLL..
ENSPTRP00000041179  ..................................................----LPKSLISLSLSHTNIL...MLD..
ENSPTRP00000035210  ..................................................-------SLEELSLHQQEIE...RLE..
ENSPTRP00000011214  ..................................................----LPPSTQTLKLIETHLR...TIP..
ENSPTRP00000010702  ..................................................---LCLKSLRKLDLSHNHIK...KLP..
ENSPTRP00000041754  ..................................................---------RELDLRGYKIP...VIE..
ENSPTRP00000050767  ..................................................----RLQKLKHLNLGMNRLN...ISP..
ENSPTRP00000034871  ..................................................------------NLHCNNIS...KIE..
ENSPTRP00000036180  ..................................................------VNLEFLSLINVGLI...SVS..
ENSPTRP00000039448  ..................................................-----LNKLKKLELSDNRVS...GGL..
ENSPTRP00000035343  ..................................................--------LTDLLLSQNLLR...RLP..
ENSPTRP00000035630  ..................................................-----YFLLTELYLIENKVT...ILH..
ENSPTRP00000024055  ..................................................--------------------...---..
ENSPTRP00000046894  ..................................................--------------------...---..
ENSPTRP00000015962  ..................................................----------ELDLSLSDLN...EVP..
ENSPTRP00000036078  ..................................................--FADIPNLRRLDFTGNLIE...DIE..
ENSPTRP00000025359  ..................................................------------TCSNANLK...EIP..
ENSPTRP00000044819  ..................................................------RRTAYLYARFNRIS...RIR..
ENSPTRP00000002116  ..................................................-------ELEFLSMANVELS...SLA..
ENSPTRP00000053040  ..................................................------------RCSQAGLS...AVP..
ENSPTRP00000007526  ..................................................-------HVSELDLSDNKLE...DWHev
ENSPTRP00000024064  ..................................................-----------VFCSLRGLQ...EVP..
ENSPTRP00000034772  ..................................................---QCLKKITHINFSDKNID...AIE..
ENSPTRP00000030128  ..................................................--------------------...---..
ENSPTRP00000048131  ..................................................----------ELFLSKKELT...EVV..
ENSPTRP00000044257  ..................................................--------------------...-AD..
ENSPTRP00000003094  ..................................................-------------CSELGLS...AVP..
ENSPTRP00000015328  ..................................................---------TTLNFQGNYIS...YID..
ENSPTRP00000048337  ..................................................----HLPNLDQLKLNGSHLG...SLR..
ENSPTRP00000007000  ..................................................-AFHMFPALKELDLAFNGIK...TIY..
ENSPTRP00000040371  ..................................................--------------------...---..
ENSPTRP00000009462  ..................................................------LRLEELVLSANRIK...EVD..
ENSPTRP00000015329  ..................................................-------------FQGNYIS...YID..
ENSPTRP00000027832  ..................................................--------------------...---..
ENSPTRP00000052190  ..................................................--------------------...---..
ENSPTRP00000015874  ..................................................--FHTLDELQTVRLDREGIT...TIR..
ENSPTRP00000046801  ..................................................--------IHLITLANNELK...SLT..
ENSPTRP00000014047  ..................................................--------------------...---..
ENSPTRP00000061088  ..................................................--------FTILNFQGNYIS...YID..
ENSPTRP00000050620  ..................................................--------------------...---..
ENSPTRP00000010544  ..................................................-----------LHLAHKDLT...VLC..
ENSPTRP00000027517  ..................................................-----PLKTKVLDMSQNYIA...ELQ..
ENSPTRP00000028616  ..................................................--------------------...---..
ENSPTRP00000027104  ..................................................-----PTNLTHILLFGMGRG...VLQ..
ENSPTRP00000005408  ..................................................-----------LDLSESGLC...RLE..
ENSPTRP00000045137  ..................................................--------------------...---..
ENSPTRP00000043320  ..................................................---------KELVLGNSRSN...EGK..
ENSPTRP00000028996  ..................................................---------TTLDYSHCSLE...QVP..
ENSPTRP00000015086  ..................................................---------RGVDLSGNDFK...GGYf.
ENSPTRP00000036008  ..................................................--------------------...---..
ENSPTRP00000047976  ..................................................--------------------...---..
ENSPTRP00000060126  ..................................................--------------------...---..
ENSPTRP00000042428  ..................................................--------------------...---..
ENSPTRP00000057066  ..................................................--------------------...---..
ENSPTRP00000060538  ..................................................-------------------E...RIP..
ENSPTRP00000047493  ..................................................--------------------...---..
ENSPTRP00000034915  ..................................................--------------------...---..
ENSPTRP00000018267  ..................................................--------------------...---..
ENSPTRP00000048004  ..................................................---VCRCDNGFIYCNDRGLT...SIP..
ENSPTRP00000051241  ..................................................--------------------...---..
ENSPTRP00000061058  ..................................................--------------------...---..
ENSPTRP00000047493  ..................................................--------------------...---..
ENSPTRP00000028379  ..................................................--------------------...---..
ENSPTRP00000022750  ..................................................--SVCRCDAGFIYCNDRFLT...SIP..
ENSPTRP00000015475  ..................................................----------ILNFQGNYIS...YID..
ENSPTRP00000028379  ..................................................--------------------...---..


                                   30         40                                                    
                                    |          |                                                    
d2ifga3               .-...--..LPG..A.ENLTELYIENQQHLQH..............................................
ENSPTRP00000001468  .K...S-..MHK..L.AQLERLDLGNNEFGEL..............................................
ENSPTRP00000034204  .A...EV..VSA..L.RELRKLNVSHNQLPAL..............................................
ENSPTRP00000050882  .-...--..---..-.-----TVAEGAFAHLS..............................................
ENSPTRP00000027103  .-...--..---..-.----------------..............................................
ENSPTRP00000051281  .D...CD..FHA..L.PQLLSLHLEENQLTRL..............................................
ENSPTRP00000051241  .E...GA..FKG..L.RSLRVLDLDHNEISGTie............................................
ENSPTRP00000049843  .D...DT..FRD..L.GNLTHLFLHGNRISSV..............................................
ENSPTRP00000028996  .K...T-..MNR..L.TQLERLDLGSNEFTEV..............................................
ENSPTRP00000008989  .Q...GL..P--..-.PSLTELHLDGNKISRV..............................................
ENSPTRP00000051884  .D...GV..FRF..L.SNLQTLDLRNNEISWAie............................................
ENSPTRP00000060321  .S...D-..ICN..L.KGIQKLNLSSNQFIHFpielcqlqsleqlnisqikgrklt......................
ENSPTRP00000029913  .E...LL..FQS..T.PKLTRLDLSENQIQGI..............................................
ENSPTRP00000026857  .Q...E-..IQR..L.KNIRVLYLDKNNLRSL..............................................
ENSPTRP00000017393  .A...AA..LRH..Q.AHLTCLNLSHNPISTV..............................................
ENSPTRP00000008774  .D...CA..FRG..L.SSLKTLDLKNNEISWTie............................................
ENSPTRP00000025115  .E...VG..LAN..L.TQLTTLHLEENQITEM..............................................
ENSPTRP00000005186  .-...--..---..-.----------------..............................................
ENSPTRP00000001472  .S...A-..IRE..L.ENLQKLNVSHNKLKIL..............................................
ENSPTRP00000002213  .F...QA..LYH..L.SFLRVLDLSQNPISAI..............................................
ENSPTRP00000051339  .Y...LA..VRH..L.VYLRFLNLSYNPISTI..............................................
ENSPTRP00000060625  .N...--..LTA..L.VRLEELELSGNRLDLI..............................................
ENSPTRP00000020782  .-...--..---..-.----------------..............................................
ENSPTRP00000047233  .P...EI..FSG..L.HNLQYLYLEYNLIKEI..............................................
ENSPTRP00000027104  .Q...GA..FQG..L.GELQVLALHSNGLTAL..............................................
ENSPTRP00000035643  .F...LA..FKH..L.VYLTHLNLSYNPISTI..............................................
ENSPTRP00000049653  .Q...EA..LDG..L.GSLRRLELEGNALEEL..............................................
ENSPTRP00000019491  .N...--..LTA..L.VRLEELELSGNRLDLI..............................................
ENSPTRP00000029568  .E...DA..FQG..L.YKLKELILSSNKIFYL..............................................
ENSPTRP00000042428  .D...DI..F-K..L.DDLSVLDLSHNQLTEC..............................................
ENSPTRP00000061216  .R...DG..FSG..I.NNLKHLILSHNDLENL..............................................
ENSPTRP00000033656  .N...--..LTP..L.VGLEELEMSGNHFPEI..............................................
ENSPTRP00000014575  .D...GI..FVD..L.VNLSHLFLHGNKLWSL..............................................
ENSPTRP00000003094  .D...YA..FQN..L.TSLVVLHLHNNRIQHL..............................................
ENSPTRP00000015086  .D...DI..F-K..L.DDLSVLDLSHNQLTEC..............................................
ENSPTRP00000006103  .N...--..LTP..L.IKLDELDLSGNHLSAI..............................................
ENSPTRP00000015965  .A...GA..FRG..L.KQLIYLYLSHNDIRVL..............................................
ENSPTRP00000036080  .E...ND..FKG..L.TSLYGLILNNNKLTKI..............................................
ENSPTRP00000008874  .P...SC..FSG..L.HSLRHLWLDDNALTEI..............................................
ENSPTRP00000047686  .N...IN..VKK..M.PQLLSVYLEENKLTEL..............................................
ENSPTRP00000037431  .A...DA..FRG..L.RRLRTLNLGGNALDRV..............................................
ENSPTRP00000060321  .D...T-..LPS..L.KNLRVLNLEYNQLTIF..............................................
ENSPTRP00000004388  .E...NA..FNG..I.RRLKELILSSNRISYF..............................................
ENSPTRP00000022464  .N...--..LSN..L.HQLQMLELGSNRIRAI..............................................
ENSPTRP00000020795  .G...DA..FQK..L.RRVKELTLSSNQITQL..............................................
ENSPTRP00000049653  .T...GA..LEG..L.PALLELQLSGNPLRAL..............................................
ENSPTRP00000035343  .A...S-..LSF..L.VKLEQLDLGGNDLEVL..............................................
ENSPTRP00000001283  .P...GA..FSE..L.SSLRELYLQNNYLTDEg.............................................
ENSPTRP00000061095  .L...C-..IDQ..W.VHVETLNLSRNQLTSL..............................................
ENSPTRP00000048194  .E...DS..FEG..L.VQLRHLWLDDNSLTEV..............................................
ENSPTRP00000036665  .-...--..---..-.----------------..............................................
ENSPTRP00000011222  .E...GT..FSH..L.TKLKEFSIVRNSLSHP..............................................
ENSPTRP00000047055  .I...YA..FRG..L.NSLTKLYLSHNRITFL..............................................
ENSPTRP00000001626  .Ei..IS..FQH..L.KRLTCLKLWHNKIVTI..............................................
ENSPTRP00000017670  .-...--..---..-.----------------..............................................
ENSPTRP00000053783  .A...GS..FAG..L.PGLQLLDLSQNQIASL..............................................
ENSPTRP00000012792  .-...--..---..-.----------------..............................................
ENSPTRP00000013006  .P...AL..FSG..L.AELRELDLSRNALRAI..............................................
ENSPTRP00000042859  .V...ES..FQN..A.TGLRWINLDNNRIRKI..............................................
ENSPTRP00000007033  .-...GA..FQA..L.THLEHLSLAHNRLAMAtalsagglgplphvtsldlsgnslysg...................
ENSPTRP00000042754  .K...DD..FKG..L.QHLYALVLVNNKISKI..............................................
ENSPTRP00000022750  .D...KV..FFN..L.VNLTELSLVRNSLTAA..............................................
ENSPTRP00000001624  .H...AV..F-S..L.LSLQELDLKENNLKSI..............................................
ENSPTRP00000017533  .P...DL..LRG..P.LQLERLHLEGNKLQVL..............................................
ENSPTRP00000031252  .D...S-..LTQ..L.RRLEELDLGNNEIYNL..............................................
ENSPTRP00000036079  .A...NA..MDG..L.VNLTMLDLCYNYLHDSl.............................................
ENSPTRP00000003137  .N...NA..LEG..L.ENLTALYLQHNEIQEV..............................................
ENSPTRP00000009804  .-...-V..FIK..Y.TKLKKIFLQHNCIRHI..............................................
ENSPTRP00000059190  .P...GA..FDDf.L.ESLEDLDLSYNNLRQV..............................................
ENSPTRP00000018046  .P...NL..P--..-.PSLERLHLQNNLISKV..............................................
ENSPTRP00000048004  .L...HA..FKG..L.NSLRRLVLDGNLLANQriaddtfsrlqnltelslvrnsl.......................
ENSPTRP00000041179  .W...WS..LHF..L.PKLEVLDLAGNQLKAL..............................................
ENSPTRP00000017706  .E...H-..VRK..L.RSLEQLYLSYNKLETL..............................................
ENSPTRP00000053173  .L...GA..LRG..L.GELQELYLKGNELKTL..............................................
ENSPTRP00000008987  .S...--..FEG..L.VNLTFIHLQHNRLKED..............................................
ENSPTRP00000008254  .E...AI..L-N..L.PHLRSLDMSSNDIQYL..............................................
ENSPTRP00000036082  .D...EA..FNG..L.PNLERLDLSKNNITSSg.............................................
ENSPTRP00000060795  .P...DL..LRG..P.LQLERLHLEGNKLQVL..............................................
ENSPTRP00000032807  .-...--..---..-.----------------..............................................
ENSPTRP00000055467  .P...HA..FAD..L.RNLRALHLNSNRLTKI..............................................
ENSPTRP00000022026  .-...--..---..-.----------------..............................................
ENSPTRP00000047494  .W...NK..LQC..L.KNLETLDLSHNQLTTV..............................................
ENSPTRP00000046894  .-...--..---..-.----------------..............................................
ENSPTRP00000008986  .E...KP..FEN..A.TQLRWINLNKNKITNYg.............................................
ENSPTRP00000047783  .E...SV..LAGpgY.TTLAGLDLSHNLLTSI..............................................
ENSPTRP00000014225  .PgglDT..LYK..F.SQLKGLNLSHNKLGLF..............................................
ENSPTRP00000026754  .K...DT..FYG..L.RSLTRLHMDHNNIEFI..............................................
ENSPTRP00000028569  .D...DM..LEG..L.EKLEILDLQHNNLARLwkhanpggpvyflkglshlhilnlesngfde...............
ENSPTRP00000022026  .-...--..---..-.----------------..............................................
ENSPTRP00000028569  .P...EL..CQK..L.PMLKVLNLQHNELSQL..............................................
ENSPTRP00000017119  .P...NL..LMK..A.DSLRFLNASANKLESL..............................................
ENSPTRP00000047493  .W...TL..LQQ..F.PRLELLDLRGNKLLFL..............................................
ENSPTRP00000018633  .E...GQ..LRG..L.VNLRHLILSNNQLAAL..............................................
ENSPTRP00000020457  .K...GA..FSG..F.GDLEKIEISQNDVLEV..............................................
ENSPTRP00000035431  .S...GA..FVG..L.AQLRVLYLAGNQLARL..............................................
ENSPTRP00000017670  .-...--..---..-.----------------..............................................
ENSPTRP00000029007  .T...NL..LQT..V.GSLEVLILSSCGLLSI..............................................
ENSPTRP00000022692  .S...GW..IRD..L.PKLTSLYLRKMPRLTT..............................................
ENSPTRP00000032807  .-...--..---..-.----------------..............................................
ENSPTRP00000003935  .R...G-..FGS..L.PALEVLDLTYNNLSEN..............................................
ENSPTRP00000030995  .E...DT..LRG..L.VNLQHLIVNNNQLGGI..............................................
ENSPTRP00000029913  .E...GA..FDG..A.ASVQELMLTGNQLETV..............................................
ENSPTRP00000014225  .D...TL..FSK..A.LNLRYLNASANSLESLpsactgeeslsmlqllcltnnlltd.....................
ENSPTRP00000005186  .H...G-..LGN..L.RKLRELDLEENKLESL..............................................
ENSPTRP00000037057  .G...QT..LQG..L.SNLMRLHIDHNKIEFI..............................................
ENSPTRP00000015508  .-...--..---..-.----------------..............................................
ENSPTRP00000012792  .-...--..---..-.----------------..............................................
ENSPTRP00000015508  .-...--..---..-.-------------SWL..............................................
ENSPTRP00000018786  .S...AA..FDAf.L.STVEDLDLSYNNLEAL..............................................
ENSPTRP00000025606  .A...E-..IGC..L.KNLKELNVSFNYLKSI..............................................
ENSPTRP00000012830  .S...VI..PWG..L.INLRKLNLSDNHLGELpg............................................
ENSPTRP00000034664  .R...NA..FEG..L.ENLLYLYLYKNEIHAL..............................................
ENSPTRP00000026322  .A...E-..IEN..L.QSLECLYLGGNFIKEI..............................................
ENSPTRP00000008962  .S...--..LEN..L.VLLRELHLDDNSISTV..............................................
ENSPTRP00000046894  .P...DA..FQG..L.RSLNSLVLYGNKITEL..............................................
ENSPTRP00000031403  .A...GA..FEH..L.PSLRQLDLSHNPLADLspfafsgsnasvsapsplvelilnhivppedeqqnrsfegmvvaal
ENSPTRP00000015314  .L...-I..KNT..L.RSLEVLNLSSNKLWTV..............................................
ENSPTRP00000027161  .D...GF..LRK..M.PSLSHLNLNQNCLMTL..............................................
ENSPTRP00000044034  .P...GA..LAV..L.SQLKNLDLSHNFISSF..............................................
ENSPTRP00000033466  .N...NI..P--..-.PDIVKLDLSYNKINQL..............................................
ENSPTRP00000027515  .S...SD..FHS..V.SKLRVLILCHNRIQQL..............................................
ENSPTRP00000008874  .Q...TV..CNQ..L.PNLQVLDLSYNLLEDL..............................................
ENSPTRP00000001496  .G...SW..FRN..T.SGLTRLQLDGNQITNL..............................................
ENSPTRP00000000339  .E...GT..FSG..S.AKLVFLDLSYNNLTQL..............................................
ENSPTRP00000027516  .T...SD..ILS..L.SKLRILIISHNRIQYL..............................................
ENSPTRP00000049501  .P...E-..VGK..L.TRIVVLNLCGNRLKSLprevsllqclkvlfvnmnclt.........................
ENSPTRP00000007737  .R...SI..FGD..L.TNLTELQLRNNSIRTL..............................................
ENSPTRP00000027179  .I...EA..C-H..F.VSLENLNLYQNCIRYI..............................................
ENSPTRP00000033370  .E...AA..-CQ..L.VSLEGLSLYHNCLRCL..............................................
ENSPTRP00000011913  .P...LL..IGK..F.TLLKSLSLNNNKLTVL..............................................
ENSPTRP00000041364  .P...E-..LGQ..L.QNLQILALDFNNFKAL..............................................
ENSPTRP00000012439  .A...GA..LAS..L.SHLKSLDLSHNLISDF..............................................
ENSPTRP00000002493  .-...--..---..-.----------------..............................................
ENSPTRP00000009963  .M...E-..LCH..F.VSLEILNLYHNCIRVI..............................................
ENSPTRP00000047494  .E...DD..FNN..L.NQLQILDLSGNCPRCYnapfpctpcknnsplq..............................
ENSPTRP00000029007  .E...DT..FQS..H.HQLSTLVLTGNPLIFM..............................................
ENSPTRP00000012803  .E...NL..AQK..L.PNLVELYLHSNNIVVV..............................................
ENSPTRP00000002493  .-...--..---..-.----------------..............................................
ENSPTRP00000006306  .R...GL..FLH..A.KRLAHLDLSYNNFSHV..............................................
ENSPTRP00000052915  .A...DL..ARC..A.PRLQSLNLTGNCLDSF..............................................
ENSPTRP00000047302  .S...DV..W-L..F.APLETLNLYHNCIKTI..............................................
ENSPTRP00000031252  .Q...E-..IGN..L.KNLLCLDVSENRLERL..............................................
ENSPTRP00000027465  .N...GS..FSG..L.SLLERLDLRNNLISSI..............................................
ENSPTRP00000026832  .P...GM..FRG..L.QSLHYLYFEFNVIREI..............................................
ENSPTRP00000008307  .N...AV..FQE..L.KVLEVLLLYNNHISYL..............................................
ENSPTRP00000027477  .D...RM..FSH..L.PSLQLLLLNSNSFTII..............................................
ENSPTRP00000047493  .E...ED..FKG..L.INLTLLDLSGNCPRCFnapfpcvpcdggasin..............................
ENSPTRP00000001819  .E...FL..FSD..L.QVLEVLLLYNNHIMAV..............................................
ENSPTRP00000010126  .P...EL..FYG..L.QSLQYLFLQYNLIREI..............................................
ENSPTRP00000041179  .P...EM..FAQ..L.SHLQCLRLSHNCISQA..............................................
ENSPTRP00000036986  .V...RA..FWG..L.GALQLLDLSANQLEAL..............................................
ENSPTRP00000033769  .G...LN..---..K.LPIKILCLSNNQIEMI..............................................
ENSPTRP00000048194  .N...NL..CQE..Q.KMLRTLDLSYNNIRDL..............................................
ENSPTRP00000057473  .K...GM..FLG..L.HNLEYLYLEYNAIKEI..............................................
ENSPTRP00000002701  .D...YT..FIG..V.FKLIYLDLSSNNLTSI..............................................
ENSPTRP00000010123  .R...EK..FAG..L.QNLEYLNVEYNAIQLI..............................................
ENSPTRP00000017119  .L...A-..VCS..I.PTLAELNVSCNALRSV..............................................
ENSPTRP00000004835  .E...GS..FLF..T.PSLQLLLFTSNSFDVI..............................................
ENSPTRP00000025772  .R...HD..LDG..L.GALEKLLLFNNRLVHL..............................................
ENSPTRP00000010123  .K...QT..FLG..L.DDLEYLQADFNLLRDI..............................................
ENSPTRP00000011064  .N...--..LNG..L.KNLRILSLGRNNIKNL..............................................
ENSPTRP00000027161  tA...AA..LHA..L.RGLRRLDLSGNSLTED..............................................
ENSPTRP00000010126  .D...DT..FLG..L.ENLEYLQVDYNYISVI..............................................
ENSPTRP00000054912  .D...GA..FSH..L.PLLQFLLLNSNKFTLI..............................................
ENSPTRP00000034515  .N...GS..FLG..L.SLLEKLDLRNNIISTV..............................................
ENSPTRP00000018540  .A...GS..FLR..I.PSLHLLLFTSNSFSVI..............................................
ENSPTRP00000057473  .E...DT..FHG..L.ENLEFLQADNNFITVI..............................................
ENSPTRP00000027614  .K...G-..LWK..L.KSLQSLDLSFNGILQI..............................................
ENSPTRP00000024687  .D...GA..FLG..Q.SSLQVLQLGYNKLSNL..............................................
ENSPTRP00000025967  .P...GA..FHG..L.QHLQVLNLTLNSLLSL..............................................
ENSPTRP00000026832  .N...DT..FLG..L.ESLEYLQADYNVIKRI..............................................
ENSPTRP00000007855  .G...LD..PEK..L.ISLHTVELRGNQLEST..............................................
ENSPTRP00000027517  .F...RC..LP-..-.PRIKVLDLHSNKIKSV..............................................
ENSPTRP00000001283  .P...GL..P--..-.RNVHVLKVKRNELAAL..............................................
ENSPTRP00000020451  .S...QA..FRG..L.NEVIKIEISQIDSLER..............................................
ENSPTRP00000006511  .-...--..---..-.----------------..............................................
ENSPTRP00000012374  .N...--..INH..L.CELRVLNLARNFLSHV..............................................
ENSPTRP00000056400  .-...--..---..-.----------------..............................................
ENSPTRP00000053355  .P...SS..FYN..L.KQLHELRLDGNSLAAF..............................................
ENSPTRP00000041711  .G...--..LEN..L.AHLVWLDLSFNNIETI..............................................
ENSPTRP00000038049  .-...--..---..-.----------------..............................................
ENSPTRP00000050575  .L...GA..LEH..L.PELRELRLEGNKLCSV..............................................
ENSPTRP00000008984  .E...DA..FRK..L.PQLRELVLRDNKIRQLpelpttltfidisnnrlgrkg.........................
ENSPTRP00000049006  .K...--..LDK..L.LKLRELNLSYNKISKI..............................................
ENSPTRP00000060814  .K...CI..L-R..L.SDVDELDLSRNLIRKI..............................................
ENSPTRP00000004277  .K...CI..L-R..L.SDVDELDLSRNLIRKI..............................................
ENSPTRP00000027103  .P...GA..FRN..L.GSLRYLSLSNNKLQVL..............................................
ENSPTRP00000051190  .Q...--..INS..C.TALQHLDLSDNNISQI..............................................
ENSPTRP00000055643  .P...GT..FG-..-.SNLLTLWLFSNNLSTI..............................................
ENSPTRP00000001472  .E...E-..MES..L.VRLQTINLSFNRFKML..............................................
ENSPTRP00000004702  .A...LM..LRG..L.PRLRELRLPGNRLAAF..............................................
ENSPTRP00000013006  .H...RL..FQG..L.GKLEYLLLSRNRLAEL..............................................
ENSPTRP00000043808  .P...KScsLLS..L.ATIKVLDLHDNQLTAL..............................................
ENSPTRP00000041179  .S...AS..LAG..L.HALRFLFMDGNCYYKNpcrqale.......................................
ENSPTRP00000035210  .H...I-..DKW..C.RDLKILYLQNNLIGKI..............................................
ENSPTRP00000011214  .S...HA..FSN..L.PNISRIYVSIDVTLQQ..............................................
ENSPTRP00000010702  .A...T-..IGD..L.IHLQELNLNDNHLESFs.............................................
ENSPTRP00000041754  .N...L-..GAT..L.DQFDAIDFSDNEIRKL..............................................
ENSPTRP00000050767  .Q...G-..FGS..L.PALEVLDLTYNNLNEN..............................................
ENSPTRP00000034871  .A...--..IDH..I.WNLRHLDLSSNQISRI..............................................
ENSPTRP00000036180  .N...--..LPK..L.PKLKKLELSENRIFGG..............................................
ENSPTRP00000039448  .E...VL..AEK..C.PNLTHLNLSGNKIKDL..............................................
ENSPTRP00000035343  .D...G-..IGQ..L.KQLSILKVDQNRLCEV..............................................
ENSPTRP00000035630  .N...NG..FGN..L.SSLEILNICRNSIYVI..............................................
ENSPTRP00000024055  .-...--..---..L.HSVRKLNCWGSRLTDI..............................................
ENSPTRP00000046894  .-...--..---..-.------DLSENQIQAI..............................................
ENSPTRP00000015962  .V...KE..LAA..L.PKATILDLSCNKLTTL..............................................
ENSPTRP00000036078  .D...GT..FSK..L.SLLEELSLAENQLLKL..............................................
ENSPTRP00000025359  .R...DL..P--..-.PETVLLYLDSNQITSI..............................................
ENSPTRP00000044819  .A...ED..FKG..L.TKLKRIDLSNNLISSI..............................................
ENSPTRP00000002116  .R...--..LPS..L.NKLRKLELSDNIISGG..............................................
ENSPTRP00000053040  .S...GI..P--..-.NDTRKLYLDANQLASV..............................................
ENSPTRP00000007526  .S...KI..VSN..V.PQLEFLNLSSNPLNLSv.............................................
ENSPTRP00000024064  .K...DI..P--..-.ANTVLLKLDANKISHL..............................................
ENSPTRP00000034772  .D...LS..L--..C.KNLSVLYLYDNCISQI..............................................
ENSPTRP00000030128  .-...-S..LWS..L.THLTALHLSDNSLSRI..............................................
ENSPTRP00000048131  .D...--..LSR..F.KKLKYLWLHHNKLHGI..............................................
ENSPTRP00000044257  .L...GC..LGE..C.LGLEWLDLSGNALTHL..............................................
ENSPTRP00000003094  .G...DL..D--..-.PLTAYLDLSMNNLTEL..............................................
ENSPTRP00000015328  .G...NV..WKA..Y.SWTEKLILSENYLTEL..............................................
ENSPTRP00000048337  .D...L-..GTS..L.GHLQVLWLARCGLADL..............................................
ENSPTRP00000007000  .V...K-..YGD..F.KLLEFLDLSFNSLTVE..............................................
ENSPTRP00000040371  .-...--..--G..A.ENLTELYIENQQHLQH..............................................
ENSPTRP00000009462  .A...TN..LP-..-.PTLKVLELYGNEISSM..............................................
ENSPTRP00000015329  .G...NV..WKA..Y.SWTEKLILRENYLTEL..............................................
ENSPTRP00000027832  .-...TS..LWS..L.THLTALHLNDNYLSRI..............................................
ENSPTRP00000052190  .-...--..---..-.----------NGLHLK..............................................
ENSPTRP00000015874  .N...--..LEG..L.QNLHSLYLQGNKIQQI..............................................
ENSPTRP00000046801  .S...KF..MTT..F.SQLRELHLEGNFLHRL..............................................
ENSPTRP00000014047  .-...--..---..-.-LVESLSLQGSYAGKIh.............................................
ENSPTRP00000061088  .G...NV..WKA..Y.SWTGKLILNENYLTEL..............................................
ENSPTRP00000050620  .-...--..---..-.---KRLDLSFNLLRSL..............................................
ENSPTRP00000010544  .H...--..LEQ..L.LLVTHLDLSHNRLRTL..............................................
ENSPTRP00000027517  .V...SD..MSF..L.SELKVLRLSHNRIQLL..............................................
ENSPTRP00000028616  .-...--..---..-.-----------KITHL..............................................
ENSPTRP00000027104  .S...HS..FSG..M.TVLQRLMISDSHISAV..............................................
ENSPTRP00000005408  .E...V-..-FR..I.PSLQQLHLQRNALCVI..............................................
ENSPTRP00000045137  .-...--..---..-.--ITSIHIENWRSLHT..............................................
ENSPTRP00000043320  .L...EG..LTD..E.SELEFLSAINVGLTSI..............................................
ENSPTRP00000028996  .K...EI..FTF..E.KTLEELYLDANQIEEL..............................................
ENSPTRP00000015086  .D...EN..VKA..M.TSLRWLKLNRTGLCYL..............................................
ENSPTRP00000036008  .-...--..---..-.-NITEIFIANQKRLEI..............................................
ENSPTRP00000047976  .-...--..---..-.---HSLDLSHNSLRAT..............................................
ENSPTRP00000060126  .-...--..---..-.----------------..............................................
ENSPTRP00000042428  .-...--..---..-.-FVRGVDLSGNDFKGG..............................................
ENSPTRP00000057066  .-...--..---..-.----------------..............................................
ENSPTRP00000060538  .G...YA..FAH..MkPGLEFLHLSHTRLQADg.............................................
ENSPTRP00000047493  .-...-N..FSK..L.LSLRALHLRGYVFQEL..............................................
ENSPTRP00000034915  .-...-A..LSG..G.KNTKILTLNGKKMTKM..............................................
ENSPTRP00000018267  .-...--..---..-.-----LSL--------..............................................
ENSPTRP00000048004  .A...DI..P--..-.DDATTLYLQNNQINNA..............................................
ENSPTRP00000051241  .-...--..---..-.----------------..............................................
ENSPTRP00000061058  .-...--..---..-.---QSLWLNNNVLNDLrdfnq.........................................
ENSPTRP00000047493  .-...--..---..-.----------------..............................................
ENSPTRP00000028379  .-...-L..FSH..L.TKLQILRVGNMDTFTK..............................................
ENSPTRP00000022750  .T...GI..P--..-.EDATTLYLQNNQINNA..............................................
ENSPTRP00000015475  .G...NV..WKA..Y.SWTEKLILRENNLTEL..............................................
ENSPTRP00000028379  .-...--..---..-.----------------..............................................


                                             50                 60            70                    
                                              |                  |             |                    
d2ifga3               .....................LELRDLR..G..L...GE..LRNLTIVK.S.GLR..F..VA................
ENSPTRP00000001468  .....................--PEVLD..Q..I...QN..LRELWMDN.N.ALQ..V..LP................
ENSPTRP00000034204  .....................--PAQLG..A..L...AH..LEELDVSF.N.RLA..H..LP................
ENSPTRP00000050882  .....................NLHSLML..S..Y...NA..ITHLPAGI.F.RDL..E..EL................
ENSPTRP00000027103  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000051281  .....................-EDHSFA..G..L...AS..LQELYLNH.N.QLY..R..IT................
ENSPTRP00000051241  .....................DTSGAFS..G..L...DS..LSKLTLFG.N.KIK..S..VA................
ENSPTRP00000049843  .....................-PERAFR..G..L...HS..LDRLLLHQ.N.RVA..H..VH................
ENSPTRP00000028996  .....................--PEVLE..Q..L...SG..LKEFWMDA.N.RLT..F..IP................
ENSPTRP00000008989  .....................-DAASLK..G..L...NN..LAKLGLSF.N.SIS..A..VD................
ENSPTRP00000051884  .....................DANEAFA..G..L...TS..LTKLILQG.N.QIK..S..IT................
ENSPTRP00000060321  .....................RLPGELS..N..M...TQ..LKELDISN.N.AIR..E..IP................
ENSPTRP00000029913  .....................-PRKAFR..G..I...TD..VKNLQLDN.N.HIS..C..IE................
ENSPTRP00000026857  .....................--CPALG..L..L...SS..LESLDLSY.N.PIF..S..SS................
ENSPTRP00000017393  .....................-PRGSFR..D..L...VR..LRELHLAG.A.LLA..V..VE................
ENSPTRP00000008774  .....................DMNGAFS..G..L...DK..LRRLILQG.N.RIR..S..IT................
ENSPTRP00000025115  .....................-TDYCLQ..D..L...SN..LQELYINH.N.QIS..T..IS................
ENSPTRP00000005186  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000001472  .....................--PEEIT..N..L...RN..LKCLYLQH.N.ELT..C..IS................
ENSPTRP00000002213  .....................-PARRLS..P..L...VR..LQELRLSG.A.CLT..S..IA................
ENSPTRP00000051339  .....................-EGSMLH..E..L...LR..LQEIQLVG.G.QLA..V..VE................
ENSPTRP00000060625  .....................-RPGSFQ..G..L...TS..LRKLWLMH.A.QVA..T..IE................
ENSPTRP00000020782  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000047233  .....................-SAGTFD..S..M...PN..LQLLYLNN.N.LLK..S..LP................
ENSPTRP00000027104  .....................-PDGLLR..G..L...GK..LRQVSLRR.N.RLR..A..LP................
ENSPTRP00000035643  .....................-EAGMFS..D..L...IR..LQELHIVG.A.QLR..T..IE................
ENSPTRP00000049653  .....................-RPGTFG..A..L...GA..LATLNLAH.N.VLV..Y..LP................
ENSPTRP00000019491  .....................-RPGSFQ..G..L...TS..LRKLWLMH.A.QVA..T..IE................
ENSPTRP00000029568  .....................-PNTTFT..Q..L...IN..LQNLDLSF.N.QLS..S..LH................
ENSPTRP00000042428  .....................--PRELE..N..A...KN..MLVLNLSH.N.SID..T..IP................
ENSPTRP00000061216  .....................-NSDTFS..L..L...KN..LIYLKLDR.N.RII..S..ID................
ENSPTRP00000033656  .....................-RPGSFH..G..L...SS..LKKLWVMN.S.QVS..L..IE................
ENSPTRP00000014575  .....................-GPGTFR..G..L...VN..LDRLLLHE.N.QLQ..W..VH................
ENSPTRP00000003094  .....................-GTHSFE..G..L...HN..LETLDLNY.N.ELQ..E..FP................
ENSPTRP00000015086  .....................--PRELE..N..A...KN..MLVLNLSH.N.SID..T..IP................
ENSPTRP00000006103  .....................-RPGSFQ..G..L...MH..LQKLWMIQ.S.QIQ..V..IE................
ENSPTRP00000015965  .....................-RAGAFD..D..L...TE..LTYLYLDH.N.KVT..E..LP................
ENSPTRP00000036080  .....................-HPKAFL..T..T...KK..LRRLYLSH.N.QLS..E..IP................
ENSPTRP00000008874  .....................-PVQAFR..S..L...SA..LQAMTLAL.N.KIH..H..IP................
ENSPTRP00000047686  .....................-PEKCLS..E..L...SN..LQELYINH.N.LLS..T..IS................
ENSPTRP00000037431  .....................-ARAWFA..D..L...AE..LELLYLDR.N.SIA..F..VE................
ENSPTRP00000060321  .....................--PKALC..F..L...PK..LISLDLTG.N.LIS..S..LP................
ENSPTRP00000004388  .....................-LNNTFR..P..V...TN..LRNLDLSY.N.QLH..S..LG................
ENSPTRP00000022464  .....................---ENID..T..L...TN..LESLFLGK.N.KIT..K..LQ................
ENSPTRP00000020795  .....................-PNTTFR..P..M...PN..LRSVDLSY.N.KLQ..A..LA................
ENSPTRP00000049653  .....................-RDGAFQ..P..Vg..RS..LQHLFLNS.S.GLE..Q..IC................
ENSPTRP00000035343  .....................--PDTLG..A..L...PN..LRELWLDR.N.QLS..A..LP................
ENSPTRP00000001283  .....................LDNETFW..K..L...SS..LEYLDLSS.N.NLS..R..VP................
ENSPTRP00000061095  .....................--PSAIC..K..L...SK..LKKLYLNS.N.KLDfdG..LP................
ENSPTRP00000048194  .....................-PVHPLS..N..L...PT..LQALTLAL.N.KIS..S..IP................
ENSPTRP00000036665  .....................----SFQ..H..L...HR..LTCLKLWY.N.HIA..Y..IP................
ENSPTRP00000011222  .....................-PPDL--..P..G...TH..LIRLYLQD.N.QIN..H..IP................
ENSPTRP00000047055  .....................-KPGVFE..D..L...HR..LEWLIIED.N.HLS..R..IS................
ENSPTRP00000001626  .....................--PPSIT..H..V...KN..LESLYFSN.N.KLE..S..LP................
ENSPTRP00000017670  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000053783  .....................-PSGVFQ..P..L...AN..LSNLDLTA.N.RLH..E..IT................
ENSPTRP00000012792  .....................-------..-..-...--..-----L--.-.---..-..--................
ENSPTRP00000013006  .....................-KANVFV..Q..L...PR..LQKLYLDR.N.LIA..A..VA................
ENSPTRP00000042859  .....................-DQRVLE..K..L...PG..LVFLYMEK.N.QLE..E..VP................
ENSPTRP00000007033  .....................LLERLLG..E..A...PS..LHTLSLAE.N.SLT..R..LT................
ENSPTRP00000042754  .....................-HEKAFS..P..L...RK..LQKLYISK.N.HLV..E..IP................
ENSPTRP00000022750  .....................---PVNL..P..G...TN..LRKLYLQD.N.HIN..R..VP................
ENSPTRP00000001624  .....................EEIVSFQ..H..L...RK..LTVLKLWH.N.SIT..Y..IP................
ENSPTRP00000017533  .....................-GKDLLL..P..Q...PD..LRYLFLNG.N.KLA..R..VA................
ENSPTRP00000031252  .....................--PESIG..A..L...LH..LKDLWLDG.N.QLS..E..LP................
ENSPTRP00000036079  .....................LKDKIFA..K..M...EK..LMQLNLCN.N.RLE..S..MP................
ENSPTRP00000003137  .....................--GSSMR..G..L...RS..LILLDLSY.N.HLR..K..VP................
ENSPTRP00000009804  .....................-SRKAFF..G..L...YN..LQILYLNH.N.CIT..T..LR................
ENSPTRP00000059190  .....................-PWAGIG..A..M...PA..LHTLNLDH.N.LID..A..LP................
ENSPTRP00000018046  .....................-PRGALS..R..Q...TQ..LRELYLQH.N.QLTdsG..LD................
ENSPTRP00000048004  .....................AAPPLNL..P..S...AH..LQKLYLQD.N.AIS..H..IP................
ENSPTRP00000041179  .....................-TNGSLP..A..G...TR..LRRLDVSC.N.SIS..F..VA................
ENSPTRP00000017706  .....................--PSQLG..L..C...SG..LRLLDVSH.N.GLH..S..LP................
ENSPTRP00000053173  .....................-PPGLLT..P..T...PK..LEKLSLAN.N.NLT..E..LP................
ENSPTRP00000008987  .....................AVSAAFK..G..L...KS..LEYLDLSF.N.QIA..K..LP................
ENSPTRP00000008254  .....................-PGPAHW..K..S...LN..LRELLFSH.N.QIS..I..LD................
ENSPTRP00000036082  .....................IGPKAFK..L..L...KK..LMRLNMDG.N.NLI..Q..VP................
ENSPTRP00000060795  .....................-GKDLLL..P..Q...PD..LRYLFLNG.N.KLA..R..VA................
ENSPTRP00000032807  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000055467  .....................-TNDMFS..G..L...SN..LHHLILNN.N.QLT..L..IS................
ENSPTRP00000022026  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000047494  .....................-PERLSN..C..S...RS..LKNLILKN.N.QIR..S..LT................
ENSPTRP00000046894  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000008986  .....................IEKGALS..Q..L...KK..LLFLFLED.N.ELE..E..VP................
ENSPTRP00000047783  .....................-SPTAFS..R..L...RY..LESLDLSH.N.GLT..A..LP................
ENSPTRP00000014225  .....................--PILLC..E..I...ST..LTELNLSC.N.GFH..D..LP................
ENSPTRP00000026754  .....................-NPEVFY..G..L...NF..LRLVHLEG.N.QLT..K..LH................
ENSPTRP00000028569  .....................IPVEVFK..D..L...FE..LKIIDLGL.N.NLN..T..LP................
ENSPTRP00000022026  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000028569  .....................-SDKTFA..F..C...TN..LTELHLMS.N.SIQ..K..IK................
ENSPTRP00000017119  .....................-PPATLS..E..E...TNsiLQELYLTN.N.SLT..D..KC................
ENSPTRP00000047493  .....................-TDSLSD..F..T...SS..LRTLLLSH.N.RIS..H..LP................
ENSPTRP00000018633  .....................-AAGALD..D..Ca..ET..LEDLDLSY.N.NLE..Q..LP................
ENSPTRP00000020457  .....................IEADVFS..N..L...PK..LHEIRIEKaN.NLL..Y..IN................
ENSPTRP00000035431  .....................-LDFTFL..H..L...PR..LQELHLQE.N.SIE..L..LE................
ENSPTRP00000017670  .....................-------..-..-...--..--------.-.-LF..F..NY................
ENSPTRP00000029007  .....................-DQQAFH..S..L...GK..MSHVDLSH.N.SLI..C..DS................
ENSPTRP00000022692  .....................LEGDIFK..M..T...PN..LQQLDCQD.SpALA..S..VA................
ENSPTRP00000032807  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000003935  .....................SLPGNFF..Y..L...TT..LRALYLSD.N.DFE..I..LP................
ENSPTRP00000030995  .....................ADEAFED..F..L...LT..LEDLDLSY.N.NLH..G..LP................
ENSPTRP00000029913  .....................-HGRVFR..G..L...SG..LKTLMLRS.N.LIS..C..VS................
ENSPTRP00000014225  .....................QCIPVLV..G..H...LH..LRILHLAN.N.QLQ..T..FP................
ENSPTRP00000005186  .....................--PNEIA..Y..L...KD..LQKLVLTN.N.QLT..T..LP................
ENSPTRP00000037057  .....................-HPQAFN..G..L...TS..LRLLHLEG.N.LLH..Q..LH................
ENSPTRP00000015508  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000012792  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000015508  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000018786  .....................-PWEAVG..Q..M...VN..LNTLTLDH.N.LID..H..IA................
ENSPTRP00000025606  .....................--PPELG..D..C...EN..LERLDCSG.NlELM..E..LP................
ENSPTRP00000012830  .....................VQSSDEI..I..C...SR..LLEIDISS.N.KLS..H..LP................
ENSPTRP00000034664  .....................-DKQTFK..G..L...IS..LEHLYIHF.N.QLE..M..LQ................
ENSPTRP00000026322  .....................--PPELG..N..L...PS..LNYLVLCD.N.KIQ..S..VP................
ENSPTRP00000008962  .....................-EAFSSY..W..L...PL..LQNITISQ.N.SLT..K..IV................
ENSPTRP00000046894  .....................-PKSLFE..G..L...FS..LQLLLLNA.N.KIN..C..LR................
ENSPTRP00000031403  lagralqglrrlelasnhflyLPRDVLA..Q..L...PS..LRYLDLSN.N.SLV..S..LT................
ENSPTRP00000015314  .....................-PT---N..M..P...SK..LHIVDLSN.N.SLT..Q..IL................
ENSPTRP00000027161  .....................-HIREHE..P..P...GA..LTELDLSH.N.QLS..E..LHla..............
ENSPTRP00000044034  .....................-PWSDLR..N..L...SA..LQLLKMNH.N.RLG..S..LP................
ENSPTRP00000033466  .....................-RPKEFE..D..V...HE..LKKLNLSS.N.GIE..F..ID................
ENSPTRP00000027515  .....................-DLKTFE..F..N...KE..LRYLDLSN.N.RLK..S..VT................
ENSPTRP00000008874  .....................---PSFS..V..C...QK..LQKIDLRH.N.EIY..E..IK................
ENSPTRP00000001496  .....................-TDSSFGgtN..L...HS..LRYLDLSN.N.FIS..Y..IG................
ENSPTRP00000000339  .....................-GAGAFR..S..A...GR..LVKLSLAN.N.NLV..G..VH................
ENSPTRP00000027516  .....................-DISVFK..F..N...HE..LEYLDLSH.N.KLV..K..IS................
ENSPTRP00000049501  .....................EVPAELS..L..C...RK..LEVLSLSH.N.CLS..Q..LP................
ENSPTRP00000007737  .....................-DRDLLR..R..S...PL..LRHLDLSI.N.GLA..Q..LP................
ENSPTRP00000027179  .....................--PEAIL..N..L...QA..LTFLNISR.N.QLS..T..LP................
ENSPTRP00000033370  .....................--NPALG..N..L...TA..LTYLNLSR.N.QLS..L..LP................
ENSPTRP00000011913  .....................--PDEIC..N..L...KK..LETLSLNN.N.HLR..E..LP................
ENSPTRP00000041364  .....................--PQVVC..T..L...KQ..LCILYLGN.N.KLC..D..LP................
ENSPTRP00000012439  .....................-AWSDLH..N..L...SA..LQLLKMDS.N.ELT..F..IP................
ENSPTRP00000002493  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000009963  .....................--PEAIV..N..L...QM..LTYLNLSR.N.QLS..A..LP................
ENSPTRP00000047494  .....................I------..-..-...--..--------.-.---..-..-P................
ENSPTRP00000029007  .....................-AETSLN..G..P...KS..LKHLFLIQ.T.GIS..N..LE................
ENSPTRP00000012803  .....................--PEAIG..S..L...VK..LQCLDLSD.N.ALE..I..VC................
ENSPTRP00000002493  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000006306  .....................-PADMFQ..E..A...HG..LVHIDLSH.NpWLR..R..VH................
ENSPTRP00000052915  .....................-PAELFR..PgaL...PL..LSELAAAD.N.CLR..E..LS................
ENSPTRP00000047302  .....................--PEAIK..N..L...QM..LTYLNISR.N.LLS..T..LP................
ENSPTRP00000031252  .....................--PEEIS..G..L...TS..LTDLVISQ.N.LLE..T..IP................
ENSPTRP00000027465  .....................-DPGAFW..G..L...SS..LKRLDLTN.N.RIG..C..LN................
ENSPTRP00000026832  .....................-QPAAFS..L..M...PN..LKLLFLNN.N.LLR..T..LP................
ENSPTRP00000008307  .....................-DPSAFG..G..L...SQ..LQKLYLSG.N.FLT..Q..FP................
ENSPTRP00000027477  .....................-RDDAFA..G..L...FH..LEYLFIEG.N.KIE..T..IS................
ENSPTRP00000047493  .....................IDRFAFQ..N..L...TQ..LRYLNLSS.T.SLR..K..IN................
ENSPTRP00000001819  .....................-DRCAFD..D..M...AQ..LQKLYLSQ.N.QIS..R..FP................
ENSPTRP00000010126  .....................-QSGTFD..P..V...PN..LQLLFLNN.N.LLQ..A..MP................
ENSPTRP00000041179  .....................VNGSQFL..P..L...TG..LQVLDLSH.N.KLD..L..YH................
ENSPTRP00000036986  .....................-APGTFA..P..L...RA..LRNLSLAG.N.RLA..R..LE................
ENSPTRP00000033769  .....................---TGLE..D..L...KA..LQNLDLSH.N.QIS..S..LQ................
ENSPTRP00000048194  .....................---PSFN..G..C...HA..LEEISLQR.N.QIY..Q..IK................
ENSPTRP00000057473  .....................-LPGTFN..P..M...PK..LKVLYLNN.N.LLQ..V..LP................
ENSPTRP00000002701  .....................-SPFTFS..V..L...SN..LVQLNIAN.NpHLL..S..LH................
ENSPTRP00000010123  .....................-LPGTFN..A..M...PK..LRILILNN.N.LLR..S..LP................
ENSPTRP00000017119  .....................--PAAVG..V..M...HN..LQTFLLDG.N.FLQ..S..LP................
ENSPTRP00000004835  .....................-SDDAFI..G..L...PH..LEYLFIEN.N.NIK..S..IS................
ENSPTRP00000025772  .....................-DEHAFH..G..L...RA..LSHLYLGC.N.ELA..S..FS................
ENSPTRP00000010123  .....................-DPGAFQ..D..L...NK..LEVLILND.N.LIS..T..LP................
ENSPTRP00000011064  .....................--NGLEA..V..G...DT..LEELWISY.N.FIE..K..LK................
ENSPTRP00000027161  .....................MAALMLQ..N..L...SS..LRSVSLAG.N.TIM..R..LD................
ENSPTRP00000010126  .....................-EPNAFG..K..L...HL..LQVLILND.N.LLS..S..LP................
ENSPTRP00000054912  .....................-GDNAFT..G..L...SH..LQYLFIEN.N.DIW..A..LS................
ENSPTRP00000034515  .....................-QPGAFL..G..L...GE..LKRLDLSN.N.RIG..C..LT................
ENSPTRP00000018540  .....................-EDDAFA..G..L...SH..LQYLFIED.N.EIG..S..IS................
ENSPTRP00000057473  .....................-EPSAFS..K..L...NR..LKVLILND.N.AIE..S..LP................
ENSPTRP00000027614  .....................-GWSDFH..N..C...LQ..LENLCLKS.N.KIF..K..IH................
ENSPTRP00000024687  .....................-TEGMLR..G..M...SR..LQFLFVQH.N.LIE..V..VT................
ENSPTRP00000025967  .....................-ESRLFH..S..L...PQ..LRELDLSS.N.NIS..H..LP................
ENSPTRP00000026832  .....................-ESGAFR..N..L...SK..LRVLILND.N.LIP..M..LP................
ENSPTRP00000007855  .....................----LGI..N..L...PK..LKNLYLAQ.N.MLK..K..VE................
ENSPTRP00000027517  .....................--PKQVI..K..L...KA..LQELNVAF.N.SLT..D..LP................
ENSPTRP00000001283  .....................-ARGALA..G..M...AQ..LRELYLTS.N.RLR..SraLG................
ENSPTRP00000020451  .....................IEANAFD..N..L...LN..LSEILIQN.TkNLR..Y..IE................
ENSPTRP00000006511  .....................-------..N..I...PE..LLSLNLSN.N.RLY..R..LDdm..............
ENSPTRP00000012374  .....................---DNLN..G..L...DS..LTELNLRH.N.QIT..F..VR................
ENSPTRP00000056400  .....................------R..N..F...PE..LLSLNLCN.N.KLY..Q..LDgl..............
ENSPTRP00000053355  .....................-PWASLL..D..M...PL..LRTLDLHN.N.KIT..S..VP................
ENSPTRP00000041711  .....................---EGLD..T..L...VN..LEDLSLFN.N.RIS..K..ID................
ENSPTRP00000038049  .....................------R..N..F...PE..LLSLNLCN.N.KLY..Q..LDgl..............
ENSPTRP00000050575  .....................-PWTAFR..A..T...PL..LRVLDLKR.N.KID..A..LP................
ENSPTRP00000008984  .....................IKQEAFK..D..M...YD..LHHLYLTD.N.NLD..H..IP................
ENSPTRP00000049006  .....................---EGIE..N..M...CN..LQKLNLAG.N.EIE..H..IP................
ENSPTRP00000060814  .....................--PDSIS..K..F...QN..LRWLDLHS.N.YID..K..LP................
ENSPTRP00000004277  .....................--PDSIS..K..F...QN..LRWLDLHS.N.YID..K..LP................
ENSPTRP00000027103  .....................-PIGLFQ..G..L...DS..LESLLLSS.N.QLV..Q..IQ................
ENSPTRP00000051190  .....................---GDLS..K..L...VS..LKTLLLHG.N.IIT..S..LR................
ENSPTRP00000055643  .....................-YPGTFR..H..L...QA..LEELDLGD.NrHLR..S..LE................
ENSPTRP00000001472  .....................--PEVLY..R..I...FT..LETILISN.N.QVG..S..VD................
ENSPTRP00000004702  .....................-PWAALR..D..A...PK..LRLLDLQA.N.RLS..A..VP................
ENSPTRP00000013006  .....................-PADALG..P..L...QR..AFWLDISH.N.RLE..A..LP................
ENSPTRP00000043808  .....................--PDDLG..Q..L...TA..LQVLNVER.N.QLM..Q..LP................
ENSPTRP00000041179  .....................VAPGALL..G..L...GN..LTHLSLKY.N.NLT..V..VP................
ENSPTRP00000035210  .....................---ENVS..K..L...KK..LEYLNLAL.N.NIE..K..IE................
ENSPTRP00000011214  .....................LESHSFY..N..L...SK..VTHIEIRN.TrNLT..Y..ID................
ENSPTRP00000010702  .....................VALCHST..L..Q...KS..LRSLDLSK.N.KIK..A..LP................
ENSPTRP00000041754  .....................---DGFP..L..L...RR..LKTLLVNN.N.RIC..R..IG................
ENSPTRP00000050767  .....................YLPGNFF..Y..L...TT..LCALYLSD.N.NFE..I..LP................
ENSPTRP00000034871  .....................---EGLN..T..L...TK..LCTLNLSC.N.LIT..K..VE................
ENSPTRP00000036180  .....................-LDMLAE..K..L...PN..LTHLNLSG.N.KLK..D..ISt...............
ENSPTRP00000039448  .....................STIEPLK..K..L...EN..LKSLDLFN.C.EVT..N..LNdyr.............
ENSPTRP00000035343  .....................--TEAIG..D..C...EN..LSELILTE.N.LLM..A..LP................
ENSPTRP00000035630  .....................-QQGAFL..G..L...NK..LKQLYLCQ.N.KIE..Q..LN................
ENSPTRP00000024055  .....................---SICR..E..M...PS..LEVITLSV.N.SIS..T..LE................
ENSPTRP00000046894  .....................-PRKAFR..G..A...VD..IKNLQLDY.N.QIS..C..IE................
ENSPTRP00000015962  .....................--PSDFC..G..L...TH..LVKLDLSK.N.KLQ..Q..LP................
ENSPTRP00000036078  .....................-----PV..L..P...PK..LTLFNAKY.N.KIK..-..-Srgik............
ENSPTRP00000025359  .....................-PNEIFK..D..L...HQ..LRVLNLSK.N.GIE..F..ID................
ENSPTRP00000044819  .....................-DNDAFR..L..L...HA..LQDLLLPE.N.QLE..A..LP................
ENSPTRP00000002116  .....................-LEVLAE..K..C...PN..LTYLNLSG.N.KIK..D..LSt...............
ENSPTRP00000053040  .....................-PAGAFQ..H..L...PV..LEELDLSH.N.ALA..H..LS................
ENSPTRP00000007526  .....................LERTCAG..S..F...SG..VRKLVLNN.S.KAS..W..ETv...............
ENSPTRP00000024064  .....................-PDGAFQ..H..L...HR..LRELDLSH.N.AIE..A..IG................
ENSPTRP00000034772  .....................---TNLN..Y..A...TN..LTHLYLQN.N.CIS..Y..IE................
ENSPTRP00000030128  .....................--PSDIA..K..L...HN..LVYLDLSS.N.KIR..S..LP................
ENSPTRP00000048131  .....................---TFLT..R..N...YC..LTELYLNN.N.AIF..E..IE................
ENSPTRP00000044257  .....................---GPLA..S..L...RQ..LAVLNVAN.N.RLT..G..LE................
ENSPTRP00000003094  .....................-QPGLFH..H..L...RF..LEELRLSG.N.HLS..H..IP................
ENSPTRP00000015328  .....................-PKDSFE..G..L...LY..LQYLDLSC.N.KIR..Y..IE................
ENSPTRP00000048337  .....................---DGIA..S..L...PA..LKELYASY.N.NIS..D..LS................
ENSPTRP00000007000  .....................-AICDLG..I..L...PH..LRVLLLTG.N.GLT..S..LPpnlavaeqeasvtslt
ENSPTRP00000040371  .....................LELRDLR..G..L...GE..LRNLTIVK.S.GLR..F..VA................
ENSPTRP00000009462  .....................-ECLCAR..P..P...AG..LQHLGLGH.N.KLL..G..PL................
ENSPTRP00000015329  .....................-HKDSFE..D..L...LS..LQYLDLSC.N.KIQ..S..IE................
ENSPTRP00000027832  .....................--PPDIA..K..L...HN..LVYLDLSS.N.KLR..S..LP................
ENSPTRP00000052190  .....................-SMENLQ..S..C...IS..LRVCIFSN.N.FIT..D..IH................
ENSPTRP00000015874  .....................---ENLA..C..I...PS..LRFLSLAG.N.QIR..Q..VE................
ENSPTRP00000046801  .....................--PSEVS..A..L...QH..LKAIDLSR.N.QFQ..D..FP................
ENSPTRP00000014047  .....................SIGDAFR..N..F...KN..LRSLDLSR.N.LIT..S..LK................
ENSPTRP00000061088  .....................-HNDSFE..G..L...LS..LQYLDLSC.N.KIQ..S..IE................
ENSPTRP00000050620  .....................---EGLS..A..F...RS..LEELILDN.N.QLG..D..DL................
ENSPTRP00000010544  .....................--PPALA..A..L...RC..LEVLQASD.N.AIE..S..LD................
ENSPTRP00000027517  .....................-DLSVFK..F..N...QD..LEYLDLSH.N.QLQ..K..IS................
ENSPTRP00000028616  .....................--GHSLM..S..L...TG..LKSLDLSR.N.SLV..S..LE................
ENSPTRP00000027104  .....................-APGTFN..D..L...IK..LKTLRLSR.N.KIT..H..LP................
ENSPTRP00000005408  .....................-PQDFFQ..L..L...PN..LTWLDLRC.N.RIK..A..LP................
ENSPTRP00000045137  .....................LNAVDME..L..Y...TG..LQKLTIKN.S.GLR..S..IQ................
ENSPTRP00000043320  .....................----ANL..P..K...LN..LKKLKLSD.N.RVS..G..GV................
ENSPTRP00000028996  .....................--PKQLF..N..C...QS..LHKLSLPD.N.DLT..T..LP................
ENSPTRP00000015086  .....................--PEELA..A..L...QK..LEHLSVSH.N.NLT..T..LH................
ENSPTRP00000036008  .....................INEDDVE..A..Y...VG..LRNLTIVD.S.GLK..F..VA................
ENSPTRP00000047976  .....................RDPSAPR..C..Mws.SA..LNSLNLSF.A.GLE..Q..VP................
ENSPTRP00000060126  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000042428  .....................YFDENVK..A..M...TS..LRWLKLNR.T.GLC..Y..LP................
ENSPTRP00000057066  .....................-------..-..-...--..--------.-.---..-..--................
ENSPTRP00000060538  .....................IHSVSFL..G..Lr..AS..LAELLLDH.T.RVQ..A..IP................
ENSPTRP00000047493  .....................-REDDFQ..P..LmqlPN..LSTINLGI.N.FIK..Q..ID................
ENSPTRP00000034915  .....................--PSALG..K..L...PG..LKTLVLQN.N.LIP..K..VC................
ENSPTRP00000018267  .....................-PHNQSL..R..A...SN..VILLDLSG.N.GLR..E..LP................
ENSPTRP00000048004  .....................GIPQDLK..T..K...VN..VQVIYLYE.N.DL-..-..--................
ENSPTRP00000051241  .....................-------..-..-...--..--SLNLSY.N.KLS..E..ID................
ENSPTRP00000061058  .....................VASQLLE..H..P...EN..LAWIDLSF.N.DLT..S..ID................
ENSPTRP00000047493  .....................-------..-..-...--..-TELDLSD.N.FIT..H..IT................
ENSPTRP00000028379  .....................IQRKDFA..G..L...TF..LEELEIDA.S.DLQ..S..YE................
ENSPTRP00000022750  .....................GIPSDLK..N..L...LK..VERIYLYH.N.S--..-..--................
ENSPTRP00000015475  .....................-HKDSFE..G..L...LS..LQ------.-.---..-..--................
ENSPTRP00000028379  .....................-LSTLYS..L..T...ER..VKRITVEN.S.KVF..L..VP................


                                           80                90         100                         
                                            |                 |           |                         
d2ifga3               .PDAFH...F...T........PRLS........RLNLSFNALES..LSWKTV...............Q.........
ENSPTRP00000001468  .GS-IG...K...L........KMLV........YLDMSKNRIET..VDMDIS...............G.........
ENSPTRP00000034204  .DS-LS...C...L........SRLR........TLDVDHNQLTA..FPRQLL...............Q.........
ENSPTRP00000050882  .VKLYL...G...S........NNLT........ALHPALFQNLS..KLELLS...............L.........
ENSPTRP00000027103  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000051281  .PRAFS...G...L........SNLL........RLHLNSNLLRA..IDSRWF...............Em........
ENSPTRP00000051241  .KRAFS...G...L........EGLE........HLNLGGNAIRS..VQFDAF...............Vk........
ENSPTRP00000049843  .PHAFR...D...L........GRLM........TLYLFANNLSA..LPTEAL...............Ap........
ENSPTRP00000028996  .GF-IG...S...L........KQLT........YLDVSKNNIEM..VEEGIS...............T.........
ENSPTRP00000008989  .NGSLA...N...T........PHLR........ELHLDNNKLTR..VPGGLA...............E.........
ENSPTRP00000051884  .KKAFI...G...L........ESLE........HLDLNNNAIMS..IQENAF...............S.........
ENSPTRP00000060321  .RN-IG...E...L........RNLV........SLHAYNNQISY..LPPSLL...............S.........
ENSPTRP00000029913  .DGAFR...A...L........RDLE........ILTLNNNNISR..ILVTSF...............Nh........
ENSPTRP00000026857  .LVVVS...F...L........HALR........ELRLYQTDLKE..IPVVIC...............Kn........
ENSPTRP00000017393  .PQAFL...G...L........RQIR........LLNLSNNLLST..LEESTF...............Hs........
ENSPTRP00000008774  .KKAFT...G...L........DALE........HLDLSDNAIMS..LQGNAF...............S.........
ENSPTRP00000025115  .AHAFA...G...L........KNLL........RLHLNSNKLKV..IDSRWF...............Ds........
ENSPTRP00000005186  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000001472  .EG-FE...Q...L........SNLE........DLDLSNNHLTT..VPASFS...............S.........
ENSPTRP00000002213  .AHAFH...G...L........TAFH........LLDVADNALQT..LEETAF...............Ps........
ENSPTRP00000051339  .PYAFR...G...L........NYLR........VLNVSGNQLTT..LEESVF...............Hs........
ENSPTRP00000060625  .RNAFD...D...L........KSLE........ELNLSHNNLMS..LPHDLF...............Tp........
ENSPTRP00000020782  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000047233  .VYIFS...G...A........P-LA........RLNLRNNKFMY..LPVSGV...............Ldq.......
ENSPTRP00000027104  .RALFR...N...L........SSLE........SVQLDHNQLET..LPGDVF...............Ga........
ENSPTRP00000035643  .PHSFQ...G...L........RFLR........VLNVSQNLLET..LEENVF...............Ss........
ENSPTRP00000049653  .AMAFQ...G...L........LRVR........WLRLSHNALSV..LAPEAL...............Ag........
ENSPTRP00000019491  .RNAFD...D...L........KSLE........ELNLSHNNLMS..LPHDLF...............Tp........
ENSPTRP00000029568  .PELFY...G...L........RKLQ........TLHLRSNSLRT..IPVRLF...............Wd........
ENSPTRP00000042428  .NQLFI...N...L........TDLL........YLDLSENRLES..LPPQMR...............R.........
ENSPTRP00000061216  .NDTFE...N...Mg.......ASLK........ILNLSFNNLTD..LHPRVL...............Kp........
ENSPTRP00000033656  .RNAFD...G...L........ASLV........ELNLAHNNLSS..LPHDLF...............Tp........
ENSPTRP00000014575  .HKAFH...D...L........RRLT........TLFLFNNSLSE..LQGECL...............Ap........
ENSPTRP00000003094  .VA-IR...T...L........GRLQ........ELGFHNNNIKA..IPEKAF...............Mg........
ENSPTRP00000015086  .NQLFI...N...L........TDLL........YLDLSENRLES..LPPQMR...............R.........
ENSPTRP00000006103  .RNAFD...N...L........QSLV........EINLAHNNLTL..LPHDLF...............Tp........
ENSPTRP00000015965  .RGLLS...P...L........VNLF........ILQLNNNKIRE..LRAGAF...............Qg........
ENSPTRP00000036080  .LNL--...-...P........KSLA........ELRIHENKVKK..IQKDTF...............Kg........
ENSPTRP00000008874  .DYAFG...N...L........SSLV........VLHLHNNRIHS..LGKKCF...............Dg........
ENSPTRP00000047686  .PGAFI...G...L........HNLL........RLHLNSNRLQM..INSKWF...............Da........
ENSPTRP00000037431  .EGAFQ...N...L........SGLL........ALHLNGNRLTV..LAWVAF...............Qp........
ENSPTRP00000060321  .KE-IR...E...L........KNLE........TLLMDHNKLTF..LAVEIF...............Q.........
ENSPTRP00000004388  .SEQFR...G...L........RKLL........SLHLRSNSLRT..IPVRIF...............Qd........
ENSPTRP00000022464  .N--LD...A...L........TNLT........VLSMQSNRLTK..IE-G-L...............Qn........
ENSPTRP00000020795  .PDLFH...G...L........RKLT........TLHMRANAIQF..VPVRIF...............Qd........
ENSPTRP00000049653  .PGAFS...G...Lg.......PGLQ........SLHLQKNQLRA..LP--AL...............Ps........
ENSPTRP00000035343  .PE-LG...N...L........RRLV........CLDVSENRLEE..LPAELG...............G.........
ENSPTRP00000001283  .AGL--...-...P........RSLV........LLHLEKNAIRS..VDADVL...............Tp........
ENSPTRP00000061095  .SG-IG...K...L........TNLE........EFMAANNNLEL..VPESLC...............R.........
ENSPTRP00000048194  .DFAFT...N...L........SSLV........VLHLHNNKIKS..LSQHCF...............Dg........
ENSPTRP00000036665  .IQ-IG...N...L........TNLE........RLYLNRNKIEK..IPTQLF...............Y.........
ENSPTRP00000011222  .LTAFS...N...L........RKLE........RLDISNNQLRM..LTQGVF...............Dn........
ENSPTRP00000047055  .PPTFY...G...L........NSLI........LLVLMNNVLTR..LPDKPL...............Cqh.......
ENSPTRP00000001626  .VAVFS...-...L........QKLR........CLDVSYNNISM..IPIEIG...............L.........
ENSPTRP00000017670  .-----...-...-........----........---LDNQNLRQ..LWDWSK...............Hnl.......
ENSPTRP00000053783  .NETFR...G...L........RRLE........RLYLGKNRIRH..IQPGAF...............Dt........
ENSPTRP00000012792  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000013006  .PGAFL...G...L........KALR........WLDLSHNRVAG..LLEDTF...............Pg........
ENSPTRP00000042859  .SAL--...-...P........RNLE........QLRLSQNHISR..IPPGVF...............Sk........
ENSPTRP00000007033  .RHTFR...D...M........PALE........QLDLHSNVLMD..IEDGAF...............Eg........
ENSPTRP00000042754  .PNL--...-...P........SSLV........ELRIHDNRIRK..VPKGVF...............Sg........
ENSPTRP00000022750  .PNAFS...Y...L........RQLY........RLDMSNNNLSN..LPQGIF...............Dd........
ENSPTRP00000001624  .EH-IK...K...L........TSLE........RLSFSHNKIEV..LPSHLF...............L.........
ENSPTRP00000017533  .AGAFQ...G...L........RQLD........MLDLSNNSLAS..VPEGLW...............Aslgqpn...
ENSPTRP00000031252  .QE-IG...N...L........KNLL........CLDVSENRLER..LPEEIS...............G.........
ENSPTRP00000036079  .PGL--...-...P........SSLM........YLSLENNSISS..IPEKYF...............Dk........
ENSPTRP00000003137  .DGL--...-...P........SALE........QLYMEHNNVYT..VPDSYF...............Rg........
ENSPTRP00000009804  .PGIFK...D...L........HQLT........WLILDDNPITR..ISQRLF...............Tg........
ENSPTRP00000059190  .PGAFA...Q...L........GQLS........RLDLTSNRLAT..LAPDPL...............Fsrgrdaea.
ENSPTRP00000018046  .ATTFS...K...L........HSLE........YLDLSHNQLTT..VPAGL-...............-.........
ENSPTRP00000048004  .YNTLA...K...M........RELE........RLDLSNNNLTT..LPRGLF...............Dd........
ENSPTRP00000041179  .PGFFS...K...A........KELR........ELNLSTNALKT..VDHSWF...............Gpl.......
ENSPTRP00000017706  .PE-VG...L...L........QNLQ........HLALSYNALEA..LPEELF...............F.........
ENSPTRP00000053173  .AGLLN...G...L........ENLD........TLLLQENSLYT..IPKGFF...............G.........
ENSPTRP00000008987  .SGL--...-...P........VSLL........TLYLDNNKISN..IPDEYF...............Kr........
ENSPTRP00000008254  .LSEKA...Y...Lw.......SRVE........KLHLSHNKLKE..IPPEIG...............C.........
ENSPTRP00000036082  .SQL--...-...P........STLE........ELKVNENNLQA..IDEESL...............Sd........
ENSPTRP00000060795  .AGAFQ...G...L........RQLD........MLDLSNNSLAS..VPEGLW...............Aslgqpn...
ENSPTRP00000032807  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000055467  .STAFD...D...V........FALE........ELDLSYNNLET..IPWDAV...............Ek........
ENSPTRP00000022026  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000047494  .KYFLQ...D...A........FQLR........YLDLSSNKIQM..IQKTSF...............Penv......
ENSPTRP00000046894  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000008986  .SPL--...-...P........RSLE........QLQLARNKVSR..IPQGTF...............Sn........
ENSPTRP00000047783  .AESFT...S...-........SPLS........DVNLSHNQLWE..VSVSAF...............Tths......
ENSPTRP00000014225  .SQ-IG...N...L........LNLQ........TLCLDGNFLTT..LPEELG...............N.........
ENSPTRP00000026754  .PDTFV...S...L........SYLQifkisfikFLYLSDNFLTS..LPQEMV...............Sy........
ENSPTRP00000028569  .ASVFN...N...Q........VSLK........SLNLQKNLITS..IEKKVF...............Gpa.......
ENSPTRP00000022026  .-----...-...-........SGLS........LLILKQQGITS..LQFQSL...............K.........
ENSPTRP00000028569  .NNPFV...K...Q........KNLI........TLDLSHNGLSS..TKLGTQ...............Vq........
ENSPTRP00000017119  .VPLLT...G...H........PHLK........ILHMAYNRLQS..FPASKM...............Ak........
ENSPTRP00000047493  .SGFLS...E...V........SSLK........HLDLSSNLLKT..INKSAL...............Etkt......
ENSPTRP00000018633  .WEALG...R...L........GNVN........TLGLDHNLLAS..VPAGAF...............Sr........
ENSPTRP00000020457  .PEAFQ...N...L........PNLQ........YLLISNTGIKH..LPDVHK...............Ih........
ENSPTRP00000035431  .DQALA...G...L........SSLA........LLDLSRNQLGT..ISREAL...............Qp........
ENSPTRP00000017670  .ALVIF...E...M........VHLK........ELGL-------..------...............-.........
ENSPTRP00000029007  .IDSLS...H...L........KGI-........YLNLAANSINI..ISPRLL...............Pi........
ENSPTRP00000022692  .THIFQ...D...T........PHLQ........VLLFQNCNLSS..FPPWTL...............D.........
ENSPTRP00000032807  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000003935  .PD-IG...K...L........TKLQ........ILSLRDNDLIS..LPKEIG...............E.........
ENSPTRP00000030995  .WDSVR...R...M........VNLH........QLSLDHNLLDH..IAEGTF...............Ad........
ENSPTRP00000029913  .NDTFA...G...L........SSVR........LLSLYDNRITT..ITPGAF...............Tt........
ENSPTRP00000014225  .ASKLN...K...L........EQLE........ELNLSGNKLKT..IPTTIA...............N.........
ENSPTRP00000005186  .RG-IG...H...L........TNLT........HLGLGENLLTH..LPEEIG...............T.........
ENSPTRP00000037057  .PSTFS...T...FtfldyfrlSTIR........HLYLAENMVRT..LPASML...............Rn........
ENSPTRP00000015508  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000012792  .-----...E...M........TNLK........DIGL-------..------...............-.........
ENSPTRP00000015508  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000018786  .EGTFV...Q...L........HKLV........RLDMTSNRLHK..LPPDGL...............Flrsqgtgpk
ENSPTRP00000025606  .FE-LS...N...L........KQVT........FVDISANKFSS..VPICVL...............R.........
ENSPTRP00000012830  .PG-FL...H...L........SKLQ........KLTASKNCLEK..LFEEEN...............Atnwig....
ENSPTRP00000034664  .PETFG...D...L........LRLE........RLFLHNNKLSK..IPAGSF...............Sn........
ENSPTRP00000026322  .PQ-LS...Q...L........HSLR........SLSLHNNLLTY..LPREIL...............N.........
ENSPTRP00000008962  .P--LF...H...F........VSLE........KLDVSHNCLSD..LKSAIK...............Wfda......
ENSPTRP00000046894  .VDAFQ...D...L........HNLN........LLSLYDNKLQT..IAKGTF...............Sp........
ENSPTRP00000031403  .YVSFR...N...L........THLE........SLHLEDNALKV..LHNGTL...............Ae........
ENSPTRP00000015314  .PGTLI...N...L........TNLT........HLYLHNNKFTF..IPDQSF...............Dq........
ENSPTRP00000027161  .PGPAS...C...L........GSLR........LFNLSSNQLLG..VPPGLF...............An........
ENSPTRP00000044034  .RDALG...A...L........PDLR........SLRINNNRLRT..LAPGTF...............Da........
ENSPTRP00000033466  .PAAFL...G...L........THLE........ELDLSNNSLQN..FDYGVL...............Ed........
ENSPTRP00000027515  .WYL--...-...L........AGLR........YLDLSFNDFDT..MPIC--...............-.........
ENSPTRP00000008874  .VDTFQ...Q...L........LSLR........SLNLAWNKIAI..IHPNAF...............St........
ENSPTRP00000001496  .KDAFR...P...L........PQLQ........EVDLSRNRLAH..MPDVFT...............P.........
ENSPTRP00000000339  .EDAFE...T...L........ESLQ........VLELNDNNLRS..LSVAAL...............Aa........
ENSPTRP00000027516  .---CH...P...T........VNLK........HLDLSFNAFDA..LPICKE...............Fgn.......
ENSPTRP00000049501  .AC-FA...D...L........SRLR........KLNLSNNFFAH..IPMCVF...............S.........
ENSPTRP00000007737  .PGLFD...G...L........LALR........SLSLRSNRLQN..LDRLTF...............Ep........
ENSPTRP00000027179  .VH-LC...N...-........LPLK........VLIASNNKLVS..LPEEIG...............H.........
ENSPTRP00000033370  .PYIC-...-...Q........LPLR........VLIVSNNKLGA..LPPDIG...............T.........
ENSPTRP00000011913  .ST-FG...Q...L........SALK........TLSLSGNQLGA..LPPQLC...............S.........
ENSPTRP00000041364  .SE-LS...L...L........QNLR........TLWIEANCLTQ..LPDVVC...............E.........
ENSPTRP00000012439  .RDAFR...S...L........RALR........SLQLNHNRLHT..LAEGTF...............Tp........
ENSPTRP00000002493  .-----...-...-........----........---LDNQNLQQ..LGSWVA...............Agl.......
ENSPTRP00000009963  .AC-LC...G...L........-PLK........VLIASNNKLGS..LPEEIG...............Q.........
ENSPTRP00000047494  .VNAFD...A...L........TELK........VLRLHSNSLQH..VPPRWF...............Kn........
ENSPTRP00000029007  .FIPVH...N...L........ENLE........SLYLGSNHISS..IKFPKD...............Fp........
ENSPTRP00000012803  .PE-IG...R...L........RALR........HLRLANNQLQF..LPPEVG...............D.........
ENSPTRP00000002493  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000006306  .PQAFQ...G...L........MQLR........DLDLSYGGLAF..LSLEAL...............Eg........
ENSPTRP00000052915  .PD-IA...H...L........ASLK........TLDLSNNQLNE..IPAELA...............D.........
ENSPTRP00000047302  .KYLFD...-...-........LPLK........VLVVSNNKLVS..IPEEIG...............K.........
ENSPTRP00000031252  .DG-IG...K...L........KKLS........ILKVDQNRLTQ..LPEAVG...............D.........
ENSPTRP00000027465  .ADIFR...G...L........TNLV........RLNLSGNLFSS..LSQGTF...............Dy........
ENSPTRP00000026832  .TDAFA...G...-........TSLA........RLNLRKNYFLY..LPVAGV...............Leh.......
ENSPTRP00000008307  .MDLYV...GrfkL........AELM........FLDVSYNRIPS..MPMHHI...............Nlvp......
ENSPTRP00000027477  .RNAFR...G...L........RDLT........HLSLANNHIKA..LPRDVF...............Sd........
ENSPTRP00000047493  .AAWFK...N...M........PHLK........VLDLEFNYLVGe.IASGAF...............Ltm.......
ENSPTRP00000001819  .LELVKegaK...L........PKLT........LLDLSSNKLKN..LPLPDL...............Qk........
ENSPTRP00000010126  .SGVFS...G...L........T-LL........RLNLRSNHFTS..LPVSGV...............Ldq.......
ENSPTRP00000041179  .EHSFT...E...L........PRLE........ALDLSYN----..------...............-.........
ENSPTRP00000036986  .PAALG...A...L........PLLR........SLSLQDNELAA..LAPGLL...............Gr........
ENSPTRP00000033769  .G--LE...N...H........DLLE........VINLEDNKIAE..LREIEY...............Ikn.......
ENSPTRP00000048194  .EGTFQ...G...L........ISLR........ILDLSRNLIHE..IHSRAF...............At........
ENSPTRP00000057473  .PHIFS...G...V........P-LT........KVNLKTNQFTH..LPVSNI...............Ldd.......
ENSPTRP00000002701  .KFTFA...N...T........TSLR........YLDLRNTGLQT..LDSAAL...............Yh........
ENSPTRP00000010123  .VDVFA...G...-........VSLS........KLSLHNNYFMY..LPVAGV...............Ldq.......
ENSPTRP00000017119  .AE-LE...N...M........KQLS........YLGLSFNEFTD..IPEVLE...............K.........
ENSPTRP00000004835  .RHTFR...G...L........KSLI........HLSLANNNLQT..LPKDIF...............Kg........
ENSPTRP00000025772  .FDHLH...G...Lsa......THLL........TLDLSSNRLGH..ISVPEL...............Aa........
ENSPTRP00000010123  .ANVFQ...Y...-........VPIT........HLDLRGNRLKT..LPYEEV...............Leq.......
ENSPTRP00000011064  .G--IH...V...M........KKLK........ILYMSNNLVKD..WAEFVK...............Lae.......
ENSPTRP00000027161  .DSAFE...G...L........ERLR........ELDLQRNYIFE..IEGGAF...............Dg........
ENSPTRP00000010126  .NNLFR...-...F........VPLT........HLDLRGNRLKL..LPYVGL...............Lqh.......
ENSPTRP00000054912  .KFTFR...G...L........KSLT........HLSLANNNLQT..LPRDIF...............Rp........
ENSPTRP00000034515  .SETFQ...G...L........PRLL........RLNISGNIFSS..LQPGVF...............De........
ENSPTRP00000018540  .KNALR...G...L........RSLT........HLSLANNHLET..LPRFLF...............Rg........
ENSPTRP00000057473  .PNIFR...-...F........VPLT........HLDLRGNQLQT..LPYVGF...............Leh.......
ENSPTRP00000027614  .PQAFK...D...L........KKLQ........VIDLSNNALTT..ILPMMI...............Ial.......
ENSPTRP00000024687  .PTAFS...E...C........PSLI........SIDLSSNRLSR..LDGATF...............As........
ENSPTRP00000025967  .TSLGE...T...W........ENLT........ILAVQQNQLQQ..LDPAFD...............Sm........
ENSPTRP00000026832  .TN-LF...K...A........VSLT........HLDLRGNRLKV..LFYRGM...............Ldhi......
ENSPTRP00000007855  .G--LE...D...L........SNLT........TLHLRDNQIDT..LSGFSR...............E.........
ENSPTRP00000027517  .G--CG...S...F........SSLS........VLIIDHNSVSH..PSADFF...............Qs........
ENSPTRP00000001283  .PRAWV...D...L........AHLQ........LLDIAGNQLTE..IPEGLP...............-.........
ENSPTRP00000020451  .PGAFI...N...L........PRLK........YLSICNTGIRK..FPDVTK...............Vfs.......
ENSPTRP00000006511  .SSIVQ...K...A........PNLK........ILNLSGNELKS..ERELDK...............Ik........
ENSPTRP00000012374  .D--VD...N...L........PCLQ........HLFLSFNNISS..FDSVSC...............Lad.......
ENSPTRP00000056400  .SDITE...K...A........PKVK........TLNLSKNKLES..AWELGK...............Vk........
ENSPTRP00000053355  .NEALR...Y...L........KNLA........YLDLSSNRLTT..LPPDFL...............Es........
ENSPTRP00000041711  .S--LD...A...L........VKLQ........VLSLGNNRIDN..MMNIIY...............Lrr.......
ENSPTRP00000038049  .SDITE...K...A........PKVK........ILNLSKNKLES..AWELGK...............Vk........
ENSPTRP00000050575  .ELALQ...F...L........VSLT........YLDLSSNRLTV..VSKSVFlnwpayqkcrqpdcgAe........
ENSPTRP00000008984  .LP---...L...P........ENLQ........ALHLQNNNILE..MHEDTF...............Cn........
ENSPTRP00000049006  .VWLGK...K...L........KSLR........VLNLKGNKISS..LQDISK...............Lkl.......
ENSPTRP00000060814  .QS-IG...Q...M........TSLL........YLNVSNNRLTS..NGLPVE...............Lkq.......
ENSPTRP00000004277  .QS-IG...Q...M........TSLL........YLNVSNNRLTS..NGLPVE...............Lkq.......
ENSPTRP00000027103  .PAHFS...Q...C........SNLK........ELQLHGNHLEY..IPDGAF...............Dh........
ENSPTRP00000051190  .MAPAY...L...P........RSLA........ILSLAENEIRD..LNEISF...............Las.......
ENSPTRP00000055643  .PDTFQ...G...L........ERLQ........SLHLYRCQLSS..LPGNIF...............Rg........
ENSPTRP00000001472  .PQKMK...M...M........ENLT........TLDLQNNDLLQ..IPPELG...............N.........
ENSPTRP00000004702  .AEAAR...F...L........ENLT........FLDLSSNQLMR..LPQELM...............Vs........
ENSPTRP00000013006  .NSLLA...P...L........GRLR........YLSLRNNSLRT..FTPQ--...............-.........
ENSPTRP00000043808  .RS-IG...N...L........TQLQ........TLNVKDNKLKE..LPDTLG...............E.........
ENSPTRP00000041179  .RNL--...-...P........SSLE........YLLLSYNRIVK..LAPEDL...............An........
ENSPTRP00000035210  .N--LE...G...C........EELA........KLDLTVNFIGE..LSSIKT...............Lqh.......
ENSPTRP00000011214  .PDALK...E...L........PLLK........FLGIFNTGLKM..FPDLTK...............Vys.......
ENSPTRP00000010702  .VQ-FC...Q...L........QELK........NLKLDDNELIQ..FPCKIG...............Q.........
ENSPTRP00000041754  .EGLDQ...A...L........PCLT........ELILTNNSLVE..LGDLDP...............Las.......
ENSPTRP00000050767  .PD-IG...K...L........TKLQ........ILSNRDNNLIS..LPKEIR...............V.........
ENSPTRP00000034871  .G--LE...E...L........INLT........RLNVSYNHIDD..LSGLIP...............Lhgi......
ENSPTRP00000036180  .LEPLK...K...L........ECLK........SLDLFNCEVTN..LNDYRE...............Svfkl.....
ENSPTRP00000039448  .ENVFK...L...L........PQLT........YLD--------..------...............-.........
ENSPTRP00000035343  .RS-LG...K...L........TKLT........NLNVDRNHLEA..LPPEIG...............G.........
ENSPTRP00000035630  .ADVFV...P...L........RSLK........LLNLQGNLISY..LDV---...............Pp........
ENSPTRP00000024055  .P--VS...R...C........QRLS........ELYLRRNRIPS..LAELFY...............Lkg.......
ENSPTRP00000046894  .DGAFR...A...L........RDLE........VLTLNNNNITR..LSVASF...............Nh........
ENSPTRP00000015962  .AD-FG...R...L........VNLQ........HLDLLNNKLVT..LPVSFA...............Q.........
ENSPTRP00000036078  .ANAFK...K...L........NNLT........FLYLDHNALES..VPLNL-...............-.........
ENSPTRP00000025359  .EHAFK...G...Va.......ETLQ........TLDLSDNRIQS..VHKNAF...............Nn........
ENSPTRP00000044819  .VL---...-...P........SGIE........FLDVRLNRLQS..XXXXXX...............Xxxa......
ENSPTRP00000002116  .VEALQ...N...L........KNLK........SLDLFNCEITN..LEDY--...............-.........
ENSPTRP00000053040  .GAAFQ...G...Le.......GTLR........HLDLSANQLAS..VPVEAF...............Vg........
ENSPTRP00000007526  .HTILQ...E...L........PDLE........ELFLCLNDYET..VSCPSI...............C.........
ENSPTRP00000024064  .PATFA...G...La.......GGLR........LLDLSYNRIQR..IPKDAL...............Gk........
ENSPTRP00000034772  .N--LR...S...L........KKLE........KLYLGGNYIAV..IE-GLE...............E.........
ENSPTRP00000030128  .AE-LG...N...M........VSLR........ELHLNNNLLRV..LPFELG...............K.........
ENSPTRP00000048131  .G--LH...Y...L........PSLH........ILLLHHNELTN..IDATVK...............Elkg......
ENSPTRP00000044257  .P--LA...T...C........ENLQ........SLNAAGNLLAT..PGQLQC...............Lag.......
ENSPTRP00000003094  .GQAFS...G...L........YSLK........ILMLQNNQLGG..IPAEAL...............We........
ENSPTRP00000015328  .RQTFE...S...L........PFLQ........YINLGCNLITQ..LSLGTF...............Qawhg.....
ENSPTRP00000048337  .P--LC...L...L........EQLE........VLDLEGDPVED..LGVRYL...............Ll........
ENSPTRP00000007000  sKRYIL...R...F........PALE........TLMLDDNRLSN..PSCFAS...............Lag.......
ENSPTRP00000040371  .PDAFH...F...T........PRLS........RLNLSFNALES..LSWKTV...............Q.........
ENSPTRP00000009462  .ESLYVtanH...W........PNLV........SLDLGFNDLTD..LQSMVT...............Slrt......
ENSPTRP00000015329  .RHTFE...P...L........PFLK........FINLSCNVITE..LSFGTF...............Qawhg.....
ENSPTRP00000027832  .AE-LG...N...M........VSLR........ELLLNNNLLRV..LPYELG...............R.........
ENSPTRP00000052190  .P--LQ...S...C........IKLI........KLDLHGNQIKS..LPNTKF...............Wng.......
ENSPTRP00000015874  .N--LL...D...L........PCLQ........FLDLSENLIET..LKLDEF...............-.........
ENSPTRP00000046801  .EQ-LT...A...L........PALE........TINLEENEIVD..VPVEKL...............Aa........
ENSPTRP00000014047  .G--IQ...Y...L........CSLQ........DLNLYYNNIPS..LVEVSR...............Lqp.......
ENSPTRP00000061088  .RHTFE...P...L........PFLQ........FINLGCNLLTE..LSFGTF...............Qawhg.....
ENSPTRP00000050620  .--VLP...G...L........PRLH........TLTLNKNRITD..LENLLD...............Hlaev.....
ENSPTRP00000010544  .G--VT...N...L........PRLQ........ELLLCNNRLQQ..PAVLQP...............Las.......
ENSPTRP00000027517  .---CH...P...I........VSFR........HLDLSFNDFKA..LPICKE...............Fgn.......
ENSPTRP00000028616  .G--IQ...Y...L........TALE........SLNLYYNCISS..LAEVFR...............Lha.......
ENSPTRP00000027104  .GALLD...K...M........VLLE........QLFLDHNALRG..IDQNMF...............Qk........
ENSPTRP00000005408  .SG-IG...A...H........KHLK........TLLLERNPIKM..LPVELG...............S.........
ENSPTRP00000045137  .PRAFA...K...N........PHLR........YINLSSNRLTT..LSWQLF...............Q.........
ENSPTRP00000043320  .EALAE...K...C........PNLT........HLNLRGNKIKD..LSTTEP...............Lkn.......
ENSPTRP00000028996  .AS-IA...N...L........INLR........ELDVSKNGIQE..FPENIK...............N.........
ENSPTRP00000015086  .GE-LS...S...L........PSLR........AIVARANSLKNsgVPDDIF...............K.........
ENSPTRP00000036008  .HKAFL...K...N........SNLQ........HINFTRNKLTS..LSRKHF...............R.........
ENSPTRP00000047976  .KGLP-...-...-........AKLR........VLDLSCNRLNR..APQ--P...............De........
ENSPTRP00000060126  .-----...-...-........---R........HLLLANNSLQS..VPPGAF...............Dh........
ENSPTRP00000042428  .EE-LA...A...L........QKLE........HLSVSHNNLTT..LHGELS...............S.........
ENSPTRP00000057066  .-----...-...-........---T........ELVLTGNNLTA..LPPGLL...............Da........
ENSPTRP00000060538  .RG-LL...G...L........KGLQ........VLGLSHNRIRQ..VPLNSI...............Cdtrvaq...
ENSPTRP00000047493  .FKLFQ...N...F........SNLE........IIYLSENRIS-..------...............-.........
ENSPTRP00000034915  .PE-LC...N...L........TQFQ........DLK--------..------...............-.........
ENSPTRP00000018267  .VTFFA...H...L........QKLE........VLNVLRNPLSR..VD----...............-.........
ENSPTRP00000048004  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000051241  .PAGFE...D...L........PNLQ........EVYLNNNELTA..VP----...............-.........
ENSPTRP00000061058  .PP-LC...S...A........PNLS........TPTCYQGSSEA..ACKXNK...............Lav.......
ENSPTRP00000047493  .NESFQ...G...L........QNLT........KINLNHN----..------...............-.........
ENSPTRP00000028379  .SKSLK...S...I........QNVS........HLILHMKQHIL..LLEIFV...............Dv........
ENSPTRP00000022750  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000015475  .-----...-...-........----........-----------..------...............-.........
ENSPTRP00000028379  .CLLSQ...H...L........KSLE........YLDLSENLIVE..EYLKNS...............Aceda.....


                                          110         120        130       140       150            
                                            |           |          |         |         |            
d2ifga3               GLSLQE..............LVLSGNPLHCS..CA.LRWLQRWEEEGLGGVPEQKLQCHGQGPLA-------hmpnas
ENSPTRP00000001468  CEALED..............LLLSSNMLQQL..PD.SIGLLKKLTTL-------------------------kvddnq
ENSPTRP00000034204  LAALEE..............LDVSSNRLRGL..PE.DISALRALK---------------------------ilwlsg
ENSPTRP00000050882  SKNQLT..............TLPEGIFDTNY..NL.FNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNIQTY......
ENSPTRP00000027103  ------..............-----------..--.----N-------------------------------lrqlqv
ENSPTRP00000051281  LPNLEI..............LMIGGNKVDAI..--.------------------------------------ldmnfr
ENSPTRP00000051241  MKNLKE..............LHISSDSFLCD..CQ.LKWLPPWLIGRMLQAFVTATCAHPE-----------slkgqs
ENSPTRP00000049843  LRALQY..............LRLNDNPWVCD..CR.ARPLWAWLQKFRGSSSEVPCSL--------------pqrlag
ENSPTRP00000028996  CENLQD..............LLLSSNSLQQL..PE.TIGSLKNIT---------------------------tlkide
ENSPTRP00000008989  HKYIQV..............VYLHNNNIS--..--.------------------------------------vvgssd
ENSPTRP00000051884  QTHLKE..............LILNTSSLLCD..CH.LKWLLQWLVDNNFQHSVNVSCAHP------------ewlagq
ENSPTRP00000060321  LNDLQQ..............LNLSGNNLTAL..PS.AIYNLFSLKEINF-----------------------ddnpll
ENSPTRP00000029913  MPKIRT..............LRLHSNHLYCD..CH.LAWLSDWLRQRRTVGQFTLCMAPVH-----------lrgfnv
ENSPTRP00000026857  LHHLEL..............LGLTGNHLKCL..PK.EIVNQTKLREIY------------------------lkrnqf
ENSPTRP00000017393  VNTLET..............LRVDGNPLACD..CR.LLW---------------------------------......
ENSPTRP00000008774  --QMKK..............LHLNTSSLLCD..CQ.LKWLPQWVA---------------------------en....
ENSPTRP00000025115  TPNLEI..............LMIGENPVIGI..--.------------------------------------ldmnfk
ENSPTRP00000005186  ------..............-----------..--.------------------------------------lpkeig
ENSPTRP00000001472  LSSLVR..............LNLSSNELKSL..--.------------------------------------paeinr
ENSPTRP00000002213  PDKLVT..............LRLSGNPLTCD..CR.LLW---------------------------------l.....
ENSPTRP00000051339  VGNLET..............LILDSNPLACD..CR.LLW---------------------------------......
ENSPTRP00000060625  LHRLER..............VHLNHNPWHCN..CD.VLWLSWWLK---------------------------e.....
ENSPTRP00000020782  L-----..............-----------..--.------------------------------------lklkel
ENSPTRP00000047233  LQSLTQ..............IDLEGNPWDCT..CD.LVALKLWVE---------------------------k.....
ENSPTRP00000027104  LPRLTE..............VLLGHNSWRCD..CG.LGPFLGWLRQHLGL----------------------vggeep
ENSPTRP00000035643  PRALEV..............LSINNNPLACD..CR.LLW---------------------------------......
ENSPTRP00000049653  LPALRR..............LSLHHNEL---..--.------------------------------------qalpgp
ENSPTRP00000019491  LHRLER..............VHLNHNPWHCN..CD.VLWLSWWLK---------------------------e.....
ENSPTRP00000029568  CRSLEF..............LDLSTNRLR--..--.------------------------------------slarng
ENSPTRP00000042428  LVHLQT..............LVLNGNPLL--..--.------------------------------------haqlrq
ENSPTRP00000061216  LSSLIH..............LQANSNPWECN..CK.LLGLRDWLASSAITLNIY------------------cqnpps
ENSPTRP00000033656  LRYLVE..............LHLHHNPWNCD..CD.ILWLAWWLREYIPTNSTCCGRCHAPM----------hmrgry
ENSPTRP00000014575  LGALEF..............LRLNGNPWDCG..CR.ARSLWEWLQRFRGSSSAVPCVS--------------pglrhg
ENSPTRP00000003094  NPLLQT..............IHFYDNPIQ--..--.------------------------------------fvgrsa
ENSPTRP00000015086  LVHLQT..............LVLNGNPLL--..--.------------------------------------haqlrq
ENSPTRP00000006103  LHHLER..............IHLHHNPWNCN..CD.ILWLSWWIK---------------------------d.....
ENSPTRP00000015965  AKDLRW..............LYLSENALS--..--.------------------------------------slqpga
ENSPTRP00000036080  MNALHV..............LEMSANPLD--..--.------------------------------------nngiep
ENSPTRP00000008874  LHSLET..............LDLNYNNLDEF..PT.AIRTLSNLKELG------------------------fhsnni
ENSPTRP00000047686  LPNLEI..............LMIGENPIIR-..--.------------------------------------ikdmnf
ENSPTRP00000037431  GFFLGR..............LFLFRNPWCCD..CR.LEWL--------------------------------......
ENSPTRP00000060321  LLKIKE..............LQLADNKLEV-..--.------------------------------------ishkie
ENSPTRP00000004388  CRNLEL..............LDLGYNRIR--..--.------------------------------------slarnv
ENSPTRP00000022464  LVNLRE..............LYLSHNGI---..--.------------------------------------eviegl
ENSPTRP00000020795  CRSLKF..............LDIGYNQLK--..--.------------------------------------slarns
ENSPTRP00000049653  LSQLEL..............IDLSSNPFHCD..CQ.LLPLHRWLTG--------------------------ln....
ENSPTRP00000035343  LVLLTD..............LLLSQNLLRRL..PD.GIGQ--------------------------------lkqlsi
ENSPTRP00000001283  IRSLEY..............LLLHSNQLR--..--.------------------------------------aqgihp
ENSPTRP00000061095  CPKLRK..............LVLNKNYLVTL..PE.AIHFLTEIEVLDVR----------------------enpnlv
ENSPTRP00000048194  LDNLET..............LDLNYNNLGE-..--.------------------------------------fpqaik
ENSPTRP00000036665  CRKLRY..............LDLSHNNLTFL..PA.DIGLLQNLQNLAITANR-------------------ietlpp
ENSPTRP00000011222  LSNLKQ..............LTARNNPWFCD..CS.IKWVTEWLKYIPSSLNVRGFMCQGPEQ---------vrgmav
ENSPTRP00000047055  MPRLHW..............LDLEGNHIHNL..RN.L-----------------------------------tfiscs
ENSPTRP00000001626  LQNLQH..............LHITGNKVDIL..PK.QLF---------------------------------kciklr
ENSPTRP00000017670  TITQGK..............LFFHYNPKLCL..SE.------------------------------------ihkmee
ENSPTRP00000053783  LDRLLE..............LKLQDNELRAL..PP.LRLPRLLLLD--------------------------lshnsl
ENSPTRP00000012792  ------..............-----------..--.------------------------------------ilgeeq
ENSPTRP00000013006  LLGLRV..............LRLSHNAI---..--.------------------------------------aslrpr
ENSPTRP00000042859  LENLLL..............LDLQHNRL---..--.------------------------------------sdgvfk
ENSPTRP00000007033  LPRLTH..............LNLSRNSLTCI..SD.FSLQQLR-----------------------------vldlsc
ENSPTRP00000042754  LRNMNC..............IEMGGNPL---..--.------------------------------------ensgfe
ENSPTRP00000022750  LDNITQ..............LILRNNPWYCG..CK.MKWVRDWLQSLPVKVNVRGLMCQAPEK---------vrgmai
ENSPTRP00000001624  CNKIRY..............LDLSYNDIRFI..PP.EIGVLQSLQYFSI-----------------------tcnkve
ENSPTRP00000017533  WDMRDG..............FDISGNPWICD..QN.LSDLYRWLQAQKDKMFSQNDTRCAGPE---------avkgqt
ENSPTRP00000031252  LTSLTD..............LVISQNLL---..--.------------------------------------etipdg
ENSPTRP00000036079  LPKLRT..............LRMSHNKLQDI..PY.NIFNLPN-----------------------------ivelsv
ENSPTRP00000003137  APKLLY..............VRLSHNSLT--..--.------------------------------------nnglas
ENSPTRP00000009804  LNSLFF..............LSMVNNYLEA-..--.------------------------------------lpkqmc
ENSPTRP00000059190  SPAPLV..............LSFSGNPLHCN..CE.LLWLRRLA----------------------------rpddle
ENSPTRP00000018046  PRTLAI..............LHLGRNRIR--..--.------------------------------------qveaar
ENSPTRP00000048004  LGNLAQ..............LLLRNNPWFCG..CN.LMWLRDWVKARAAVVNVRGLMCQGPEK---------vrgmai
ENSPTRP00000041179  ASALQI..............LDVSANPLHCA..C-.------------------------------------g.....
ENSPTRP00000017706  CRKLRT..............LLLGDNQLSQL..--.------------------------------------sphvga
ENSPTRP00000053173  SHLLPF..............AFLHGNPWLCN..CE.ILYFRRWLQDNA------------------------envy..
ENSPTRP00000008987  FNALQY..............LRLSHNEL---..--.------------------------------------adsgip
ENSPTRP00000008254  LENLTS..............LDVSYNL----..--.------------------------------------elrsfp
ENSPTRP00000036082  LNQLVT..............LELEGNNLS--..--.------------------------------------eanvnp
ENSPTRP00000060795  WDMRDG..............FDISGNPWICD..QN.LSDLYRWLQAQKDKMFSQNDTRCAGPE---------avkgqt
ENSPTRP00000032807  L-----..............-----------..--.------------------------------------rslkei
ENSPTRP00000055467  MVSLHT..............LSLDHNMIDN-..--.------------------------------------ipkgtf
ENSPTRP00000022026  ------..............VYVDQNKFLCY..AD.TI----------------------------------hwqdiv
ENSPTRP00000047494  LNNLKM..............LLLHHNRFLCT..CD.AVWF--------------------------------......
ENSPTRP00000046894  ------..............-----------..--.-----------------------------------Lyldgnq
ENSPTRP00000008986  LENLTL..............LDLQNNKLV--..--.------------------------------------dnafqr
ENSPTRP00000047783  QGRALH..............VDLSHNLIHR-..--.------------------------------------lvpdpt
ENSPTRP00000014225  LQQLSS..............LGISFNNFSQI..PE.VYEKLTML----------------------------drvvma
ENSPTRP00000026754  MPDLDS..............LYLHGNPWTCD..CH.LKWLSDWIQEKPDVIKCK------------------kdrsps
ENSPTRP00000028569  FRNLTE..............LDMRFNPFDCT..CEsIAWFVNWINETNTNIPELSSHYLCNTPP--------hyhgfp
ENSPTRP00000022026  EISAGN..............IYITDNSNLCY..YH.TINWTTLFSTINQRIVI-------------------rdnrka
ENSPTRP00000028569  LENLQE..............LLLSNNKI---..--.------------------------------------qalkse
ENSPTRP00000017119  LEELEE..............IDLSGNKLKAI..PT.TIMNCRRMH---------------------------tviahs
ENSPTRP00000047493  TTKLSM..............LELHGNPFECT..CD.I-----------------------------------g.....
ENSPTRP00000018633  LHKLAR..............LDMTSNRLTTI..PP.DPLFSR------------------------------lpllar
ENSPTRP00000020457  SLQKVL..............LDIQDNI----..--.------------------------------------nihtie
ENSPTRP00000035431  LASLQV..............LRLTENPWRCD..CA.LHWLGAWIKEGGQR----------------------lltsrd
ENSPTRP00000017670  ------..............-----------..--.------------------------------------ynlmni
ENSPTRP00000029007  LSQQST..............INLSHNPLDCT..CS.NIHFLTWYKENLHKLEGSEETTCANPPS--------lrgvkl
ENSPTRP00000022692  SSQVLS..............INLFGNPLTCS..CD.LSWLL-------------------------------t.....
ENSPTRP00000032807  -----A..............VRFSNNPALCN..VE.SIQWRD------------------------------ivssdf
ENSPTRP00000003935  LTQLKE..............LHIQGNRLTVL..P-.------------------------------------pelgnl
ENSPTRP00000030995  LQKLAR..............LDLTSNRLQKL..PP.DP----------------------------------ifarsq
ENSPTRP00000029913  LVSLST..............INLLSNPFNCN..CH.LAWLGKWLRKRRIVSGNPRCQKP-------------fflkei
ENSPTRP00000014225  CKRLHT..............LVAHSNNI---..--.------------------------------------sifpei
ENSPTRP00000005186  LENLEE..............LYLNDNP----..--.------------------------------------nlhslp
ENSPTRP00000037057  MPLLEN..............LYLQGNPWTCD..CE.MRWFLEW-----------------------------......
ENSPTRP00000015508  ------..............-LIQRNPQLCY..QD.TILWKDIFHKN-------------------------nqlalt
ENSPTRP00000012792  ------..............-----------..--.------------------------------------ynlrni
ENSPTRP00000015508  ------..............-----------..--.------------------------------------glrslr
ENSPTRP00000018786  PPTPLT..............VSFGGNPLHCN..CE.LLWLRRLTR---------------------------eddlet
ENSPTRP00000025606  MSNLQW..............LDISSNNLTDL..PQ.DIDRLEELQSFLLYKNKLT-----------------ylpysm
ENSPTRP00000012830  LRKLQE..............LDISDNKLTEL..PA.LF----------------------------------lhsfks
ENSPTRP00000034664  LDSLKR..............LRLDSNALVCD..CD.LMWLKELLQGFAQHGHTQAAATCEYP----------rrlhgr
ENSPTRP00000026322  LIHLEE..............LSLRGNPL---..--.------------------------------------vvrfvr
ENSPTRP00000008962  CYSLHE..............LSLTGNPLLQ-..--.------------------------------------etnwrd
ENSPTRP00000046894  LRAIQT..............MHLAQNPFICD..CH.LKWLADYLHTNPIETSGARCTSP-------------rrlank
ENSPTRP00000031403  LQGLPHir............VFLDNNPWVCD..CH.MADMVTWLKETEVVQGKDRLTCAYPEK---------mrnrvl
ENSPTRP00000015314  LFQLQE..............ITLYNNRWSCDhkQN.ITYLLKWMMETKAHVIGTPCST--------------qiss..
ENSPTRP00000027161  ARNITT..............LDMSHNQIS--..--.------------------------------------lcplpa
ENSPTRP00000044034  LSALSH..............LQLYHNPFHCG..CG.LVWLQAWAASTRVSLPEPDSIACASPPA--------lqgvpv
ENSPTRP00000033466  LYFLKL..............LWLRDNPWRCD..YN.IHYLYYWLKH--------------------------h.....
ENSPTRP00000027515  ------..............-----------..--.------------------------------------eeagnm
ENSPTRP00000008874  LPSLIK..............LDLSSNLL---..--.------------------------------------ssfpit
ENSPTRP00000001496  LKQLIL..............LSLDKNQWSCT..CD.LHPLARFLRNYIKS----------------------sahtlr
ENSPTRP00000000339  LPALRS..............LRLDGNPWLCD..CD.FAHLFSWIQENASKLPKGLDEIQC------------slpmes
ENSPTRP00000027516  MSQLKF..............LGLSTTHL---..--.------------------------------------ekssvl
ENSPTRP00000049501  LKELIF..............LHVGSNRL---..--.------------------------------------eniaes
ENSPTRP00000007737  LANLQL..............LQVGDNPWECD..CN.LREFKHWMEWFSYRGGRLDQLACT------------lpkelr
ENSPTRP00000027179  LRHLME..............LDVSCNEIQTI..PS.QIGNLEALRDLNVRRN--------------------hlvhlp
ENSPTRP00000033370  LGSLRQ..............LDVSSNELQSL..PS.ELCGLSSLRDLNVR----------------------rnqlst
ENSPTRP00000011913  LRHLDV..............MDLSKNQIRSI..PD.SVGELQVI----------------------------elnlnq
ENSPTRP00000041364  LSLLKT..............LHAGSNALRLL..PG.QLRRLQELR---------------------------tiwlsg
ENSPTRP00000012439  LTALSH..............LQINDNPFDCT..CG.IVWLKTWALTTAVSIPEQDNIACTSPH---------vlkgtp
ENSPTRP00000002493  TIPVGK..............IYFAFNPRLCL..EH.I-----------------------------------yrleev
ENSPTRP00000009963  LKQLME..............LDVSCNEITAL..PQ.QIGQLKSLRELNVRRN--------------------ylkvlp
ENSPTRP00000047494  INKLQE..............LDLSQNFLAKE..IG.DAKFLHFLPN--------------------------liqldl
ENSPTRP00000029007  ARNLKV..............LDFQNNAIH--..--.------------------------------------yisred
ENSPTRP00000012803  LKELQT..............LDISTNRLLTL..PE.RLHMCLSLQYLTVD----------------------rnrlwy
ENSPTRP00000002493  M-----..............-----------..--.------------------------------------phlrdv
ENSPTRP00000006306  LPGLVT..............LQIGGNPWVCG..CT.MEPLLKWLRN--------------------------r.....
ENSPTRP00000052915  CPKLKE..............INFRGNK----..--.------------------------------------lrdkrl
ENSPTRP00000047302  LKDLME..............LDISCNEIQVL..PQ.QMGKLHSLRELNIRR---------------------nnlhvl
ENSPTRP00000031252  CESLTE..............LVLTENQLLTL..PK.SIGKLKKLSNLNA-----------------------drnklv
ENSPTRP00000027465  LASLRS..............LEFQTEYLLCD..CN.ILWMHRWVKEKNITVRDTRCVYP-------------ks....
ENSPTRP00000026832  LNAIVQ..............IDLNENPWDCT..CD.LVPFKQWIETISSVSVVGDVLCRSPEN---------lthrdv
ENSPTRP00000008307  GKQLRG..............IYLHGNPFVCD..CS.LYSLLVFWYRRHFSSVM-------------------dfkndy
ENSPTRP00000027477  LDSLIE..............LDLRGNKFECD..CK.AKWLYLWLKMTNSTVSDVLCIGPPE-----------yq....
ENSPTRP00000047493  LPRLEI..............LDLSFNYI---..--.------------------------------------kgsyp.
ENSPTRP00000001819  LPAWIKng............LYLHNNPLNCD..CE.LYQLFSHWQYRQLSSV--------------------mdfqed
ENSPTRP00000010126  LKSLIQ..............IDLHDNPWDCT..CD.IVGMKLWVEQLKVGVLVDEVICKAP-----------kkfaet
ENSPTRP00000041179  ------..............-----------..--.------------------------------------s.....
ENSPTRP00000036986  LPALDA..............LHLRGNPWGCG..CA.LRPLCAWLRRHPLPAS--------------------eaetvl
ENSPTRP00000033769  LPILRV..............LNLLKNPIQEK..SE.YWFFV-------------------------------ifmllr
ENSPTRP00000048194  LGPITN..............LDVSFNELT--..--.------------------------------------sfpteg
ENSPTRP00000057473  LDLLTQ..............IDLEDNPWDCS..CD.LVGLQQWIQKLSKNTVTDDILCTSPG----------hldkke
ENSPTRP00000002701  LTTLET..............LFLSGNPWKCN..CS.FLDFAIFLIVFHMDPSDDLNATCVEPT---------eltgwp
ENSPTRP00000010123  LTSIIQ..............IDLHGNPWECS..CT.IVPFKQWAERLGSEVLMSDLKCE-------------tpvnff
ENSPTRP00000017119  LTAVDK..............LCMSGNCM---..--.------------------------------------etlrlq
ENSPTRP00000004835  LDSLTN..............VDLRGNSFNCD..CK.LKWLVEWLGHTNATVEDIYCEGPP------------eyk...
ENSPTRP00000025772  LPAFLKng............LYLHNNPLPCD..CR.LYHLLQRWHQ--------------------------rg....
ENSPTRP00000010123  IPGIAE..............ILLEDNPWDCT..CD.LLSLKEWLENIPKNALIGRVVCEAPT----------rlqgkd
ENSPTRP00000011064  LPCLED..............LVFVGNPL---..--.------------------------------------eekhsa
ENSPTRP00000027161  LPELRH..............LNLAFNNLPCI..VD.FGLTQLRVLNVSYNVLEW------------------flaaga
ENSPTRP00000010126  MDKVVE..............LQLEENPWNCS..CE.LISLKDWLDSISYSALVGDVVCETP-----------frlhgr
ENSPTRP00000054912  LDILND..............LDLRGNSLNCD..CK.VKWLVEWLAHTNTTVAPIYCASP-------------prf...
ENSPTRP00000034515  LPALKV..............VDLGTEFLTCD..CH.LRWLLPWAQNRSLQLSEHTLCA--------------yp....
ENSPTRP00000018540  LDTLTH..............VDLRGNPFQCD..CR.VLWLLQWMPTVNASVGTGACAG--------------pas...
ENSPTRP00000057473  IGRILD..............LQLEDNKWACN..CD.LLQLKTWLENMPPQSIIGDVVCNSPP----------lfkgsi
ENSPTRP00000027614  EFPHLV..............VDLADNNWQCD..DS.------------------------------------vaif..
ENSPTRP00000024687  LASLMV..............CELAGNPFNCE..CD.LFGFLAWLVVFNNVTKNYDRLQCESPR---------efagyp
ENSPTRP00000025967  PRYLGP..............RLLKDNLWKCN..CH.LLGLKLWLEKFVYKGGKTDGIICESP----------dtwkgk
ENSPTRP00000026832  GRSLME..............LQLEENPWNCT..CE.IVQLKSWLERIPYTALVGDITCETP-----------fhfhgk
ENSPTRP00000007855  MKSLQY..............LNLRGNMVADL..GE.LAKLRD------------------------------lpklra
ENSPTRP00000027517  CQKMRS..............IKAGDNPFQCT..CE.LRQFVKSIDQVSS-----------------------evlegw
ENSPTRP00000001283  -ESLEY..............LYLQNNKIS--..--.------------------------------------avpana
ENSPTRP00000020451  SESNFI..............LEICDN-----..--.------------------------------------lhitti
ENSPTRP00000006511  GLKLEE..............LWLDGNSLCD-..--.------------------------------------tfrdqs
ENSPTRP00000012374  SSSLSD..............ITFDGNPIA--..--.------------------------------------qeswyk
ENSPTRP00000056400  GLKLEE..............LWLEGNPLC--..--.------------------------------------stfldq
ENSPTRP00000053355  WTHLVStpsgvldlspsriiLGLQDNPWFCD..CH.ISKMIELSKVIDPAIVLLDPLMTCSE----------perltg
ENSPTRP00000041711  FKCLRT..............LSLSRNPISEA..ED.YKM---------------------------------ficayl
ENSPTRP00000038049  GLKLEE..............LWLEGNPLCST..FS.------------------------------------dqsayv
ENSPTRP00000050575  ILSSLV..............VALHDNPWVCD..CR.LRGLVQFVKSITLPVILVNSYLICQGP---------lskagq
ENSPTRP00000008984  VKNLTY..............-----------..--.------------------------------------irkale
ENSPTRP00000049006  LQDLIS..............LILVENPVVTL..PH.YLQFTIFHLR--------------------------slesle
ENSPTRP00000060814  LKNIRT..............VNLGLNHLDSV..PT.TL----------------------------------galkel
ENSPTRP00000004277  LKNIRT..............VNLGLNHLDSV..PT.TL----------------------------------galkel
ENSPTRP00000027103  LVGLTK..............LNLGKNSLT--..--.------------------------------------his...
ENSPTRP00000051190  LTELEQ..............LSIMNNPCV--..--.------------------------------------matpsi
ENSPTRP00000055643  LVSLQY..............LYLQENSL---..--.------------------------------------lhlqgk
ENSPTRP00000001472  CVNLRT..............LLLDGNPF---..--.------------------------------------r.....
ENSPTRP00000004702  WAHLKTgifppghhprlv..LGLQDNPWACD..CR.LYDLVHLLDGWAPNLAFIETEL--------------rcaspr
ENSPTRP00000013006  PPGLER..............LWLEGNPWDCG..CP.LKALRDFALQNPSAVPRFVQAIC-------------eg....
ENSPTRP00000043808  LRSLRT..............LNISGNEIQRL..PQ.MLAHVRTL----------------------------emlsld
ENSPTRP00000041179  LTALRV..............LDVGGNCRRC-..--.------------------------------------d.....
ENSPTRP00000035210  NIHLKE..............LFLMGNPCA--..--.------------------------------------sfdhyr
ENSPTRP00000011214  TDIFFI..............LEITDNPYMTS..IP.VNAFQGLCNETLTL----------------------klynng
ENSPTRP00000010702  LINLRF..............LSAARNKLP--..--.------------------------------------flpsef
ENSPTRP00000041754  LKSLTY..............LSILRNPVTNK..KH.YRLYVI------------------------------ykvpqv
ENSPTRP00000050767  LIQLKE..............LHIQGNCLT--..--.------------------------------------vlppe.
ENSPTRP00000034871  KHKLRY..............IDLHSNRVDSI..HH.LLQ---------------------------------cmvglh
ENSPTRP00000036180  LPQLTY..............L----------..--.------------------------------------dgydre
ENSPTRP00000039448  ------..............-----------..--.------------------------------------gydrdd
ENSPTRP00000035343  CVALSV..............LSLRDNRLAVL..--.------------------------------------ppelah
ENSPTRP00000035630  LFHLEL..............ITLYGNLWNCS..CS.LFNLQNWLNTSNVTLENENITMCSYPN---------slqsyn
ENSPTRP00000024055  LPRLRV..............LWLAENPCCGT..SP.HRYRMTVLRTL-------------------------prlqkl
ENSPTRP00000046894  MPKLRT..............FRLHSNNLYCD..CH.LAWLSDWLRQRPRVGLYTQCMGP-------------sh....
ENSPTRP00000015962  LKNLKW..............LDLKDNPLD--..--.------------------------------------pvl...
ENSPTRP00000036078  PESLRV..............IHLQFNNIA--..--.------------------------------------sitddt
ENSPTRP00000025359  LKA--R..............ARIANNPWHCD..CT.LQQVLRSMASNHETAHNVICK---------------ts....
ENSPTRP00000044819  MEKLQF..............LYLSDNLLDSI..PG.PLPLSL------------------------------rsvhlq
ENSPTRP00000002116  ------..............-----------..--.------------------------------------resife
ENSPTRP00000053040  LQ--IQ..............VNLSANPWHCD..CA.LQEVLRQ-----------------------------vrlvp.
ENSPTRP00000007526  CHSLKL..............LHITDNNLQDW..TE.IR----------------------------------klgvmf
ENSPTRP00000024064  LSA--K..............IRLSHNPLHCE..CA.LQEALWELKLDPDSVDEIAC----------------htsv..
ENSPTRP00000034772  LGELRE..............LHVEN------..--.------------------------------------qrlplg
ENSPTRP00000030128  LFQLQT..............LGLKGNPLTQD..--.------------------------------------ilnlyq
ENSPTRP00000048131  MLNLKI..............LSLYQNPL---..CQ.YNLYRLY-----------------------------iiyhlp
ENSPTRP00000044257  LPCLEY..............LRLRD------..--.------------------------------------plarls
ENSPTRP00000003094  LPSLQS..............LVIRG------..--.------------------------------------lvwesp
ENSPTRP00000015328  MQFLHN..............LILNRNPLTTV..--.------------------------------------edpylf
ENSPTRP00000048337  CPRLAM..............LTLEGNL----..--.------------------------------------vclqpa
ENSPTRP00000007000  LRRLKK..............LSLDENRIIRI..PY.------------------------------------lqqvql
ENSPTRP00000040371  GLSLQE..............LVLSGNPLHCS..CA.LRWLQRWEEEGLGGVPEQKLQCHG------------qgpl..
ENSPTRP00000009462  LRHLRL..............LVLQGNPLA--..--.------------------------------------lvpyyr
ENSPTRP00000015329  MQFLHK..............LILNHNPLTTV..ED.PY----------------------------------lfklpa
ENSPTRP00000027832  LFQLQT..............LGLKGNPLSQ-..--.------------------------------------dilnly
ENSPTRP00000052190  LKNLKL..............LYLHDNGFAKL..K-.------------------------------------nicvls
ENSPTRP00000015874  PQSLLI..............LNLSGNSC---..--.------------------------------------tnqdgy
ENSPTRP00000046801  MPALRS..............INLRFNPL---..--.------------------------------------n.....
ENSPTRP00000014047  LPFLKE..............LDLRLNPVV--..--.------------------------------------rkdtdy
ENSPTRP00000061088  MQFLHK..............LILNRNPLTTV..ED.PYLF--------------------------------klsafk
ENSPTRP00000050620  TPALEY..............LSLLGN-----..--.------------------------------------vacpne
ENSPTRP00000010544  CPRLVL..............LNLQGNPLC--..--.------------------------------------qavgil
ENSPTRP00000027517  LSQLNF..............LGLS-------..--.------------------------------------amklqk
ENSPTRP00000028616  LTELVD..............VDFRLNPVVKV..EP.D-----------------------------------yrlfvv
ENSPTRP00000027104  LVNLQE..............LALNQNQL---..--.------------------------------------d.....
ENSPTRP00000005408  VTTLKA..............LNLRHCPLE--..--.------------------------------------fppql.
ENSPTRP00000045137  TLSLRE..............LQLEQNFFNCS..CD.IRWMQLWQEQGEAKLNSQNLY---------------ci....
ENSPTRP00000043320  LEDLKS..............LDLF-------..--.------------------------------------n.....
ENSPTRP00000028996  CKVLTI..............VEASVNPIS--..--.------------------------------------klp...
ENSPTRP00000015086  LDDLSV..............LDLSHNQLT--..--.------------------------------------ec....
ENSPTRP00000036008  HLDLSE..............LILVGNPFTCS..CD.IMWIKT------------------------------lqeak.
ENSPTRP00000047976  LPEVDN..............LTLDGNPF---..--.------------------------------------lvp...
ENSPTRP00000060126  LPQLQT..............LDVTQNPWHCD..CS.LTYLRLWLEDRTP-----------------------eallqv
ENSPTRP00000042428  LPSLRA..............IVARANSL---..--.------------------------------------knsgvp
ENSPTRP00000057066  LPALRT..............AHLGANPWRCD..CR.LVPLRAWLAGRPERAPYRDLRCVAP-----------p.....
ENSPTRP00000060538  DSNLIS..............THLENNLF---..--.------------------------------------drrrip
ENSPTRP00000047493  ------..............-----------..--.------------------------------------plvk..
ENSPTRP00000034915  ---LRE..............FYCEGNPL---..--.------------------------------------flqq..
ENSPTRP00000018267  ------..............-----------..--.------------------------------------galaar
ENSPTRP00000048004  ------..............-----------..--.------------------------------------de....
ENSPTRP00000051241  ------..............-----------..--.------------------------------------......
ENSPTRP00000061058  LPRLRS..............LTLHGNPM---..--.------------------------------------eeekgy
ENSPTRP00000047493  ------..............-----------..--.------------------------------------p.....
ENSPTRP00000028379  TSSVEC..............LELRDTDL---..--.------------------------------------d.....
ENSPTRP00000022750  ------..............-----------..--.------------------------------------......
ENSPTRP00000015475  ------..............-----------..--.------------------------------------......
ENSPTRP00000028379  WPSLQT..............LILRQNHL---..--.------------------------------------asl...


                                                                                                    
                                                                                                    
d2ifga3               c.............................................................................
ENSPTRP00000001468  ltmlpntignlslleefdcscneleslpstigylhslrtlavdenflpelpreigscknvtvmslrsnkleflpeeig
ENSPTRP00000034204  aelgtlpagfcelasleslmldnnglqalpaqfsclqrlkmlnlssnlfeefpaallplagleelylsrnqltsvpsl
ENSPTRP00000050882  ..............................................................................
ENSPTRP00000027103  lilsrnqisfispgafngltelrelslhtnalqdldgnvfrmlanlqnislqnnrlrqlpgnifanvnglmaiqlqnn
ENSPTRP00000051281  planlrslvlagmnlreisdyaleglqsleslsfydnqlarvprraleqvpglkfldlnknplqrvgpgdfanmlhlk
ENSPTRP00000051241  i.............................................................................
ENSPTRP00000049843  rdlkrlaandlq..................................................................
ENSPTRP00000028996  nqlmylpdsigglisveeldcsfnevealpssigqltnlrtfaadhnylqqlppeigswknitvlflhsnkletlpee
ENSPTRP00000008989  fcppghntkkasysgvslfsnpvqyweiqpstfrc...........................................
ENSPTRP00000051884  sil...........................................................................
ENSPTRP00000060321  rppmeickgkqlyti...............................................................
ENSPTRP00000029913  advqkkeyvcpaphleppscnansiscpspctcsnnivdcrgkglmeipanlpegiveirleqnsikaipagaftqyk
ENSPTRP00000026857  evfpqelcvlytleiidldenkigaipeeighltglqkfymasnnlpvlpaslcqcsqlsvldlshnllhsipkslae
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  ..............................................................................
ENSPTRP00000025115  planlrslvlagmyltdipgnalvgldsleslsfydnklvkvpqlalqkvpnlkfldlnknpihkiqegdfknmlrlk
ENSPTRP00000005186  nctqitnldlqhnelldlpdtignlsslsrlglrynrlsaiprslakcsaleelnlennnistlpesllsslvklnsl
ENSPTRP00000001472  mkrlkhldcnsnlletippelagmeslellylrrnklrflpefpscsllkelhvgenqiemleaehlkhlnsilvldl
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  hlehnqfskinfahfprlfnlrsiylqwnrirsisqgltwtwsslhnldlsgndiqgiepgtfkclpnlqklnldsnk
ENSPTRP00000047233  ..............................................................................
ENSPTRP00000027104  prcagpgahaglpl................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  vlsqarglarlelghnpltyageedglalpglrellldggalqalgprafahcprlhtldlrgnqldtlpplqgpgql
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  fagliklrelhlehnqltkinfahflrlsslhtlflqwnkisnltcgmewtwgtlekldltgneikaidltvfetmpn
ENSPTRP00000042428  lpamtalqtlhlrstqrtqsnlptsleglsnladvdlscndltrvpeclytlpslrrlnlssnqitelslcidqwvhv
ENSPTRP00000061216  mrgralryini...................................................................
ENSPTRP00000033656  lvevdqasfqc...................................................................
ENSPTRP00000014575  qdlkl.........................................................................
ENSPTRP00000003094  fqylpklhtlslngatdiqefpdlkgttsleiltltragirllpsgmcqqlprlrvlelshnqieelpslhrcqklee
ENSPTRP00000015086  lpamtalqtlhlrstqrtqsnlptsleglsnladvdlscndltrvpeclytlpslrrlnlssnqitelslcidqwvhv
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  lddvenlakfhvdrnqlssypsaalsklrvveelklshnplksipdnafqsfgryletlwldntnlekfsdgaflgvt
ENSPTRP00000036080  gafegvtvfhiriaeakltsvpkglpptllelhldynkistveledfkrykelqrlglgnnkitdiengslaniprvr
ENSPTRP00000008874  rsipekafvgnpslitihfydnpiqfvgrsafqhlpelrtltlngasqitefpd........................
ENSPTRP00000047686  kplinlrslviaginlteipdnalvglenlesisfydnrlikvphvalqkvvnlkfldlnknpinrirrgdfsnmlhl
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  nfrelrilildknllknipekisccamleclslsdnkltelpkyihklnnlrklhvnrnnmvkitdsishlnnicsle
ENSPTRP00000004388  fagmirlkelhlehnqfsklnlalfprlvslqnlylqwnkisvigqtmswtwsslqrldlsgneieafsgpsvfqcvp
ENSPTRP00000022464  ennnkltmldiasnrikkienishltelqefwmndnlleswsdldelkgarsletvylernplqkdpqyrrkvmlalp
ENSPTRP00000020795  faglfkltelhlehndlvkvnfahfprlislhslclrrnkvaivvssldwvwnlekmdlsgneieymephvfetvphl
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  lkvdqnrlce....................................................................
ENSPTRP00000001283  lafqglkrlhtvhlynnalervpsglprrvrtlmilhnqitgigredfattyfleelnlsynritspqvhrdafrklr
ENSPTRP00000061095  mppkpadraaewynid..............................................................
ENSPTRP00000048194  alpslkelgfhsnsisvipdgafdgnpllrtihlydnplsfvgnsafhnlsdlhslvirgasmvqqfpn.........
ENSPTRP00000036665  elfqcrklralhlgnnvlqslpsrvgeltnltqielrgnrleclpvelgecpllkr......................
ENSPTRP00000011222  relnmnllsc....................................................................
ENSPTRP00000047055  nltvlvmrknkinhlnentfaplqkldeldlgsnkienlpplifkdlkelsqlnlsynpiqkiqanqfdylvklksls
ENSPTRP00000001626  tlnlgqncitslpekvgqlsqltqlelkgncldrlpaqlglcrmlkk...............................
ENSPTRP00000017670  vsgtkgrqerndialktngdqascene...................................................
ENSPTRP00000053783  lalepgildtanvealrlaglglqqldeglfsrlrnlhdldvsdnqlervppvirglrgltrlrlagntriaqlrped
ENSPTRP00000012792  legnysfyvldnqnlqqlwdwdhrnltikagkmyfafnpklcvseiyrmeevtgtkgrqskgdintrnngerascesd
ENSPTRP00000013006  tfkdlhfleelqlghnrirqlaersfeglgqlevltldhnqlhivkagaflgl.........................
ENSPTRP00000042859  pdtfhglknlmqlnlahnilrkmpprvptaihqlyldsnkietipngyfksfpnlafirlnynkltdrglpknsfnis
ENSPTRP00000007033  nsieafqtasqpqaefqltwldlrenkllhfpdlaalprliylnlsnnlirlptgppqdskgihapsegwsalplsap
ENSPTRP00000042754  pgafdglklnylriseakltgipkdlpetlnelhldhnkiqaieledllrysklyrlglghnqirmiengslsflptl
ENSPTRP00000022750  kdlnaelfdc....................................................................
ENSPTRP00000001624  slpdelyfckklktlkigknslsvlspkignllflsyldvkgnhfeilppelgdcralkra.................
ENSPTRP00000017533  llav..........................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ghnklkqafyiprnlehlylqnneiekmnltvmcpsidplhyhhltyirvdqnklkepissyiffcfphih.......
ENSPTRP00000003137  ntfnssslleldlsynqlqkippvntnlenlylqgnrinefsissfctvvdvvnfsklqvlrldgneikrs.......
ENSPTRP00000009804  aqmpqlnwvdlegnrikyltnstflscdsltvlflprnqigfvpektfsslknlgeldlssnmitelsphlfkdlkll
ENSPTRP00000059190  tcasppglagryfwavpegefsceppli..................................................
ENSPTRP00000018046  lhgarglrylllqhnqlgssglpagalrplrglhtlhlygngldrvppalprrlralvlphnhvaalgardlvatpgl
ENSPTRP00000048004  kdit..........................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  lralsrlelkgnrlealpeelgncgglkk.................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  gnsfnvsslveldlsynklkniptvnenlenyylevnqlekfdvksfckilgplsyskikhlrldgnrisetslppdm
ENSPTRP00000008254  nemgklskiwdlpldelrlnfdfkhig...................................................
ENSPTRP00000036082  lafkplkslaylrlgknkfriipqglpgsieelylennqieeiteicfnhtrkinvivlrynkieenriaplawinqe
ENSPTRP00000060795  llav..........................................................................
ENSPTRP00000032807  sdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspegcwgpep..............
ENSPTRP00000055467  shlhkmtrldvtsnklqklppdplfqraqvlatsgiispstfalsfggnplhcncellwlrrlsreddletcasppll
ENSPTRP00000022026  rnpwpsnltlvstngssgcgrchksctgrcwgptenhcqt......................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  ftlvpkelsnykhltlidlsnnristlsnqsfsnmtqlltlilsynrlrcipprtfdglkslrllslhgndisvvpeg
ENSPTRP00000008986  dtfkglknlmqlnmaknalrnmpprlpantmqlfldnnsiegipenyfnvipkvaflrlnhnklsdeglpsrgfdvss
ENSPTRP00000047783  raglpaptiqslnlawnrlhavpnlrdlplrylsldgnplavigpgaftglgglthlslaslqrlpelapngfrelpg
ENSPTRP00000014225  gnclevlnlgvlnrmnhikhvdlrmnhlktmvienlegnkhithvdlrdnrltdldlsslcsleqlhcgrnqlreltl
ENSPTRP00000026754  saqqcplcmnprtskgkplamvsaaafqcakp..............................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  enctaegmvcnhlcssdgcwgpgp......................................................
ENSPTRP00000028569  eldifansslkklelssnqikefspgcfhaigrlfglflnnvqlgpslteklclelantsirnlslsnsqlsttsntt
ENSPTRP00000017119  ncievfpevmqlpeikcvdlscnelsevtlpenlppklqeldltgnprlvldhktl......................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  prgspasalvlafggnplhcncelvwlrrlareddleacasppalggryfwavgeeefvceppvvt............
ENSPTRP00000020457  rnsfvglsfesvilwlnkngiqeihncafngtqldelnlsdnnnleelpndvfhgasgpvildisrtrihslpsygle
ENSPTRP00000035431  rkimcaepprlalqslldvshsslicippsvhv.............................................
ENSPTRP00000017670  trgsvrieknnelcylatidwsrildsvednyivlnkddneecgdicpgtakgkt.......................
ENSPTRP00000029007  sd............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  lsnmsmdfqnhlgscqkcdpscpngscwgageencqk.........................................
ENSPTRP00000003935  dltgqkqvfkaennpwvtpi..........................................................
ENSPTRP00000030995  asaltatpfapplsfsfggnplhcncellwlrrlerdddletcgspgglkgryfwhvreeefvc..............
ENSPTRP00000029913  piqdvaiqdftcdilsynrlrcipvhafnglrslrvltlhgndissvpegsfndltslshlalgtnplhcdc......
ENSPTRP00000014225  lqlpqiqfvdlscndlteilipealpatlqdldltgntnlvlehktldifshittlkid...................
ENSPTRP00000005186  felalcsklsimsiencplshlpp......................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  lidtnrsrachpcspmckgsrcwgessedcqs..............................................
ENSPTRP00000012792  trgairieknadlcylstvdwslildavsnnyivgnkppkecgdlcpgtmee..........................
ENSPTRP00000015508  elgsglalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgeglachqlcarghcwgpgp............
ENSPTRP00000018786  catpehltdryfwsipeeeflcepplit..................................................
ENSPTRP00000025606  lnlkkltllvvsgdhlvelptalcdsstplkfvslmdnpidn....................................
ENSPTRP00000012830  lnslnvsrnnlkvfpdpwacplkcckasrnaleclpdkmavfwknhlkdvdfsenalkevplglfqldalmflrlqgn
ENSPTRP00000034664  avasvtveefncqspritf...........................................................
ENSPTRP00000026322  dltydpptllelaartikirnisytpydlpgnllrylgsasncpn.................................
ENSPTRP00000008962  sllkvlpalrilngniln............................................................
ENSPTRP00000046894  rigqikskkfrc..................................................................
ENSPTRP00000031403  lelnsadldc....................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  asdrvgppscvdfrnmaslrslslegcglgalpdcpfqgtsltyldlssnwgvlngsltplqdvapmlqvlslrnmgl
ENSPTRP00000044034  yrlpalp.......................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  shleilglsgakiqksdfqkiahlhlntvflgfrtlshyeegslpilnttklhivlpmdtnfwvllrdgiktskilem
ENSPTRP00000008874  glhglthlkltgnhalqslissenfpelkviempyayqccaf....................................
ENSPTRP00000001496  nakdlnc.......................................................................
ENSPTRP00000000339  rrisl.........................................................................
ENSPTRP00000027516  piahlniskillvlgetygekedpeglqdfnteslhivfptnkefhfildvsvktvanlelsnikcvlednkcsyfls
ENSPTRP00000049501  iqhlaslqifiaegnnihsfprslclvtslellnlnnndiqilpselhllcrlvriawnpmdkglhishnplskplp.
ENSPTRP00000007737  gkdmrmvpmemfny................................................................
ENSPTRP00000027179  eelaelplirldfscnkittipvcyrnlrhlqtitldnnplqsppaqicikgkvhifkylniqackiapdlpdydrrp
ENSPTRP00000033370  lpeelgdlplvrldfscnrvsripvsfcrlrhlqvilldsnplqspp...............................
ENSPTRP00000011913  nqisqisvkisccprlkilrleenclelsmlpqsilsdsqicllavegnlf...........................
ENSPTRP00000041364  nrltdfpavllhmpflevidvdwnsiryfpslahlsslklviydhnpcrn............................
ENSPTRP00000012439  lsrlpplpcsap..................................................................
ENSPTRP00000002493  tgtrgrqnkaeinprtngdraacqt.....................................................
ENSPTRP00000009963  qelvdlplvkfdfscnkvlvipicfremkqlqvlllennplqsppaqictkgkvhifkylsiqacqiktadslylht.
ENSPTRP00000047494  sfnfelqvyrasmnlsqafsslkslkilrirgyvfkelksfnlsplhnlqnlevldlgtnfikianlsmfkqfkrlkv
ENSPTRP00000029007  mrsleqainlslnfngnnvkgielgafdstvfqslnfggtpnlsvifnglqnsttqslwlgtfediddedissamlkg
ENSPTRP00000012803  vprhlcqlpslnelsmagnrlaflpldlgrsrelqyvyvdnnihlkglpsylyn........................
ENSPTRP00000002493  alpalgavlrgavrveknqelchlstidwgllqpapganhivgnklgeecadvcpgvlgaagepcakttfsghtdyrc
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ek............................................................................
ENSPTRP00000047302  pdelgdlplvkldfscnkvteipvcyrklhhlqviildnnplqvppaqiclkgkvhifkylniqaccrmdkkpdsldl
ENSPTRP00000031252  slpkeiggccsltvfcvrdnrltripaevsqatelhvldvagnrllhlplsltalklkalwlsdnqsq..........
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  rtielevlc.....................................................................
ENSPTRP00000008307  tcrlwsdsrhsrqv................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  lycmnskklhnv..................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  c.............................................................................
ENSPTRP00000033769  ltel..........................................................................
ENSPTRP00000048194  lnglnqlklvgnfklkealaakdfvnlrslsvpyayqccafwgcdsyanlnt..........................
ENSPTRP00000057473  l.............................................................................
ENSPTRP00000002701  i.............................................................................
ENSPTRP00000010123  rkdfmllsnde...................................................................
ENSPTRP00000017119  alrkmphikhvdlrlnvirkliadevdflqhvtqldlrdnklgdldamifnnievlhcernqlvtldicgyflkalya
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  lnetteqdlc....................................................................
ENSPTRP00000011064  ennwieeatkrvpklkkldgtpvik.....................................................
ENSPTRP00000027161  eaafeletldlshnqllffpllpqhsklrtlllrdnnmg.......................................
ENSPTRP00000010126  dldevskqelc...................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  lsrlkkesicpt..................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ll............................................................................
ENSPTRP00000025967  dllriphely....................................................................
ENSPTRP00000026832  dlreirktel....................................................................
ENSPTRP00000007855  lvlldnpctdetsyrqealvqmpylerldkefyeeeer........................................
ENSPTRP00000027517  pdsykcdypesyrgtplkdfhmselscn..................................................
ENSPTRP00000001283  fdstpnlkgiflrfnklavgsvvdsafrrlkhlqvldiegnlefg.................................
ENSPTRP00000020451  pgnafqgmnnesvtlklygngfeevqshafngttltalelkenvhlekmhngafrgatgpktldisstklqalpsygl
ENSPTRP00000006511  tyisairerfpkllrldghelppp......................................................
ENSPTRP00000012374  htvlqnmmqlrqldmkr.............................................................
ENSPTRP00000056400  sayvsairdcfpkllrldgrelsa......................................................
ENSPTRP00000053355  ilfqraelehclkpsvm.............................................................
ENSPTRP00000041711  pdlvyldyrriddh................................................................
ENSPTRP00000038049  sairdcfpkllrldgrelp...........................................................
ENSPTRP00000050575  lfhetelsacmkp.................................................................
ENSPTRP00000008984  dirldgnpinlsktpqaymclprl......................................................
ENSPTRP00000049006  gqpvttq.......................................................................
ENSPTRP00000060814  hevglhdnllnnipvsmsklpklkklnikrnpfpkpgesemfidsirrlenl..........................
ENSPTRP00000004277  hevglhdnllnnipvsmsklpklkklnikrnpfpkpgesemfidsirrlenly.........................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  pgfdyrpyivswclnlrvldgyvisqkeslk...............................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  slagvafsqlelrkc...............................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  as............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  efvvatlpqlkwldgkeieps.........................................................
ENSPTRP00000011214  ftsvqgyafngtkldavylnknkyltvidkdafggvysgpslldvsqtsvtalpskglehlkeli.............
ENSPTRP00000010702  rnlsleyldlfgntfeqpkvlpviklqapltlle............................................
ENSPTRP00000041754  rvldfqkvkl....................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  fltnlilekdgddnpvcrlpgyravilqtlpqlrildcknifge..................................
ENSPTRP00000036180  dq............................................................................
ENSPTRP00000039448  k.............................................................................
ENSPTRP00000035343  taelhvldvagnrlqslpfalthlnlkalwlaenqa..........................................
ENSPTRP00000035630  iktvphkaec....................................................................
ENSPTRP00000024055  dnqavtee......................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  fckandtsyirdrieeirlegnp.......................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  nnlietmqrdvfcdpeehkhtrrqledirldgnpinlslfpsayfcl...............................
ENSPTRP00000002116  llqqityldgfdqedn..............................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  psldtlvlannhlnaieepddslarlfpnlrsislhksglqswedidklnsfpkleevrllgipllqpytteerrklv
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ekllfdprtlhslakslcilnisnnniddirdleilenlnqliavdnqllhvkdlefllnklmklwkidlngnpvclk
ENSPTRP00000030128  epdgt.........................................................................
ENSPTRP00000048131  gvelldrnqvtek.................................................................
ENSPTRP00000044257  nplcaspsywaavrellpglkvidgervig................................................
ENSPTRP00000003094  ersfegls......................................................................
ENSPTRP00000015328  elpalkyldmgtthit..............................................................
ENSPTRP00000048337  pgptnkvprgynyraevrklipqlqvldevpath............................................
ENSPTRP00000007000  ydesvdwnggrgsphkepqfmlqskprmledsdeqldytvlpmkkdvdrtevvfssypgfstsettkicslppifeil
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  gltidslaqlcvldditvspn.........................................................
ENSPTRP00000015329  lkyldmgttlvplttlknilmmtveleklilpshmacclcqfkn..................................
ENSPTRP00000027832  qdpdgt........................................................................
ENSPTRP00000052190  acptlialtmfdcpvslkkgyrhvlvnsiwplkaldhhvisde...................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  rlfavytlqtleklddrtvre.........................................................
ENSPTRP00000061088  yldmgtmqvplttienilvmtveleklilpsh..............................................
ENSPTRP00000050620  lvslekdeedykryrcfvlyklpnlkfldaqkvtrq..........................................
ENSPTRP00000010544  eqlaellpsv....................................................................
ENSPTRP00000027517  ldllpiahlhlsyilldlrnyyikeneteslqilnaktlhlvfhptslfaiqvnisvntlgclqltniklnddncqvf
ENSPTRP00000028616  hllpklqqlddrpvres.............................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  rca...........................................................................
ENSPTRP00000042428  ddi...........................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ptafsci.......................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  cdl...........................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  qmqklrvlnlsdnrlknlpfsftklkelaalwlsdnqskalip...................................
ENSPTRP00000034204  isglgrlltlwldnnrirylpdsiveltgleelvlqgnqiavlpdhfgqlsrvglwkikdnpliqppyevcmkg....
ENSPTRP00000050882  ..............................................................................
ENSPTRP00000027103  qlenlplgifdhlgklcelrlydnpwrcdsdilplrnwlllnqprlgtdtvpvcfspanvrgqsl.............
ENSPTRP00000051281  elglnnmeelvsidkfalvnlpeltklditnnprlsfihprafhhlpqmetlmlnnnalsalhqqtveslpnlqevgl
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  mgdmqklkvinlsdnrlknlpfsftklqqltamwlsdnqs......................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000029913  klkridisknqisdiapdafqglksltslvlygnkiteiakglfdglvslqllllnankinclrvntfqdlqnlnlls
ENSPTRP00000026857  lrkmteiglsgnrlekvprlicrwtslhllylgntglhrlrgsfrclvnlrfldlsqnhldhcplqicalknlevlgl
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  ..............................................................................
ENSPTRP00000025115  elginnmgelvsvdryaldnlpeltkleatnnpklsyihrlafrsvpaleslmlnnnalnaiyqktveslpnlreisi
ENSPTRP00000005186  tlarncfqlypvggpsqfstiyslnmehnrinkipfgifsrakvlsklnmkdnqltslp...................
ENSPTRP00000001472  rdnklksvpdeiillqslerldlsnndisslpyslgnlhlkflalegnplrtirr.......................
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  ltnisqetvnawislisitlsgnmwecsrsicplfywlknf.....................................
ENSPTRP00000047233  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  rrlrlqgnplwcgcqarpllewlarar...................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  lkillmdnnklnsldskilnslrslttvglsgnlwecsaricalaswlg.............................
ENSPTRP00000042428  etlnlsrnqltslpsaicklsklkklylnsnkldfdglpsgigkltnleefmaannnlelvpeslcrcpklrklvlnk
ENSPTRP00000061216  ..............................................................................
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  iglqhnriweigadtfsqlsslqaldlswntirsihpkafstlrslvkldltdnqlttlplaglgglmhlklkgnlal
ENSPTRP00000015086  etlnlsrnqltslpsaicklsklkklylnsnkldfdglpsgigkltnleefmaannnlelvpeslcrcpklrklvlnk
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  tlkhvhlennrlnqlpsnfpfdsletlaltnnpwkctcqlrglrrwle..............................
ENSPTRP00000036080  eihlennklkkipsglpelkylqiiflhsnsiarvgvndfcptvpkmkkslysaislfnnpvkywe............
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  kelginnmpelisidslavdnlpdlrkieatnnprlsyihpnaffrlpkleslmlnsnalsalyhgtieslpnlkeis
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  fsgn..........................................................................
ENSPTRP00000004388  nlqrlnldsnkltfigqeildswislndislagniwecsrnicslvnwlks...........................
ENSPTRP00000022464  svrqid........................................................................
ENSPTRP00000020795  qslqldsnrltyieprilnswksltsitlagnlwdcgrn.......................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  llrsldlsgnrlhtlpp.............................................................
ENSPTRP00000061095  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  ..............................................................................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  legieisniqqrmfrplmnlshiyfkkfqycgyap...........................................
ENSPTRP00000001626  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  laglaalqeldvsnlslqalpgdlsglfprlrllaaarnpfncvcplswf............................
ENSPTRP00000012792  v.............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  nllvlhlshnrissvpainnrlehlylnnnsiekingtqicpndlvafhdfssdlenvphlrylrldgnylkppipld
ENSPTRP00000007033  sgnasarplsqllnldlsyneielipdsflehltslcflnlsrnclrtfearrsgslpclmlldlshnaletlelgar
ENSPTRP00000042754  relhldnnklarvpsglpdlkll.......................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  ..............................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  qklnlssnplmylhknqfeslkqlqsldlerieipnintrmfqpmknlshiyfknfrycsyap...............
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  telnlaynrlasarvhhrafrrlralrsldlagnqltrlpmglptglrtlqlqrnqlrmlepeplagldqlrelslah
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  ..............................................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  yeclr.........................................................................
ENSPTRP00000008254  ..............................................................................
ENSPTRP00000036082  nlesidlsfnklyhvpsylpksllhlvllgnqieripgyvfghmepgleylylsfnkladdgmdrvsfygayhslrel
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  tgryfwsipeeeflcepplitr........................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  afndlsalshlaiganplycdcnmqwlsdwvk..............................................
ENSPTRP00000008986  ildlqlshnqltkvprisahlqhlhldhnkiksvnvsvicpspsmlpaerdsfsygphlrylrldgneikppipmal.
ENSPTRP00000047783  lqvldlsgnpklnwagaevfsglsslqeldlsgtnlvplpealllhlpalqsisvg......................
ENSPTRP00000014225  sgfslrtlyassnrltavnvypipslltsldlsrnllecvpdwaceakkievldvsynlltevpvrilsslslrklml
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  flglkwtnltmldlsynnlnvvgndsfawlphleyffldynniqhlfshslhglfnvrylnl................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  nlkklra.......................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  qlaalppqekwtcrqlktldlsrnqlgknedglktkriaffttrgrqrsgteaacvlefpaflseslevlclndnhld
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  hssfmaldfsgfgnlrdldlsgnclttfprfggslaletldlrrnsltalpqkavseqlsrglrtiylsqnpydccgv
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  tnidgksqfvsyemqrnlslenaktsilllnkvdllwddlflilqfvwhtsvehfqirnvtfggkayldhnsfdysnt
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  ilaklqtnpklssltlnniettwnsfirilqlvwhttvwyfsisnvklqgqldfrdfdysgtslkalsihqvvsdvfs
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  lgfgscheelyssrpygaldsgfnsvdsgdkrwsgneptdefsdlplrvaeitkeqrlrresqyqenrgslvvtnggv
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  idlsvnkisp....................................................................
ENSPTRP00000029007  lcemsveslnlqehrfsdissttfqcftqlqeldltathlkglpsgikglnllkklvlsvnhfdqlcqisaanfpslt
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  wtsshcqrvcpcphgmactargecchteclggc.............................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  psls..........................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ssnel.........................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  esiqrl........................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  iarlpsvsklngs.................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  pkyrdrlilvskslefld............................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  pvkslkarnqtlappfpelrylslaynkiakedavlpvalfpslcefvfhnnplva......................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  ikflseltrgptllnftlnhiettwkclvrvfqflwpkpveylniynltiiesiheeeftyskttlkalkiehitnkv
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  ..............................................................................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051281  hgnpircdcvirwana..............................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000029913  lydnklqtiskglfaplqsiqtlhlaqnpfvcdchlkwladylqdnpietsgarc.......................
ENSPTRP00000026857  ddnkigqlpselgslsklkilgltgneflsfpeevlslasleklyi................................
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  ..............................................................................
ENSPTRP00000025115  hsnplrcdcvihwinsnktnirf.......................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  ..............................................................................
ENSPTRP00000047233  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  nylvtlpeaihflteievldvrenpnlvmppkpadraaewynidfsl...............................
ENSPTRP00000061216  ..............................................................................
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  sqafskdsfpklrilevpyayqccpygm..................................................
ENSPTRP00000015086  nylvtlpeaihflteievldvrenpnlvmppkpadraaewynidfsl...............................
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  ihsnpircdcvirwmnmn............................................................
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  ..............................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000061095  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  ..............................................................................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  lm............................................................................
ENSPTRP00000007033  algslrtlllqgnalrdlppytfanlaslqrlnlqgnrvspcggpdepgpsgcvafsgitslrslslvdneiellrag
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  ..............................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  nrlrvgdigpgtwhe...............................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  ..............................................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  ..............................................................................
ENSPTRP00000008254  ..............................................................................
ENSPTRP00000036082  fldhndlksippgiqemkalhflrlnnnkirnilpeeicnaeedddsnlehlhlennyikireipsy...........
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ghnhvqnlp.....................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  tvppsvcllkslselylgnnpglrelppelgqlgnlwqldtedltisnvp............................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  dgw...........................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  vmrtiklehvhfrvfyiqqdkiyllltkmdienltisnaqmphmlfpnyptkfqylnfanniltdelfkrtiqlphlk
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  fpqsdiyeifsnmniknftvsgtrmvhmlcpskispflhldfsnnlltdtvfencghlteletlilqmnqlkelskia
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  ehdldqidyidsctaeeeeaevrqprgpdpdslssqfmayieqrrishegspvkpvairefqktedmrrylhqnrvpa
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000029007  hlyvrgnvkklhlgvgcleklgnletldlshndi............................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  flfsqtalytvfsemnimmltisdtpfihmlcphapstfkflnftqnvftdsifekcstlvkletlilqknglkdlfk
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  ..............................................................................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051281  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000026857  ..............................................................................
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  ..............................................................................
ENSPTRP00000025115  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  ..............................................................................
ENSPTRP00000047233  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000061216  ..............................................................................
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  ..............................................................................
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  ..............................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000061095  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  ..............................................................................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  ..............................................................................
ENSPTRP00000007033  aflhtplteldlssnpglevatgalgglesslevlalqgnglmvlqvdlpcficlkrlnlaenrlshlpawtqavsle
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  ..............................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  ..............................................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  ..............................................................................
ENSPTRP00000008254  ..............................................................................
ENSPTRP00000036082  ..............................................................................
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  ..............................................................................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  tlilngnkletlslvscfanntplehldlsqnllqhkndencswpetvvnmnlsynklsdsvfrclpksiqildlnnn
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  emttqmkslqqldisqnsvsydekkgdcswtksllslnmssniltdtifrclpprikvldlhsnkiksvpkqvvklea
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  epssllslsashnqlsh.............................................................
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  vglmtkdmpsleildvswnsl.........................................................
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                                                                    
                                                                                                    
d2ifga3               ..............................................................................
ENSPTRP00000001468  ..............................................................................
ENSPTRP00000034204  ..............................................................................
ENSPTRP00000050882  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051281  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000049843  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000008989  ..............................................................................
ENSPTRP00000051884  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000026857  ..............................................................................
ENSPTRP00000017393  ..............................................................................
ENSPTRP00000008774  ..............................................................................
ENSPTRP00000025115  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000002213  ..............................................................................
ENSPTRP00000051339  ..............................................................................
ENSPTRP00000060625  ..............................................................................
ENSPTRP00000020782  ..............................................................................
ENSPTRP00000047233  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000035643  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000019491  ..............................................................................
ENSPTRP00000029568  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000061216  ..............................................................................
ENSPTRP00000033656  ..............................................................................
ENSPTRP00000014575  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000006103  ..............................................................................
ENSPTRP00000015965  ..............................................................................
ENSPTRP00000036080  ..............................................................................
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000047686  ..............................................................................
ENSPTRP00000037431  ..............................................................................
ENSPTRP00000060321  ..............................................................................
ENSPTRP00000004388  ..............................................................................
ENSPTRP00000022464  ..............................................................................
ENSPTRP00000020795  ..............................................................................
ENSPTRP00000049653  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000061095  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000036665  ..............................................................................
ENSPTRP00000011222  ..............................................................................
ENSPTRP00000047055  ..............................................................................
ENSPTRP00000001626  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000053783  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000042859  ..............................................................................
ENSPTRP00000007033  vldlrnnsfsllpgsamggletslrrlylqgnplsccgn.......................................
ENSPTRP00000042754  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000001624  ..............................................................................
ENSPTRP00000017533  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000036079  ..............................................................................
ENSPTRP00000003137  ..............................................................................
ENSPTRP00000009804  ..............................................................................
ENSPTRP00000059190  ..............................................................................
ENSPTRP00000018046  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000017706  ..............................................................................
ENSPTRP00000053173  ..............................................................................
ENSPTRP00000008987  ..............................................................................
ENSPTRP00000008254  ..............................................................................
ENSPTRP00000036082  ..............................................................................
ENSPTRP00000060795  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000055467  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000008986  ..............................................................................
ENSPTRP00000047783  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000026754  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000028569  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000018633  ..............................................................................
ENSPTRP00000020457  ..............................................................................
ENSPTRP00000035431  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000022692  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000003935  ..............................................................................
ENSPTRP00000030995  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000014225  ..............................................................................
ENSPTRP00000005186  ..............................................................................
ENSPTRP00000037057  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018786  ..............................................................................
ENSPTRP00000025606  ..............................................................................
ENSPTRP00000012830  ..............................................................................
ENSPTRP00000034664  ..............................................................................
ENSPTRP00000026322  ..............................................................................
ENSPTRP00000008962  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000031403  ..............................................................................
ENSPTRP00000015314  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000044034  ..............................................................................
ENSPTRP00000033466  ..............................................................................
ENSPTRP00000027515  kiqtvpketihlmalrelniafnfltdlpgcshfsrlsilniemnfilspsldfvqscqevktlnagrnpfrctcelk
ENSPTRP00000008874  ..............................................................................
ENSPTRP00000001496  ..............................................................................
ENSPTRP00000000339  ..............................................................................
ENSPTRP00000027516  lqelnvafnsltdlpgcgsfsslsvliidhnsvshpsadffqscqkmrsikagdnpfqctcelrefvknid.......
ENSPTRP00000049501  ..............................................................................
ENSPTRP00000007737  ..............................................................................
ENSPTRP00000027179  ..............................................................................
ENSPTRP00000033370  ..............................................................................
ENSPTRP00000011913  ..............................................................................
ENSPTRP00000041364  ..............................................................................
ENSPTRP00000012439  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000009963  ..............................................................................
ENSPTRP00000047494  ..............................................................................
ENSPTRP00000029007  ..............................................................................
ENSPTRP00000012803  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000006306  ..............................................................................
ENSPTRP00000052915  ..............................................................................
ENSPTRP00000047302  ..............................................................................
ENSPTRP00000031252  ..............................................................................
ENSPTRP00000027465  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000008307  ..............................................................................
ENSPTRP00000027477  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000001819  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000036986  ..............................................................................
ENSPTRP00000033769  ..............................................................................
ENSPTRP00000048194  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000002701  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000017119  ..............................................................................
ENSPTRP00000004835  ..............................................................................
ENSPTRP00000025772  ..............................................................................
ENSPTRP00000010123  ..............................................................................
ENSPTRP00000011064  ..............................................................................
ENSPTRP00000027161  ..............................................................................
ENSPTRP00000010126  ..............................................................................
ENSPTRP00000054912  ..............................................................................
ENSPTRP00000034515  ..............................................................................
ENSPTRP00000018540  ..............................................................................
ENSPTRP00000057473  ..............................................................................
ENSPTRP00000027614  ..............................................................................
ENSPTRP00000024687  ..............................................................................
ENSPTRP00000025967  ..............................................................................
ENSPTRP00000026832  ..............................................................................
ENSPTRP00000007855  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000001283  ..............................................................................
ENSPTRP00000020451  ..............................................................................
ENSPTRP00000006511  ..............................................................................
ENSPTRP00000012374  ..............................................................................
ENSPTRP00000056400  ..............................................................................
ENSPTRP00000053355  ..............................................................................
ENSPTRP00000041711  ..............................................................................
ENSPTRP00000038049  ..............................................................................
ENSPTRP00000050575  ..............................................................................
ENSPTRP00000008984  ..............................................................................
ENSPTRP00000049006  ..............................................................................
ENSPTRP00000060814  ..............................................................................
ENSPTRP00000004277  ..............................................................................
ENSPTRP00000027103  ..............................................................................
ENSPTRP00000051190  ..............................................................................
ENSPTRP00000055643  ..............................................................................
ENSPTRP00000001472  ..............................................................................
ENSPTRP00000004702  ..............................................................................
ENSPTRP00000013006  ..............................................................................
ENSPTRP00000043808  ..............................................................................
ENSPTRP00000041179  ..............................................................................
ENSPTRP00000035210  ..............................................................................
ENSPTRP00000011214  ..............................................................................
ENSPTRP00000010702  ..............................................................................
ENSPTRP00000041754  ..............................................................................
ENSPTRP00000050767  ..............................................................................
ENSPTRP00000034871  ..............................................................................
ENSPTRP00000036180  ..............................................................................
ENSPTRP00000039448  ..............................................................................
ENSPTRP00000035343  ..............................................................................
ENSPTRP00000035630  ..............................................................................
ENSPTRP00000024055  ..............................................................................
ENSPTRP00000046894  ..............................................................................
ENSPTRP00000015962  ..............................................................................
ENSPTRP00000036078  ..............................................................................
ENSPTRP00000025359  ..............................................................................
ENSPTRP00000044819  ..............................................................................
ENSPTRP00000002116  ..............................................................................
ENSPTRP00000053040  ..............................................................................
ENSPTRP00000007526  ..............................................................................
ENSPTRP00000024064  ..............................................................................
ENSPTRP00000034772  ..............................................................................
ENSPTRP00000030128  ..............................................................................
ENSPTRP00000048131  ..............................................................................
ENSPTRP00000044257  ..............................................................................
ENSPTRP00000003094  ..............................................................................
ENSPTRP00000015328  ..............................................................................
ENSPTRP00000048337  ..............................................................................
ENSPTRP00000007000  ..............................................................................
ENSPTRP00000040371  ..............................................................................
ENSPTRP00000009462  ..............................................................................
ENSPTRP00000015329  ..............................................................................
ENSPTRP00000027832  ..............................................................................
ENSPTRP00000052190  ..............................................................................
ENSPTRP00000015874  ..............................................................................
ENSPTRP00000046801  ..............................................................................
ENSPTRP00000014047  ..............................................................................
ENSPTRP00000061088  ..............................................................................
ENSPTRP00000050620  ..............................................................................
ENSPTRP00000010544  ..............................................................................
ENSPTRP00000027517  ..............................................................................
ENSPTRP00000028616  ..............................................................................
ENSPTRP00000027104  ..............................................................................
ENSPTRP00000005408  ..............................................................................
ENSPTRP00000045137  ..............................................................................
ENSPTRP00000043320  ..............................................................................
ENSPTRP00000028996  ..............................................................................
ENSPTRP00000015086  ..............................................................................
ENSPTRP00000036008  ..............................................................................
ENSPTRP00000047976  ..............................................................................
ENSPTRP00000060126  ..............................................................................
ENSPTRP00000042428  ..............................................................................
ENSPTRP00000057066  ..............................................................................
ENSPTRP00000060538  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000034915  ..............................................................................
ENSPTRP00000018267  ..............................................................................
ENSPTRP00000048004  ..............................................................................
ENSPTRP00000051241  ..............................................................................
ENSPTRP00000061058  ..............................................................................
ENSPTRP00000047493  ..............................................................................
ENSPTRP00000028379  ..............................................................................
ENSPTRP00000022750  ..............................................................................
ENSPTRP00000015475  ..............................................................................
ENSPTRP00000028379  ..............................................................................


                                                         
                                                         
d2ifga3               ...................................
ENSPTRP00000001468  ...................................
ENSPTRP00000034204  ...................................
ENSPTRP00000050882  ...................................
ENSPTRP00000027103  ...................................
ENSPTRP00000051281  ...................................
ENSPTRP00000051241  ...................................
ENSPTRP00000049843  ...................................
ENSPTRP00000028996  ...................................
ENSPTRP00000008989  ...................................
ENSPTRP00000051884  ...................................
ENSPTRP00000060321  ...................................
ENSPTRP00000029913  ...................................
ENSPTRP00000026857  ...................................
ENSPTRP00000017393  ...................................
ENSPTRP00000008774  ...................................
ENSPTRP00000025115  ...................................
ENSPTRP00000005186  ...................................
ENSPTRP00000001472  ...................................
ENSPTRP00000002213  ...................................
ENSPTRP00000051339  ...................................
ENSPTRP00000060625  ...................................
ENSPTRP00000020782  ...................................
ENSPTRP00000047233  ...................................
ENSPTRP00000027104  ...................................
ENSPTRP00000035643  ...................................
ENSPTRP00000049653  ...................................
ENSPTRP00000019491  ...................................
ENSPTRP00000029568  ...................................
ENSPTRP00000042428  ...................................
ENSPTRP00000061216  ...................................
ENSPTRP00000033656  ...................................
ENSPTRP00000014575  ...................................
ENSPTRP00000003094  ...................................
ENSPTRP00000015086  ...................................
ENSPTRP00000006103  ...................................
ENSPTRP00000015965  ...................................
ENSPTRP00000036080  ...................................
ENSPTRP00000008874  ...................................
ENSPTRP00000047686  ...................................
ENSPTRP00000037431  ...................................
ENSPTRP00000060321  ...................................
ENSPTRP00000004388  ...................................
ENSPTRP00000022464  ...................................
ENSPTRP00000020795  ...................................
ENSPTRP00000049653  ...................................
ENSPTRP00000035343  ...................................
ENSPTRP00000001283  ...................................
ENSPTRP00000061095  ...................................
ENSPTRP00000048194  ...................................
ENSPTRP00000036665  ...................................
ENSPTRP00000011222  ...................................
ENSPTRP00000047055  ...................................
ENSPTRP00000001626  ...................................
ENSPTRP00000017670  ...................................
ENSPTRP00000053783  ...................................
ENSPTRP00000012792  ...................................
ENSPTRP00000013006  ...................................
ENSPTRP00000042859  ...................................
ENSPTRP00000007033  ...................................
ENSPTRP00000042754  ...................................
ENSPTRP00000022750  ...................................
ENSPTRP00000001624  ...................................
ENSPTRP00000017533  ...................................
ENSPTRP00000031252  ...................................
ENSPTRP00000036079  ...................................
ENSPTRP00000003137  ...................................
ENSPTRP00000009804  ...................................
ENSPTRP00000059190  ...................................
ENSPTRP00000018046  ...................................
ENSPTRP00000048004  ...................................
ENSPTRP00000041179  ...................................
ENSPTRP00000017706  ...................................
ENSPTRP00000053173  ...................................
ENSPTRP00000008987  ...................................
ENSPTRP00000008254  ...................................
ENSPTRP00000036082  ...................................
ENSPTRP00000060795  ...................................
ENSPTRP00000032807  ...................................
ENSPTRP00000055467  ...................................
ENSPTRP00000022026  ...................................
ENSPTRP00000047494  ...................................
ENSPTRP00000046894  ...................................
ENSPTRP00000008986  ...................................
ENSPTRP00000047783  ...................................
ENSPTRP00000014225  ...................................
ENSPTRP00000026754  ...................................
ENSPTRP00000028569  ...................................
ENSPTRP00000022026  ...................................
ENSPTRP00000028569  ...................................
ENSPTRP00000017119  ...................................
ENSPTRP00000047493  ...................................
ENSPTRP00000018633  ...................................
ENSPTRP00000020457  ...................................
ENSPTRP00000035431  ...................................
ENSPTRP00000017670  ...................................
ENSPTRP00000029007  ...................................
ENSPTRP00000022692  ...................................
ENSPTRP00000032807  ...................................
ENSPTRP00000003935  ...................................
ENSPTRP00000030995  ...................................
ENSPTRP00000029913  ...................................
ENSPTRP00000014225  ...................................
ENSPTRP00000005186  ...................................
ENSPTRP00000037057  ...................................
ENSPTRP00000015508  ...................................
ENSPTRP00000012792  ...................................
ENSPTRP00000015508  ...................................
ENSPTRP00000018786  ...................................
ENSPTRP00000025606  ...................................
ENSPTRP00000012830  ...................................
ENSPTRP00000034664  ...................................
ENSPTRP00000026322  ...................................
ENSPTRP00000008962  ...................................
ENSPTRP00000046894  ...................................
ENSPTRP00000031403  ...................................
ENSPTRP00000015314  ...................................
ENSPTRP00000027161  ...................................
ENSPTRP00000044034  ...................................
ENSPTRP00000033466  ...................................
ENSPTRP00000027515  nfiqletysevmmvgwsdsytceyplnlrgtrlkd
ENSPTRP00000008874  ...................................
ENSPTRP00000001496  ...................................
ENSPTRP00000000339  ...................................
ENSPTRP00000027516  ...................................
ENSPTRP00000049501  ...................................
ENSPTRP00000007737  ...................................
ENSPTRP00000027179  ...................................
ENSPTRP00000033370  ...................................
ENSPTRP00000011913  ...................................
ENSPTRP00000041364  ...................................
ENSPTRP00000012439  ...................................
ENSPTRP00000002493  ...................................
ENSPTRP00000009963  ...................................
ENSPTRP00000047494  ...................................
ENSPTRP00000029007  ...................................
ENSPTRP00000012803  ...................................
ENSPTRP00000002493  ...................................
ENSPTRP00000006306  ...................................
ENSPTRP00000052915  ...................................
ENSPTRP00000047302  ...................................
ENSPTRP00000031252  ...................................
ENSPTRP00000027465  ...................................
ENSPTRP00000026832  ...................................
ENSPTRP00000008307  ...................................
ENSPTRP00000027477  ...................................
ENSPTRP00000047493  ...................................
ENSPTRP00000001819  ...................................
ENSPTRP00000010126  ...................................
ENSPTRP00000041179  ...................................
ENSPTRP00000036986  ...................................
ENSPTRP00000033769  ...................................
ENSPTRP00000048194  ...................................
ENSPTRP00000057473  ...................................
ENSPTRP00000002701  ...................................
ENSPTRP00000010123  ...................................
ENSPTRP00000017119  ...................................
ENSPTRP00000004835  ...................................
ENSPTRP00000025772  ...................................
ENSPTRP00000010123  ...................................
ENSPTRP00000011064  ...................................
ENSPTRP00000027161  ...................................
ENSPTRP00000010126  ...................................
ENSPTRP00000054912  ...................................
ENSPTRP00000034515  ...................................
ENSPTRP00000018540  ...................................
ENSPTRP00000057473  ...................................
ENSPTRP00000027614  ...................................
ENSPTRP00000024687  ...................................
ENSPTRP00000025967  ...................................
ENSPTRP00000026832  ...................................
ENSPTRP00000007855  ...................................
ENSPTRP00000027517  ...................................
ENSPTRP00000001283  ...................................
ENSPTRP00000020451  ...................................
ENSPTRP00000006511  ...................................
ENSPTRP00000012374  ...................................
ENSPTRP00000056400  ...................................
ENSPTRP00000053355  ...................................
ENSPTRP00000041711  ...................................
ENSPTRP00000038049  ...................................
ENSPTRP00000050575  ...................................
ENSPTRP00000008984  ...................................
ENSPTRP00000049006  ...................................
ENSPTRP00000060814  ...................................
ENSPTRP00000004277  ...................................
ENSPTRP00000027103  ...................................
ENSPTRP00000051190  ...................................
ENSPTRP00000055643  ...................................
ENSPTRP00000001472  ...................................
ENSPTRP00000004702  ...................................
ENSPTRP00000013006  ...................................
ENSPTRP00000043808  ...................................
ENSPTRP00000041179  ...................................
ENSPTRP00000035210  ...................................
ENSPTRP00000011214  ...................................
ENSPTRP00000010702  ...................................
ENSPTRP00000041754  ...................................
ENSPTRP00000050767  ...................................
ENSPTRP00000034871  ...................................
ENSPTRP00000036180  ...................................
ENSPTRP00000039448  ...................................
ENSPTRP00000035343  ...................................
ENSPTRP00000035630  ...................................
ENSPTRP00000024055  ...................................
ENSPTRP00000046894  ...................................
ENSPTRP00000015962  ...................................
ENSPTRP00000036078  ...................................
ENSPTRP00000025359  ...................................
ENSPTRP00000044819  ...................................
ENSPTRP00000002116  ...................................
ENSPTRP00000053040  ...................................
ENSPTRP00000007526  ...................................
ENSPTRP00000024064  ...................................
ENSPTRP00000034772  ...................................
ENSPTRP00000030128  ...................................
ENSPTRP00000048131  ...................................
ENSPTRP00000044257  ...................................
ENSPTRP00000003094  ...................................
ENSPTRP00000015328  ...................................
ENSPTRP00000048337  ...................................
ENSPTRP00000007000  ...................................
ENSPTRP00000040371  ...................................
ENSPTRP00000009462  ...................................
ENSPTRP00000015329  ...................................
ENSPTRP00000027832  ...................................
ENSPTRP00000052190  ...................................
ENSPTRP00000015874  ...................................
ENSPTRP00000046801  ...................................
ENSPTRP00000014047  ...................................
ENSPTRP00000061088  ...................................
ENSPTRP00000050620  ...................................
ENSPTRP00000010544  ...................................
ENSPTRP00000027517  ...................................
ENSPTRP00000028616  ...................................
ENSPTRP00000027104  ...................................
ENSPTRP00000005408  ...................................
ENSPTRP00000045137  ...................................
ENSPTRP00000043320  ...................................
ENSPTRP00000028996  ...................................
ENSPTRP00000015086  ...................................
ENSPTRP00000036008  ...................................
ENSPTRP00000047976  ...................................
ENSPTRP00000060126  ...................................
ENSPTRP00000042428  ...................................
ENSPTRP00000057066  ...................................
ENSPTRP00000060538  ...................................
ENSPTRP00000047493  ...................................
ENSPTRP00000034915  ...................................
ENSPTRP00000018267  ...................................
ENSPTRP00000048004  ...................................
ENSPTRP00000051241  ...................................
ENSPTRP00000061058  ...................................
ENSPTRP00000047493  ...................................
ENSPTRP00000028379  ...................................
ENSPTRP00000022750  ...................................
ENSPTRP00000015475  ...................................
ENSPTRP00000028379  ...................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053105 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Anabaena sp. 90
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Coriobacterium glomerans PW2
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium propionicum F0230a
NoYes   Actinoplanes missouriensis 431
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Finegoldia magna ATCC 29328
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   butyrate-producing bacterium SM4/1
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecalis 62
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes