SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Thioredoxin-like alignments in PDB chains (SCOP 1.75)

These alignments are sequences aligned to the 0034808 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                         10        20        30        40        50         60           70        8
                          |         |         |         |         |          |            |         

d1a0fa2  -r........................................
1nhyA  -l........................................
1z9hA  -salktylvsgqpleeiityypamkavndqgkevtefgnkyw
2fnoA  -d........................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0034808 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Amphimedon queenslandica
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Pandoraea sp. RB-44
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Collimonas fungivorans Ter331
NoYes   Achromobacter xylosoxidans
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Starkeya novella DSM 506
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Pseudomonas protegens Pf-5
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Plasmodium falciparum HB3
NoYes   Acidithiobacillus ferrooxidans ATCC 23270
NoYes   Sorangium cellulosum So0157-2
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas mendocina NK-01
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   2_050719S (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]