SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Ribonuclease H-like alignments in Monodelphis domestica 76_5

These alignments are sequences aligned to the 0052065 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2bw3a2               gr............................................................................
ENSMODP00000011848  inlspkqhhtalgnllqkisknemannemirwglcldtdiagrvlpmerinlrnssfitsqelnwtkevtreasiltv
ENSMODP00000019498  htrltpeqrqrevgrlidyihkddnvqkelrdwglsfdsnllsfsgrilqaekihqggktfdynpqfadwsketrgap
ENSMODP00000013136  lssqnygelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlflkiihtsvwagqkrlgqlakwk
ENSMODP00000000258  tgrvvpsekilmqdticqpmssanwskdmrnckllgaralnnwlivcshrnedvaenllnclrrvsgpmgfhiekpki
ENSMODP00000023789  icevwacnlddemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvdllkiiqlgltfmneqgeyp
ENSMODP00000010707  icevwasnleeemrkireivlsysyiamdtefpgvvvrpigefrssidyqyqllrcnvdllkiiqlgltftnekgeyp
ENSMODP00000003634  irevwacnldeemkkmrpviqqynyvamdtefpgvvarpvgefrsyadyqyqllrcnvdwlkiiqlgltfmneqgecp
ENSMODP00000023788  irevwacnldeemkkmrpviqqynyvamdtefpgvvarpvgefrsyadyqyqllrcnvdwlkiiqlgltfmneqgecp
ENSMODP00000003639  irevwacnldeemkkmrpviqqynyvamdtefpgvvarpvgefrsyadyqyqllrcnvdwlkiiqlgltfmneqgecp
ENSMODP00000000899  pmfrhlkntyaglqlvvvilpgktpvyaevkrvgdtvlgmatqcvqmknvqrttpqtlsnlclkinvklggvnnillp
ENSMODP00000022277  pmfrhlkntysglqliivilpgktpvyaevkrvgdtllgmatqcvqvknviktspqtlsnlclkinvklgginnilvp
ENSMODP00000013136  lrlivdhniadymtaknnvvinykdmnhtnsygiirglqfasfivqyyglvmdllvlglhrasemagppqmpndflsf
ENSMODP00000022283  pmfrhlkntysglqliivilpgktpvyaevkrvgdtllgmatqcvqvknvvktspqtlsnlclkinvklgginnilvp
ENSMODP00000022278  glqlivvilpgktpvyaevkrvgdtllgmatqcvqvknvvktspqtlsnlclkinaklgginnvlvphqrpsvfqqpv
ENSMODP00000014003  iirpqlkfrekvdnsntpfvpkifikpnaqkplaqaltkerrerqerpedldvppaladflyqqrtqqieqdmfahpy
ENSMODP00000009125  ykimkfksrkveknyafeipdvpekseylevrysaelpqlpqdlkgetfshvfgtntsslelflmnrrikgpcwleik
ENSMODP00000018959  vsavdyyfiqddgnrfkvalpykpyfyiatrkgcerevssflskkfqgkiakletvpkedldlsnhlvglkrnyikls
ENSMODP00000022331  qapvkkvpvvrvfgatpagqktclhlhgifpylyvpydgcgqqperylrqmafsidralnvalgnpsstvqhvfkvsl
ENSMODP00000006050  memirsnfknnlhkvyqaieeadflaidgefsgisdgpsvtaltngfdtpeeryhklkkaihsmdfllfqfglctfky
ENSMODP00000008671  cclgideagrgpvlgpmvygicfcplsrlgdlealkvadsktlseaererlfgkldqardfvgwaldilspnlisnsm
ENSMODP00000037687  lptcetfvfldleatglpnahpeiaeislfaihrfslehperdesgtlqlprvldkltlcmcpeqnftpkaseitgls
ENSMODP00000002956  vpvvdvqidnfkdmwpsillaiqtasfvavdtelsglgerknlldhcieerykavakaartrsvlslglacfrqqitk
ENSMODP00000027553  lptcetfvfldleatglpnahpeiaeislfaihrfslehperdesgtlqlprvldkltlcmcpeqnftpkaseitgls
ENSMODP00000009208  melgadcfeqklpmleelilasdflgldieftglrsiypkgqqtslfdspaewylktrrsiqqftvcqiglsmfsnmg
ENSMODP00000017947  metlvfmdleatglpfsqpkvtelclvaihrhaleasqqapppggassvpptprvadklclcvapgkacsaaassltg
ENSMODP00000017401  qrmvwvdlemtgldiekdqiiemaclitdsdlnilaegpnliinqpdelldsmsewckehhgksgltkavkestitlq
ENSMODP00000012810  ewervesflweeleqcpvlgidcewvnvkgkarpvsllqmasptgycilirlpklisgeagfpqtlvdlledsrilkv
ENSMODP00000018108  avvytdgccssngrrkaragigvywgpghplnvadrllgrqtnqraeihaackaieqaknqninklvlytdsmfting
ENSMODP00000038709  hlwqmdithvpsftrlkyvhvsidtfsgflfasaqsgea.......................................
ENSMODP00000039628  kndyyyqlpiarerihflhtweevdkcrdvilqpgqvvgidmewrpsfglvgrprvsvlqiatkehvylldllqfskl
ENSMODP00000038176  qiiv..........................................................................
ENSMODP00000039944  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000038788  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000038827  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039663  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040429  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000039575  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000039383  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000041234  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakillkeiiprfglparidsdrgshft
ENSMODP00000040821  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiphfglparidsdrgshft
ENSMODP00000039730  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpmtratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000038999  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000041237  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000041263  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000040130  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040009  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039973  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000041154  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptaqataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000040497  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040043  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000041073  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000023743  gyydyicvidfeatceegnppeftheiiefpivllnthtleiedtfqqyvrpeintqlsdfcisltgitqdmvdraat
ENSMODP00000040431  rplaytpfehlqidfitmpkagqyksclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000040237  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039798  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039454  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040592  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039820  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040107  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039515  kfplpeapfqvwqidfiqlpphagykfvlvmvcmfsrwveafpcrqatatavakcllekifpvwgipreihsdrgthf
ENSMODP00000039512  avvytdgccsskgkkpragigvywgpghplnvgdrltgrqtnqraeihaackaleqakdqninklvlytysmctvng.
ENSMODP00000039295  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiphfglparidsdrgshft
ENSMODP00000039164  rplaytpfehlqidfimmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000038871  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000039051  tpfehlqidfvmmpcykfclvivdqltrwpeafpttqatadfvakillkeiiphfglparidsdrgshftdsvl....
ENSMODP00000039453  hlwqmdvthvpsfaklky............................................................
ENSMODP00000039381  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsnrgshft
ENSMODP00000008720  kqlfdyliiidfestcwndgkhhysqeiiefpavllntltge....................................
ENSMODP00000038685  rplaytpfehlqidfitmpkagqykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshft
ENSMODP00000040777  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratvdfvakillkeiiphfglparidsdrgshft
ENSMODP00000039334  qykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshftdsvl..................
ENSMODP00000039385  qykfclvivdqltrwpeafptarataafvakvllkeiiprfglpacidsdrgshftdsvl..................
ENSMODP00000040453  rykfclvivdqltrwpeafpttratadfvakillkeiiprfglpalidsdrgshftdsvl..................
ENSMODP00000039799  qykfclvivdqltrwpeafptarataafvakvllkeiiprfglparidsdrgshftdsvl..................
ENSMODP00000039637  qykfclvivdqltrwpeafptaqataafvakvllkeiiprfglparidsdrgshftdsvl..................
ENSMODP00000040012  ykfclvivdqltrwpeafpttratadfvakillkeiiphfglparidsdrgshftdsvl...................
ENSMODP00000024433  ivamdcemvgvgllresglarcsivdydglvvydefirpegeitdyrthvsgiepfhmsmavpfqsareeilkllrdk
ENSMODP00000024435  cvaidcemvgtgpggrvselarcsvvsyhgdvlydkyirpetpivdyrtrwsgitrqhmq..................
ENSMODP00000000191  spseeedvmytvvnqfqqkfgsamlhikkqsvlsvaaegvnlcrhgklcwlqvatssrvylfdifllgsrafnnglqm
ENSMODP00000039903  rykfclvivdqltrwpealpttratadfvakillkeiiprfglparidsyrgshftdsv...................
ENSMODP00000040636  rplaycpfeslqidyismpkagrykfclvivdrltkwpeafpsntntasfvvkvstkeiiprfgvpltidshkgshft
ENSMODP00000020966  mvaldcemvgtgpkghtsslarcsivsysgdilydeyirppckivdyrtkwsgikkehminatpfkvarreilkillg
ENSMODP00000016034  tkavamdcemvgagpngeenilarvsivnqfgkcvydkyvkptekvtdyrtdv.........................
ENSMODP00000004997  sc............................................................................
ENSMODP00000003205  qryhyflvldfeatcdkpqihpqeiiefpilklngqtmeiestfhmyvqpavhpqltpfcteltgiiqgmvdgqpslq
ENSMODP00000037910  slsdgavigfdmewpppfwkgrpgrvaliqlcvseskcylfhiasmsvfprglkmlle....................
ENSMODP00000039515  pdfswytdgsclrnesgilvaryaitttaevieaghlpsatsaqqaeleavtracelakgkrvniyt...........
ENSMODP00000039336  pdfswytdgsclrnesgilvaryaitttaevieaghlpsafsaqqaeleavtracelakgkrvniyt...........
ENSMODP00000038980  pdfswytdgsclrnesgilvagyaitttaevieaghlpsaisaqqadleavtracelakgkrvn..............
ENSMODP00000039762  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000040130  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqraelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000041120  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000040102  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000040313  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039046  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038811  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039383  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000041250  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000041237  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000040431  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000040043  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000039234  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038908  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039691  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000039207  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000041154  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000041263  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000038922  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000040466  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdekatiytdsryafgichsvg
ENSMODP00000040107  dlilftdgssfmrdgirytgaaivsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038922  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglparidsdrgshft
ENSMODP00000040185  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiandkkatiytdsryafgichsvg
ENSMODP00000040009  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039841  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039295  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039454  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038788  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiymdsryafgichsvg
ENSMODP00000039831  dlilftdgssfmrdgihytgaavvsefatewsaslpsnisaqgaelialtqaciiakdkkstiymdsryafgichsvg
ENSMODP00000040454  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichpvg
ENSMODP00000039924  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000041073  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000038806  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiymdsryafgichsva
ENSMODP00000039381  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039798  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000040698  dlilfadgssfmrdgirytgaaivsefvtewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000040592  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038871  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039820  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039730  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkptiytdsryafgichsvg
ENSMODP00000039164  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiymdsryafgichsvg
ENSMODP00000039750  sdlilftdgssfmrdgisysgaavvsefatewsaslpsnisaqgaelialkhaciiakgkkatiytdsryafgichsv
ENSMODP00000039973  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsgyafgichsvg
ENSMODP00000040501  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000040437  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhaciiakdkkatiytdsryafgichsvg
ENSMODP00000038880  dlilftdgssfmrvgirytgaavvsefatewsaslpsnistqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000039575  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkhacviakdkkatiytdsryafgichsvg
ENSMODP00000008758  lfgldcemcltpngneltrvslvdaeghcvmdelvkpdnkilnyltrfsgitrkilkpvttrlrd.............
ENSMODP00000041052  grragaavvdhtgqviwdaslpegtsaqkaelvalaaalrvakdkrvtiytdsryafatlhvh...............
ENSMODP00000039051  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiymdsrysfgichsvg
ENSMODP00000040944  dlilftdgssfmrdgisytgaavvsefatewsaslpsnisaqgaqlialkhaciiakdkkatiytdsrypfgichsvg
ENSMODP00000040237  dlilftdgssfmrdgirytgdavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000038664  dlilfpdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvg
ENSMODP00000040821  dlilftdgspimrdgirytgaavvsefatewsaslpsnisaqgaelialkqaciiakekkatiymdsryafgichsvg
ENSMODP00000038848  dlilftngssfmrdgirytgaavvsefatewsallpsnisaqgaelialkqaciiakdkkatiymdsryafgichsvg
ENSMODP00000032264  iyaldcemcytkqgleltritvinsdlkvvydtfvkpdnkvvdyntrfsgvteedlqnacitlrdvqavllnmfssdt
ENSMODP00000040497  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgaelicskqaciiakdkkatiytdsryafgichsvg
ENSMODP00000024080  kgirvlgiafssardhpvfcalvngdgevtdflrlphftkrrtawreeerekkaqdietlkkfllnkkphvv......
ENSMODP00000024075  pveepwaavtadlmgpfpsssrshvyavivtdaftkwvvalplrdvaasevsraiislfflygppqrvvmdqgdefin
ENSMODP00000039841  rplaytpfehlqidfitmpkagrykfclvivdqltrwpeafpttratadfvakillkeiiprfglpa...........
ENSMODP00000005300  vfavdcevcytskglelvrvtvvdpslqvvydtlvkpeneiidynirfsgvaeddlkntnvslqdvqai.........
ENSMODP00000038999  girytgaavvsefatewsaslpsnisaqgaelialkqaciiakdkkatiytdsryafgichsvgmlwlqrgfltsagk
ENSMODP00000040471  sdlilftdgssfmrdgirysgaavvsefatewsaslpsnisaqgaelialkhaciiakd...................
ENSMODP00000039453  ltritqsspipgaptifvdgsktglaaivmhdyphtvhtpyqsaqlvelyaaltvfi.....................
ENSMODP00000003431  k.............................................................................
ENSMODP00000041120  rplaytpfehlqidfitmpkagqykf....................................................
ENSMODP00000040625  dlilftdgssfmrdgirytgaavvsefatewsaslpsnissqgaelialt............................
ENSMODP00000039589  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqgael................................
ENSMODP00000038709  trqtrsspipgaptvfvdgsktglaaivmnnhprsiktpyesaqlvelyaaltvfhslpdtpfnlysdsryvvqsl..
ENSMODP00000039282  dlilftdgssfmrdgirytgaavvsefatewsaslpsnisaqga..................................
ENSMODP00000041052  hlrgtrpcehweldftevrpgkfgfwyllvlvdtftgwpeafa...................................
ENSMODP00000039149  kelenpdfswytdgsclrnesgilvagyaitttaevieaghlpsatsaqq............................
ENSMODP00000040465  ldtplknsdlilftdgsslmrdgirysgaavvsefatew.......................................
ENSMODP00000039233  kelenpdfswytdgsclrnesgilvagyaitttaevieaghlpsa.................................
ENSMODP00000003608  aapwsslridvigpvpaseeghrhvliasdacsswteafplksftqm...............................
ENSMODP00000040080  feqvgmgvvgplvetpngfrfillsvdaysrwveasplkeqnpvevagalipfllrfgrpqllvttlrvpfvnqvnrs
ENSMODP00000009010  kelilllwkvvdlankkvgqlhevlvkpdhleltedckeetkidaenlssapqleqalrqfn................
ENSMODP00000039267  sgqvermnkelktmigklctethl......................................................
ENSMODP00000038982  kelenpdfswytdgsclrnesgi.......................................................
ENSMODP00000038685  lwlqrgfltsagksianaeiinevlsalqlpea.............................................
ENSMODP00000038827  lwlqrgfltsagksianaeiine.......................................................
ENSMODP00000039663  lwlqrgfltsagksianaeiine.......................................................
ENSMODP00000039944  lwlqrgfltsagksianaeiinevlsalqlpea.............................................
ENSMODP00000040429  lwlqrgfltsagksianaeiinev......................................................
ENSMODP00000041234  lwlqrgfltsagksianaeiinevlsalklpr..............................................
ENSMODP00000039249  kelenpdfswytdgsclrnesgil......................................................
ENSMODP00000024410  ygedldehfrilaqkqslpyleaahellqaelpplpnkwawkegwtryepdgkgqqvefpeeralvfdvevciaegsc
ENSMODP00000041250  rplaytpfehlqi.................................................................
ENSMODP00000006552  em............................................................................
ENSMODP00000003608  fvciytsgycfyqdtewcagfglyvlspdspplslsfscsphtptyahlaavacglerfvhsciplvflvnc......
ENSMODP00000037000  lvglavcwgerdayylslqqeelhseisaslappsldpnltvnerlrqlqaclqhvsvkgrsviiynfiqnyktllls
ENSMODP00000039291  lkdvplaspdlifftdgssfmspqgrragaavv.............................................
ENSMODP00000035244  dppvmdgfsiddryiyikvehdtlwrqeqemsnqfartmlfqilkckhtvicfnakefv...................
ENSMODP00000040437  rplaytpfehlqidfi..............................................................
ENSMODP00000020968  syfsl.........................................................................
ENSMODP00000040977  eknak.........................................................................
ENSMODP00000040986  lletplknsdlilftdgssfmrdgiryt..................................................
ENSMODP00000040102  rplaytpfehlqidfi..............................................................
ENSMODP00000040698  rplaytpfehlqidfi..............................................................
ENSMODP00000040339  lilftdgssfmrdgirytgaavvsefa...................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  pmhfwalfypkravdqarelvgmlekisgpigmqmsppawielkddrietyirtiksmlggkvqmvvciitgtrddly
ENSMODP00000019498  lisvkpldnwlliytrrnyeaansliqnlfkvtpamgiqmkkaimievddrteaylrvlqqkvtsdtqivvcllssnr
ENSMODP00000013136  taeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselqlpfqaclkvekfgdlilkatepqmvlfn
ENSMODP00000000258  tkvqenttafiraiqqhtnldlqlvmcilpsnqkdcydsikrflsldhpvpsqcvlartlirqgmmmsiatkiamqmv
ENSMODP00000023789  pgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeegietqyfaellmtsgvvlcegvkwlsfhsgydf.....
ENSMODP00000010707  sgintwqfnfkfnltedmysqdsidllansglqfqkheeegidtlhfaellmtsgvvlcdnvkwlsfhsgydfgymvk
ENSMODP00000003634  pgtstwqfnfkfnlkedmyaqdsielltmsgiqfkkheeegieaqyfaellmtsgvvlcdevkwlsfhsgydfgyfik
ENSMODP00000023788  pgtstwqfnfkfnlkedmyaqdsielltmsgiqfkkheeegieaqyfaellmtsgvvlcdgvkwlsfhsgydfgyfik
ENSMODP00000003639  pgtstwqfnfkfnlkedmyaqdsielltmsgiqfkkheeegieaqyfaellmtsgvvlcdgvkwlsfhsgydfgyfik
ENSMODP00000000899  qgrppvfqqpviflgadvthppagdgkkpsiaavvgsmdahpnrycatvrvqqhrqeiiqdlaamvrelliqfykstr
ENSMODP00000022277  hqrpsvfqqpviflgadvthppagdgkkpsiaavvgsmdahpsrycatvrvqrprqeiiqdlasmvrelliqfykstr
ENSMODP00000013136  qdiateaahpirlfcryidrihiffrftadeardliqryltehpdpnnenivgynnkkcwprdarmrlmkhd......
ENSMODP00000022283  hqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqeiiedlsymvrelliqfykstr
ENSMODP00000022278  iflgadvthppagdgkkpsiaavvgsmdghpsrycatvrvqtsrqetsqellysqeviqdltnmvrelliqfykstrf
ENSMODP00000014003  qyeldhfaipdevlqkpqiqmykpvgetpchfvttldalvelnekllnckdfgvdlehhsyrsflgltclmqistrte
ENSMODP00000009125  npqllnqpiswckveamalkpdlvnvvkdiappplvimsfslktmqnakthqnevialaalihhsfpldkaapqppfq
ENSMODP00000018959  fntvddlvkvrkeispavkknrerdntsdtytamlssalmgvsvttdegvskkiadq.....................
ENSMODP00000022331  vsgmpfygyhekerhfmkiylynpamvkricellqsgaimnkyyqpheahipyllqlfidynlygmnlinlaavrfrk
ENSMODP00000006050  dstdskyimksfnfyvfpkpfsrtspdvkfvcqsssidflanqgfdfnkvfrngipylnqeeerqlreqydekrsqsn
ENSMODP00000008671  qrrakynlnslshdtamalvqlaldqgvkvtqvfvdtvgpadkyqqk...............................
ENSMODP00000037687  nqnladnhkagfngaviralreflkrqkspiclvahngfdydfpllrtelqrlgad......................
ENSMODP00000002956  adhsylvqvfnltllcmqeyiiepqsvqflvqhgfdfnrqytqg..................................
ENSMODP00000027553  nqnladnhkagfdgaviralweflkrqkspiclvahngfdydfpllrtelqrlgadlpggtvcldtlpalrgldkahh
ENSMODP00000009208  rksnkylahsynfflfpttlgimdsefsfqassilflnqygfdynkflkngipymneeqekkikqdlltgnwkvrstl
ENSMODP00000017947  lntamltahrrgpfdsaladllqaflrrqrpplclvahng......................................
ENSMODP00000017401  qaeyeflsfvrqqtppglcplagnsvhadkkfldkympqfmkhlh.................................
ENSMODP00000012810  gvgcwedaskllreydltvrgcld......................................................
ENSMODP00000018108  i.............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  dkeekekelchfiwslfs............................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  dsv...........................................................................
ENSMODP00000038788  dsv...........................................................................
ENSMODP00000038827  dsv...........................................................................
ENSMODP00000039663  dsv...........................................................................
ENSMODP00000040429  dsv...........................................................................
ENSMODP00000039575  dsv...........................................................................
ENSMODP00000039383  dsv...........................................................................
ENSMODP00000041234  dsv...........................................................................
ENSMODP00000040821  nsvl..........................................................................
ENSMODP00000039730  dsv...........................................................................
ENSMODP00000038999  dsv...........................................................................
ENSMODP00000041237  dsv...........................................................................
ENSMODP00000041263  dsv...........................................................................
ENSMODP00000040130  dsv...........................................................................
ENSMODP00000040009  dsvl..........................................................................
ENSMODP00000039973  dsv...........................................................................
ENSMODP00000041154  dsv...........................................................................
ENSMODP00000040497  dsv...........................................................................
ENSMODP00000040043  dsvl..........................................................................
ENSMODP00000041073  dsv...........................................................................
ENSMODP00000023743  fpqvlrnvvewmklkelgttykysi.....................................................
ENSMODP00000040431  dsvl..........................................................................
ENSMODP00000040237  dsv...........................................................................
ENSMODP00000039798  dsv...........................................................................
ENSMODP00000039454  dsvl..........................................................................
ENSMODP00000040592  dsv...........................................................................
ENSMODP00000039820  dsv...........................................................................
ENSMODP00000040107  dsv...........................................................................
ENSMODP00000039515  tglvvsq.......................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  dsv...........................................................................
ENSMODP00000039164  dsvl..........................................................................
ENSMODP00000038871  dsvl..........................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  dsv...........................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  dsv...........................................................................
ENSMODP00000040777  dsv...........................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  lv............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  vledrkilkvi...................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  q.............................................................................
ENSMODP00000020966  kivvghaihndfkalhyfhpkp........................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  qvlervdewmakeglldpsvksifvtcgdwdlkvmlpgqchylglpvad.............................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  mlwlqrgfltsagk................................................................
ENSMODP00000040130  mlwlqrgfltsag.................................................................
ENSMODP00000041120  mlwlqrgfltsagk................................................................
ENSMODP00000040102  mlwlqrgfltsagk................................................................
ENSMODP00000040313  mlwlqrgfltsagksi..............................................................
ENSMODP00000039046  mlwlqrgfltsagksi..............................................................
ENSMODP00000038811  mlwlqrgfltsagksi..............................................................
ENSMODP00000039383  mlwlqrgfltsagk................................................................
ENSMODP00000041250  mlwlqrgfltsagksi..............................................................
ENSMODP00000041237  mlwlqrgfltsagk................................................................
ENSMODP00000040431  mlwlqrgfltsagk................................................................
ENSMODP00000040043  mlwlqrgfltsagk................................................................
ENSMODP00000039234  mlwlqrgfltsagksi..............................................................
ENSMODP00000038908  mlwlqrgfltsagksi..............................................................
ENSMODP00000039691  mlwlqrgfltsagk................................................................
ENSMODP00000039207  mlwlqrgfltsagk................................................................
ENSMODP00000041154  mlwlqrgfltsagk................................................................
ENSMODP00000041263  mlwlqrgfltsagk................................................................
ENSMODP00000038922  mlwlqrgfltsagksi..............................................................
ENSMODP00000040466  mlwlqrgfltsagksi..............................................................
ENSMODP00000040107  mlwlqrgfltsag.................................................................
ENSMODP00000038922  dsv...........................................................................
ENSMODP00000040185  mlwlqrgfltsagksi..............................................................
ENSMODP00000040009  mlwlqrgfltsagksi..............................................................
ENSMODP00000039841  vlwlqrgfltsagksi..............................................................
ENSMODP00000039295  mlwlqrgfltsagksi..............................................................
ENSMODP00000039454  mlwlqrgfltsagksi..............................................................
ENSMODP00000038788  mlwlqrgfltsagk................................................................
ENSMODP00000039831  mlwlqrgfltsagk................................................................
ENSMODP00000040454  mlwlqrgfltsaeksi..............................................................
ENSMODP00000039924  mlwlqrgfltsagksi..............................................................
ENSMODP00000041073  mlwlqrgflt....................................................................
ENSMODP00000038806  mlwlqrgfltsag.................................................................
ENSMODP00000039381  mlwlqrgfltsagksi..............................................................
ENSMODP00000039798  mlwlqrgfltsagksi..............................................................
ENSMODP00000040698  mlwlqrgfltsagksia.............................................................
ENSMODP00000040592  mlwlqrgfltsagksi..............................................................
ENSMODP00000038871  mlwlqrgfltsagksi..............................................................
ENSMODP00000039820  mlwlqrgfltsagksi..............................................................
ENSMODP00000039730  mlwlqrgfltsagksi..............................................................
ENSMODP00000039164  mlwlqrgfltsagk................................................................
ENSMODP00000039750  gmlwlqrgfltsa.................................................................
ENSMODP00000039973  mlwlqrgfltsagk................................................................
ENSMODP00000040501  mlwlqrgfltsagksi..............................................................
ENSMODP00000040437  mlwlqrgfltsagk................................................................
ENSMODP00000038880  mlwlqrgfltsagk................................................................
ENSMODP00000039575  mlwlqrgfltsagk................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  mlwlqrgfltsa..................................................................
ENSMODP00000040944  mlwlqrgfltsagksi..............................................................
ENSMODP00000040237  mlwlqrgfltsagksi..............................................................
ENSMODP00000038664  mlwlqrgfltsagksi..............................................................
ENSMODP00000040821  mlwlqrgfltsagks...............................................................
ENSMODP00000038848  mlwlqrgfltsagksi..............................................................
ENSMODP00000032264  ilighslesdlfalklihttvvdtsvvfp.................................................
ENSMODP00000040497  mlwlqrgfltsagk................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  qingeilgllgtmangsrfypsqpd.....................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  sian..........................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  lrrqlqslgvplgk................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ptlavavspnswyswcsrrlleeryswarslylsdlipletpagisgpakqdwserlivghnvcfdrafikeqyliqg
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  cgislagn......................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  gaikklccvqspvpsqvinartvaqptklwsvaqkillqincklggelwgvdiplkqlmvigmd..............
ENSMODP00000019498  kd............................................................................
ENSMODP00000013136  lyddwlrtissytafsrlililralhvnndrakvilkpdkttite.................................
ENSMODP00000000258  sklggelwaveiplkslmvvgidvnkeacakgrsavgfvassnsritrwfsrcilqntktni................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  lltdsrlpeeeheff...............................................................
ENSMODP00000003634  iltnsplpeea...................................................................
ENSMODP00000023788  iltnsplpeea...................................................................
ENSMODP00000003639  iltnsplpeeahd.................................................................
ENSMODP00000000899  fkptriifyrdgv.................................................................
ENSMODP00000022277  fkptri........................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  fkptriifyrdgvpegqlpqilhyella..................................................
ENSMODP00000022278  kptriiyy......................................................................
ENSMODP00000014003  dfiidtlelrsdlyilnesftdps......................................................
ENSMODP00000009125  shfcvvskpndcifpydfkevinkknvnieiaatertllgfflakvhkidpdvivghniygfdleillqrinvckvph
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  vkrksdtlhgigcykdqlpgnsltgtlfrweedeipsslilegvepqstcelevdavaadilnrleieaqiggnpglq
ENSMODP00000006050  gagalsyispnaskcpviipedqkkf....................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  hstrashgk.....................................................................
ENSMODP00000009208  dkdqmkvvidevtrwlemaqegdwmtlpditgfqafevqlvlrqalptvwtlmkdkgvlvkkvsrqyrwclenssrdh
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  srmrfl........................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  wskigrlkrsimpklggrggfaernaacgr................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  aiwedekqrrrnrnessqishpesqdrrcvpatesekmfqkrlqevlkqndfsvtlsgsvdysngsqefsaeltlhse
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ddcrrekillsargfavffqmlvkakkplvghnmmmdllhlhekfy................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  vlstetvpcspanvvevhqekelskecfkknilkeeealineeailnlmetsqtfqplsqrlsqspifmdsnpdeslv
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  hllaglesdgyqgkrhgissshpsfgssrnpqnsddeenepqiekeemelsllmsqrwdsniedhcaekrspcrnihr
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  ssteeedssseeemewsgnnlllanlsipqldgtadensdnplnnessrthssviatskmsvktsifhkdaatlepps
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  sakitfpckhtsalsshvlnkedliedlsqpnnietgpdhtvhsltnespysmkypgslsstvhsenshkesskkeif
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  avsscessifdyeedisslnrqisnrkytsirkvekdasfmhmshhinestlgknfnfsdlshsknkltsegtekgss
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  talnnffpssltencelvscsgesrtmvhsvegasdeggisklkiryeefqehkiekpslsqqaahymffpsvvlsnc
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  lsrpqklspvtyklqpgnkqsrlklskkklvdhqenppsindigstkegcylqgstcstnsekddalsndvirvarea
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  fenkapadscidchfgdgtleseqsfglfgnkytlrakrkvnyetedsessfvthnskislpqsmeigesldgslksr
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  krrkmskklppviikyiiinrfrgrknmlvklgkidskekqvilteekmdlykklaplkdfwpkvpdspatkypiypl
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  tpkkshrrkakhksakkktgkqqktnnknikrtlsfrkkrshtilsppspsynaetedcdlnysdvmsklgflserst
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  spvnsspprcwsptdpraeeiitasdkealllfkgpniynskainssmgknsrakaqvkksktklvnpsvvskkrnkr
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  tqtrkpgedgrkkprakqkqkisekgstsrkhitfkdekintqtnaevkfvikhqdlsetannfggsqslnkqkdvsv
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  pspatihplstplpsivnvqqkspgcfpsslenksidlqafsspqddlcsslvstpigtgkelskmntqwshnqstif
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  sikestliqnnifdlsnhlsqvaqntqlslnmmstkaeenanshkkilssvgklnehhssldsvksdqlhapnflhck
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                                                                    
                                                                                                    
d2bw3a2               ..............................................................................
ENSMODP00000011848  ..............................................................................
ENSMODP00000019498  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000000258  ..............................................................................
ENSMODP00000023789  ..............................................................................
ENSMODP00000010707  ..............................................................................
ENSMODP00000003634  ..............................................................................
ENSMODP00000023788  ..............................................................................
ENSMODP00000003639  ..............................................................................
ENSMODP00000000899  ..............................................................................
ENSMODP00000022277  ..............................................................................
ENSMODP00000013136  ..............................................................................
ENSMODP00000022283  ..............................................................................
ENSMODP00000022278  ..............................................................................
ENSMODP00000014003  ..............................................................................
ENSMODP00000009125  ..............................................................................
ENSMODP00000018959  ..............................................................................
ENSMODP00000022331  dsqqhivcmpepskhsdpyspihiaseenhgslqlpnncfvtslrspikqiaweqkqrgfildmssfkpervkqrsls
ENSMODP00000006050  ..............................................................................
ENSMODP00000008671  ..............................................................................
ENSMODP00000037687  ..............................................................................
ENSMODP00000002956  ..............................................................................
ENSMODP00000027553  ..............................................................................
ENSMODP00000009208  ..............................................................................
ENSMODP00000017947  ..............................................................................
ENSMODP00000017401  ..............................................................................
ENSMODP00000012810  ..............................................................................
ENSMODP00000018108  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039628  ..............................................................................
ENSMODP00000038176  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000023743  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039512  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000008720  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000040777  ..............................................................................
ENSMODP00000039334  ..............................................................................
ENSMODP00000039385  ..............................................................................
ENSMODP00000040453  ..............................................................................
ENSMODP00000039799  ..............................................................................
ENSMODP00000039637  ..............................................................................
ENSMODP00000040012  ..............................................................................
ENSMODP00000024433  ..............................................................................
ENSMODP00000024435  ..............................................................................
ENSMODP00000000191  ..............................................................................
ENSMODP00000039903  ..............................................................................
ENSMODP00000040636  ..............................................................................
ENSMODP00000020966  ..............................................................................
ENSMODP00000016034  ..............................................................................
ENSMODP00000004997  ..............................................................................
ENSMODP00000003205  ..............................................................................
ENSMODP00000037910  ..............................................................................
ENSMODP00000039515  ..............................................................................
ENSMODP00000039336  ..............................................................................
ENSMODP00000038980  ..............................................................................
ENSMODP00000039762  ..............................................................................
ENSMODP00000040130  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040313  ..............................................................................
ENSMODP00000039046  ..............................................................................
ENSMODP00000038811  ..............................................................................
ENSMODP00000039383  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000041237  ..............................................................................
ENSMODP00000040431  ..............................................................................
ENSMODP00000040043  ..............................................................................
ENSMODP00000039234  ..............................................................................
ENSMODP00000038908  ..............................................................................
ENSMODP00000039691  ..............................................................................
ENSMODP00000039207  ..............................................................................
ENSMODP00000041154  ..............................................................................
ENSMODP00000041263  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040466  ..............................................................................
ENSMODP00000040107  ..............................................................................
ENSMODP00000038922  ..............................................................................
ENSMODP00000040185  ..............................................................................
ENSMODP00000040009  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000039295  ..............................................................................
ENSMODP00000039454  ..............................................................................
ENSMODP00000038788  ..............................................................................
ENSMODP00000039831  ..............................................................................
ENSMODP00000040454  ..............................................................................
ENSMODP00000039924  ..............................................................................
ENSMODP00000041073  ..............................................................................
ENSMODP00000038806  ..............................................................................
ENSMODP00000039381  ..............................................................................
ENSMODP00000039798  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040592  ..............................................................................
ENSMODP00000038871  ..............................................................................
ENSMODP00000039820  ..............................................................................
ENSMODP00000039730  ..............................................................................
ENSMODP00000039164  ..............................................................................
ENSMODP00000039750  ..............................................................................
ENSMODP00000039973  ..............................................................................
ENSMODP00000040501  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000038880  ..............................................................................
ENSMODP00000039575  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039051  ..............................................................................
ENSMODP00000040944  ..............................................................................
ENSMODP00000040237  ..............................................................................
ENSMODP00000038664  ..............................................................................
ENSMODP00000040821  ..............................................................................
ENSMODP00000038848  ..............................................................................
ENSMODP00000032264  ..............................................................................
ENSMODP00000040497  ..............................................................................
ENSMODP00000024080  ..............................................................................
ENSMODP00000024075  ..............................................................................
ENSMODP00000039841  ..............................................................................
ENSMODP00000005300  ..............................................................................
ENSMODP00000038999  ..............................................................................
ENSMODP00000040471  ..............................................................................
ENSMODP00000039453  ..............................................................................
ENSMODP00000003431  ..............................................................................
ENSMODP00000041120  ..............................................................................
ENSMODP00000040625  ..............................................................................
ENSMODP00000039589  ..............................................................................
ENSMODP00000038709  ..............................................................................
ENSMODP00000039282  ..............................................................................
ENSMODP00000041052  ..............................................................................
ENSMODP00000039149  ..............................................................................
ENSMODP00000040465  ..............................................................................
ENSMODP00000039233  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000040080  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000039267  ..............................................................................
ENSMODP00000038982  ..............................................................................
ENSMODP00000038685  ..............................................................................
ENSMODP00000038827  ..............................................................................
ENSMODP00000039663  ..............................................................................
ENSMODP00000039944  ..............................................................................
ENSMODP00000040429  ..............................................................................
ENSMODP00000041234  ..............................................................................
ENSMODP00000039249  ..............................................................................
ENSMODP00000024410  ..............................................................................
ENSMODP00000041250  ..............................................................................
ENSMODP00000006552  ..............................................................................
ENSMODP00000003608  ..............................................................................
ENSMODP00000037000  ..............................................................................
ENSMODP00000039291  ..............................................................................
ENSMODP00000035244  ..............................................................................
ENSMODP00000040437  ..............................................................................
ENSMODP00000020968  ..............................................................................
ENSMODP00000040977  ..............................................................................
ENSMODP00000040986  ..............................................................................
ENSMODP00000040102  ..............................................................................
ENSMODP00000040698  ..............................................................................
ENSMODP00000040339  ..............................................................................


                                                           10        20        30                 40
                                                            |         |         |                  |
d2bw3a2               .........................--EIKSAVE....KDGASATIDLWTDNYIKRNFLGVTLHY.........HENN
ENSMODP00000011848  .........................---------....---------------------------.........----
ENSMODP00000019498  .........................---------....---------------------------.........----
ENSMODP00000013136  .........................---------....---------------------------.........----
ENSMODP00000000258  .........................---------....---------------------------.........----
ENSMODP00000023789  .........................---------....---------------------------.........----
ENSMODP00000010707  .........................---------....---------------------------.........----
ENSMODP00000003634  .........................---------....---------------------------.........----
ENSMODP00000023788  .........................---------....---------------------------.........----
ENSMODP00000003639  .........................---------....---------------------------.........----
ENSMODP00000000899  .........................---------....---------------------------.........----
ENSMODP00000022277  .........................---------....---------------------------.........----
ENSMODP00000013136  .........................---------....---------------------------.........----
ENSMODP00000022283  .........................---------....---------------------------.........----
ENSMODP00000022278  .........................---------....---------------------------.........----
ENSMODP00000014003  .........................---------....---------------------------.........----
ENSMODP00000009125  .........................---------....---------------------------.........----
ENSMODP00000018959  .........................---------....---------------------------.........----
ENSMODP00000022331  eaisqtkalsqcknrnvsaaafgeg---------....---------------------------.........----
ENSMODP00000006050  .........................---------....---------------------------.........----
ENSMODP00000008671  .........................---------....---------------------------.........----
ENSMODP00000037687  .........................---------....---------------------------.........----
ENSMODP00000002956  .........................---------....---------------------------.........----
ENSMODP00000027553  .........................---------....---------------K-----------.........----
ENSMODP00000009208  .........................---------....---------------------------.........----
ENSMODP00000017947  .........................---------....---------------------------.........-D--
ENSMODP00000017401  .........................---------....---------------------------.........----
ENSMODP00000012810  .........................---------....---------------------------.........----
ENSMODP00000018108  .........................---------....---------------------------.........----
ENSMODP00000038709  .........................---------....---------------------------.........-TKH
ENSMODP00000039628  .........................---------....---------------------------.........----
ENSMODP00000038176  .........................-----SHLKeae.SGVIHFTSGIWMSS-QTREYLTLTAHWvtfessvrpHCED
ENSMODP00000039944  .........................---------....---------------------------.........----
ENSMODP00000038788  .........................---------....---------------------------.........----
ENSMODP00000038827  .........................---------....---------------------------.........----
ENSMODP00000039663  .........................---------....---------------------------.........----
ENSMODP00000040429  .........................---------....---------------------------.........----
ENSMODP00000039575  .........................---------....---------------------------.........----
ENSMODP00000039383  .........................---------....---------------------------.........----
ENSMODP00000041234  .........................---------....---------------------------.........----
ENSMODP00000040821  .........................---------....---------------------------.........----
ENSMODP00000039730  .........................---------....---------------------------.........----
ENSMODP00000038999  .........................---------....---------------------------.........----
ENSMODP00000041237  .........................---------....---------------------------.........----
ENSMODP00000041263  .........................---------....---------------------------.........----
ENSMODP00000040130  .........................---------....---------------------------.........----
ENSMODP00000040009  .........................---------....---------------------------.........----
ENSMODP00000039973  .........................---------....---------------------------.........----
ENSMODP00000041154  .........................---------....---------------------------.........----
ENSMODP00000040497  .........................---------....---------------------------.........----
ENSMODP00000040043  .........................---------....---------------------------.........----
ENSMODP00000041073  .........................---------....---------------------------.........----
ENSMODP00000023743  .........................---------....------L--------------------.........----
ENSMODP00000040431  .........................---------....---------------------------.........----
ENSMODP00000040237  .........................---------....---------------------------.........----
ENSMODP00000039798  .........................---------....---------------------------.........----
ENSMODP00000039454  .........................---------....---------------------------.........----
ENSMODP00000040592  .........................---------....---------------------------.........----
ENSMODP00000039820  .........................---------....---------------------------.........----
ENSMODP00000040107  .........................---------....---------------------------.........----
ENSMODP00000039515  .........................---------....---------------------------.........----
ENSMODP00000039512  .........................---------....---------------------------.........----
ENSMODP00000039295  .........................---------....---------------------------.........----
ENSMODP00000039164  .........................---------....---------------------------.........----
ENSMODP00000038871  .........................---------....---------------------------.........----
ENSMODP00000039051  .........................---------....---------------------------.........----
ENSMODP00000039453  .........................---------....---VHVSID------TFSGFLFASAQS.........GEAT
ENSMODP00000039381  .........................---------....---------------------------.........----
ENSMODP00000008720  .........................---------....---------------------------.........----
ENSMODP00000038685  .........................---------....---------------------------.........----
ENSMODP00000040777  .........................---------....---------------------------.........----
ENSMODP00000039334  .........................---------....---------------------------.........----
ENSMODP00000039385  .........................---------....---------------------------.........----
ENSMODP00000040453  .........................---------....---------------------------.........----
ENSMODP00000039799  .........................---------....---------------------------.........----
ENSMODP00000039637  .........................---------....---------------------------.........----
ENSMODP00000040012  .........................---------....---------------------------.........----
ENSMODP00000024433  .........................---------....---------------------------.........----
ENSMODP00000024435  .........................---------....---------------------------.........----
ENSMODP00000000191  .........................---------....---------------------------.........----
ENSMODP00000039903  .........................---------....---------------------------.........----
ENSMODP00000040636  .........................---------....---------------------------.........----
ENSMODP00000020966  .........................---------....---------------------------.........----
ENSMODP00000016034  .........................---------....---------------------------.........----
ENSMODP00000004997  .........................---------....--------------------YILTAYQ.........AEGN
ENSMODP00000003205  .........................---------....---------------------------.........----
ENSMODP00000037910  .........................---------....---------------------------.........----
ENSMODP00000039515  .........................---------....--------D------------------.........----
ENSMODP00000039336  .........................---------....--------D------------------.........----
ENSMODP00000038980  .........................---------....-----I---------------------.........----
ENSMODP00000039762  .........................---------....---------------------------.........----
ENSMODP00000040130  .........................---------....---------------------------.........----
ENSMODP00000041120  .........................---------....---------------------------.........----
ENSMODP00000040102  .........................---------....---------------------------.........----
ENSMODP00000040313  .........................---------....---------------------------.........----
ENSMODP00000039046  .........................---------....---------------------------.........----
ENSMODP00000038811  .........................---------....---------------------------.........----
ENSMODP00000039383  .........................---------....---------------------------.........----
ENSMODP00000041250  .........................---------....---------------------------.........----
ENSMODP00000041237  .........................---------....---------------------------.........----
ENSMODP00000040431  .........................---------....---------------------------.........----
ENSMODP00000040043  .........................---------....---------------------------.........----
ENSMODP00000039234  .........................---------....---------------------------.........----
ENSMODP00000038908  .........................---------....---------------------------.........----
ENSMODP00000039691  .........................---------....---------------------------.........----
ENSMODP00000039207  .........................---------....---------------------------.........----
ENSMODP00000041154  .........................---------....---------------------------.........----
ENSMODP00000041263  .........................---------....---------------------------.........----
ENSMODP00000038922  .........................---------....---------------------------.........----
ENSMODP00000040466  .........................---------....---------------------------.........----
ENSMODP00000040107  .........................---------....---------------------------.........----
ENSMODP00000038922  .........................---------....---------------------------.........----
ENSMODP00000040185  .........................---------....---------------------------.........----
ENSMODP00000040009  .........................---------....---------------------------.........----
ENSMODP00000039841  .........................---------....---------------------------.........----
ENSMODP00000039295  .........................---------....---------------------------.........----
ENSMODP00000039454  .........................---------....---------------------------.........----
ENSMODP00000038788  .........................---------....---------------------------.........----
ENSMODP00000039831  .........................---------....---------------------------.........----
ENSMODP00000040454  .........................---------....---------------------------.........----
ENSMODP00000039924  .........................---------....---------------------------.........----
ENSMODP00000041073  .........................---------....---------------------------.........----
ENSMODP00000038806  .........................---------....---------------------------.........----
ENSMODP00000039381  .........................---------....---------------------------.........----
ENSMODP00000039798  .........................---------....---------------------------.........----
ENSMODP00000040698  .........................---------....---------------------------.........----
ENSMODP00000040592  .........................---------....---------------------------.........----
ENSMODP00000038871  .........................---------....---------------------------.........----
ENSMODP00000039820  .........................---------....---------------------------.........----
ENSMODP00000039730  .........................---------....---------------------------.........----
ENSMODP00000039164  .........................---------....---------------------------.........----
ENSMODP00000039750  .........................---------....---------------------------.........----
ENSMODP00000039973  .........................---------....---------------------------.........----
ENSMODP00000040501  .........................---------....---------------------------.........----
ENSMODP00000040437  .........................---------....---------------------------.........----
ENSMODP00000038880  .........................---------....---------------------------.........----
ENSMODP00000039575  .........................---------....---------------------------.........----
ENSMODP00000008758  .........................---------....---------------------------.........----
ENSMODP00000041052  .........................---------....-----------A---------------.........----
ENSMODP00000039051  .........................---------....---------------------------.........----
ENSMODP00000040944  .........................---------....---------------------------.........----
ENSMODP00000040237  .........................---------....---------------------------.........----
ENSMODP00000038664  .........................---------....---------------------------.........----
ENSMODP00000040821  .........................---------....---------------------------.........----
ENSMODP00000038848  .........................---------....---------------------------.........----
ENSMODP00000032264  .........................---------....---------------------------.........----
ENSMODP00000040497  .........................---------....---------------------------.........----
ENSMODP00000024080  .........................---------....---------------------------.........----
ENSMODP00000024075  .........................---------....---------------------------.........----
ENSMODP00000039841  .........................---------....---------------------------.........----
ENSMODP00000005300  .........................---------....---------------------------.........----
ENSMODP00000038999  .........................---------....---------------------------.........----
ENSMODP00000040471  .........................---------....-K-------------------------.........----
ENSMODP00000039453  .........................---------....---------------------------.........----
ENSMODP00000003431  .........................----KEILDnichSPCVSMLLDSSTDS-SDQSCVGIYIRY.........FKEL
ENSMODP00000041120  .........................---------....---------------------------.........----
ENSMODP00000040625  .........................---------....---------------------------.........----
ENSMODP00000039589  .........................---------....---------------------------.........----
ENSMODP00000038709  .........................---------....---------------------------.........----
ENSMODP00000039282  .........................---------....---------------------------.........----
ENSMODP00000041052  .........................---------....---------------------------.........----
ENSMODP00000039149  .........................---------....---------------------------.........----
ENSMODP00000040465  .........................---------....---------------------------.........----
ENSMODP00000039233  .........................---------....---------------------------.........----
ENSMODP00000003608  .........................---------....-----------------------A---.........----
ENSMODP00000040080  .........................---------....---------------------------.........----
ENSMODP00000009010  .........................---------....---------------------------.........----
ENSMODP00000039267  .........................---------....---------------------------.........----
ENSMODP00000038982  .........................---------....--------------------L------.........----
ENSMODP00000038685  .........................---------....---------------------------.........----
ENSMODP00000038827  .........................---------....---------------------------.........----
ENSMODP00000039663  .........................---------....---------------------------.........----
ENSMODP00000039944  .........................---------....---------------------------.........----
ENSMODP00000040429  .........................---------....---------------------------.........----
ENSMODP00000041234  .........................---------....---------------------------.........----
ENSMODP00000039249  .........................---------....---------------------V-----.........----
ENSMODP00000024410  .........................---------....---------------------------.........----
ENSMODP00000041250  .........................---------....---------------------------.........----
ENSMODP00000006552  .........................---LREIRD....SHFFSIVTDDVVDI-AGEEHLPVLVRF.........VDDS
ENSMODP00000003608  .........................---------....---------------------------.........----
ENSMODP00000037000  .........................---------....---------------------------.........----
ENSMODP00000039291  .........................---------....---------------------------.........----
ENSMODP00000035244  .........................---------....---------------------------.........----
ENSMODP00000040437  .........................---------....---------------------------.........----
ENSMODP00000020968  .........................---------....------VLNESNDVHDSAQLLIFIYEM.........IDNF
ENSMODP00000040977  .........................---------....---ICVVIDETSAV-SKKSTLVIYLQC.........TVQS
ENSMODP00000040986  .........................---------....-------------------G-------.........----
ENSMODP00000040102  .........................---------....---------------------------.........----
ENSMODP00000040698  .........................---------....---------------------------.........----
ENSMODP00000040339  .........................---------....---------------------------.........----


                                50        60        70              80          90                  
                                 |         |         |               |           |                  
d2bw3a2               E..LRDLILGLKSLDFERSTAENIYKKLKAIFS.QF.NVEDL....SSIKFVTDR..GANVVKSLANN..........
ENSMODP00000011848  -..-------------V----------------.--.-----....---------..-----------..........
ENSMODP00000019498  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000013136  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000000258  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000023789  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000010707  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000003634  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000023788  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000003639  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000000899  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000022277  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000013136  -..--------------V---------------.--.-----....---------..-----------..........
ENSMODP00000022283  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000022278  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000014003  -..--------------------I---------.--.-----....---------..-----------..........
ENSMODP00000009125  -..------------------------------.--.-----....---------..----------Micdveisak.
ENSMODP00000018959  -..------------------------L-----.--.-----....---------..-----------..........
ENSMODP00000022331  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000006050  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000008671  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000037687  -..------------------------------.--.---L-....---------..-----------..........
ENSMODP00000002956  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000027553  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000009208  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000017947  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000017401  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000012810  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000018108  -..-------------------------TSWIK.DW.KK---....---------..-----------..........
ENSMODP00000038709  V..IKHMFLAMSMM-------------------.--.----G....KPLSIKTDN..GPGYTSQA---..........
ENSMODP00000039628  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038176  Y..HCSALLNVSQV-DCDYSGVSVQKQLEYWWE.AWvTSVGL....QIGITVTDN..QSIGKTLNEGEh.........
ENSMODP00000039944  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038788  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038827  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039663  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040429  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039575  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039383  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041234  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040821  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039730  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038999  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041237  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041263  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040130  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040009  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039973  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041154  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040497  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040043  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041073  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000023743  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040431  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040237  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039798  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039454  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040592  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039820  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040107  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039515  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039512  -..------------------------ITNRIK.DW.KKN--....---------..-----------..........
ENSMODP00000039295  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039164  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038871  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039051  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039453  KhvIKHMFLAMSVM-------------------.--.----G....RPLTLKTDN..GPGY-------..........
ENSMODP00000039381  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000008720  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038685  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040777  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039334  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039385  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040453  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039799  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039637  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040012  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000024433  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000024435  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000000191  -..------------------------------.--.-----....---------..-------HD-Cr.........
ENSMODP00000039903  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040636  -..----------------------D-------.--.-----....---------..-----------..........
ENSMODP00000020966  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000016034  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000004997  H..IKSYVLGIKGV-DIRDSGDFIHHWVQNVLS.EF.VMSE-....-IRTVYVTD..CRVNSSAFSKAg.........
ENSMODP00000003205  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000037910  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039515  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039336  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038980  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039762  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040130  -..----------------K-------------.--.-----....---------..-----------..........
ENSMODP00000041120  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040102  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040313  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039046  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000038811  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039383  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000041250  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000041237  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040431  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040043  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000039234  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000038908  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039691  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000039207  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000041154  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000041263  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000038922  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040466  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040107  -..----------------K-------------.--.-----....---------..-----------..........
ENSMODP00000038922  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040185  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040009  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039841  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039295  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039454  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000038788  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000039831  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040454  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039924  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000041073  -..-------------S----------------.--.-----....---------..-----------..........
ENSMODP00000038806  -..----------------K-------------.--.-----....---------..-----------..........
ENSMODP00000039381  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039798  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040698  -..--------------------N---------.--.-----....---------..-----------..........
ENSMODP00000040592  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000038871  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039820  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039730  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000039164  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000039750  -..---------------G--------------.--.-----....---------..-----------..........
ENSMODP00000039973  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000040501  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040437  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000038880  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000039575  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000008758  -..------------------------------.--.-----....---------..---V-------..........
ENSMODP00000041052  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039051  -..---------------G--------------.--.-----....---------..-----------..........
ENSMODP00000040944  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040237  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000038664  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000040821  -..------------------I-----------.--.-----....---------..-----------..........
ENSMODP00000038848  -..-------------------A----------.--.-----....---------..-----------..........
ENSMODP00000032264  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040497  -..-----------------S------------.--.-----....---------..-----------..........
ENSMODP00000024080  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000024075  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039841  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000005300  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038999  -..---------------------A--------.--.-----....---------..-----------..........
ENSMODP00000040471  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039453  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000003431  E..VKESYITLAPL--YSETVDGYFETIISALD.EL.DIPFR....KPGWVVGLGtdGSAMLSCKGGLvekfqeiipp
ENSMODP00000041120  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040625  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039589  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038709  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039282  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000041052  -..------------T-----------------.--.-----....---------..-----------..........
ENSMODP00000039149  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040465  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039233  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000003608  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040080  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000009010  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000039267  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038982  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000038685  -..------------------------------.--.-----....---------..----------L..........
ENSMODP00000038827  -..---------------------------VLS.AL.KLPK-....---------..---------AL..........
ENSMODP00000039663  -..---------------------------VLS.AL.KLPK-....---------..---------AL..........
ENSMODP00000039944  -..------------------------------.--.-----....---------..----------L..........
ENSMODP00000040429  -..----------------------------LS.AL.KLPK-....---------..---------AL..........
ENSMODP00000041234  -..------------------------------.--.-----....---------..---------AL..........
ENSMODP00000039249  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000024410  -..------D-----------------------.--.-----....---------..-----------..........
ENSMODP00000041250  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000006552  Hn.LREEFIGFLPY---EADAEILAIKFHTTITeKW.GLNMEycrgQAYIVSSGF..SSKMKVVAMRLlekypqa...
ENSMODP00000003608  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000037000  -..------------------------------.--.-F---....---------..-----------..........
ENSMODP00000039291  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000035244  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040437  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000020968  K..VTEELAALQSI-KGTTTGEDIYEKVSQTVK.DL.ELDWA....KLANVTTDS..APSMMGSKKGViahinqemgk
ENSMODP00000040977  A..PSPVMLFVALKELMSMTADCIFSTLLSALN.DC.GFNNDylndNLIAFCSDG..ANSVLGRKSGValkllenfpk
ENSMODP00000040986  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040102  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040698  -..------------------------------.--.-----....---------..-----------..........
ENSMODP00000040339  -..------------------------------.--.-----....---------..-----------..........


                           100       110       120           130       140                       150
                             |         |         |             |         |                         |
d2bw3a2               ......IRINCSSHLLSNVLENSFEETPELNM....PILACKNIVKYFKKANLQHRLRSS...............L.K
ENSMODP00000011848  ......--------------------------....------------------------...............-.-
ENSMODP00000019498  ......--------------------------....------------------------...............-.-
ENSMODP00000013136  ......--------------------------....------------------------...............-.-
ENSMODP00000000258  ......------A-------------------....------------------------...............-.-
ENSMODP00000023789  ......--------------------------....------------------------...............-.-
ENSMODP00000010707  ......--------------------------....------------------------...............-.-
ENSMODP00000003634  ......--------------------------....------------------------...............-.-
ENSMODP00000023788  ......--------------------------....------------------------...............-.-
ENSMODP00000003639  ......--------------------------....------------------------...............-.-
ENSMODP00000000899  ......--------------------------....------------------------...............-.-
ENSMODP00000022277  ......--------------------------....------------------------...............-.-
ENSMODP00000013136  ......--------------------------....------------------------...............-.-
ENSMODP00000022283  ......--------------------------....------------------------...............-.-
ENSMODP00000022278  ......--------------------------....----------------------R-...............-.-
ENSMODP00000014003  ......--------------------------....------------------------...............-.-
ENSMODP00000009125  ......ELIRCKSYHLSELVHQILRTERETIP....------------------------...............-.-
ENSMODP00000018959  ......--------------------------....------------------------...............-.-
ENSMODP00000022331  ......--------------------------....------------------------...............-.-
ENSMODP00000006050  ......--------------------------....------------------------...............-.-
ENSMODP00000008671  ......--------------------------....------------------------...............-.-
ENSMODP00000037687  ......--------------------------....------------------------...............-.-
ENSMODP00000002956  ......--------------------------....------------------------...............-.-
ENSMODP00000027553  ......--------------------------....------------------------...............-.-
ENSMODP00000009208  ......--------------------------....------------------------...............-.-
ENSMODP00000017947  ......--------------------------....------------------------...............-.-
ENSMODP00000017401  ......--------------------------....------------------------...............-.-
ENSMODP00000012810  ......--------------------------....------------------------...............-.-
ENSMODP00000018108  ......--------------------------....------------------------...............-.-
ENSMODP00000038709  ......--------------------------....------------------------...............-.-
ENSMODP00000039628  ......--------------------------....------------------------...............-.-
ENSMODP00000038176  ......SSVPCFGHTINLIVNEAIKSQRMVQN....LLSIARKICERVHRSAKAKEKLAElqkeyelpqhh....L.I
ENSMODP00000039944  ......--------------------------....------------------------...............-.-
ENSMODP00000038788  ......--------------------------....------------------------...............-.-
ENSMODP00000038827  ......--------------------------....------------------------...............-.-
ENSMODP00000039663  ......--------------------------....------------------------...............-.-
ENSMODP00000040429  ......--------------------------....------------------------...............-.-
ENSMODP00000039575  ......--------------------------....------------------------...............-.-
ENSMODP00000039383  ......--------------------------....------------------------...............-.-
ENSMODP00000041234  ......--------------------------....------------------------...............-.-
ENSMODP00000040821  ......--------------------------....------------------------...............-.-
ENSMODP00000039730  ......--------------------------....------------------------...............-.-
ENSMODP00000038999  ......--------------------------....------------------------...............-.-
ENSMODP00000041237  ......--------------------------....------------------------...............-.-
ENSMODP00000041263  ......--------------------------....------------------------...............-.-
ENSMODP00000040130  ......--------------------------....------------------------...............-.-
ENSMODP00000040009  ......--------------------------....------------------------...............-.-
ENSMODP00000039973  ......--------------------------....------------------------...............-.-
ENSMODP00000041154  ......--------------------------....------------------------...............-.-
ENSMODP00000040497  ......--------------------------....------------------------...............-.-
ENSMODP00000040043  ......--------------------------....------------------------...............-.-
ENSMODP00000041073  ......--------------------------....------------------------...............-.-
ENSMODP00000023743  ......--------------------------....------------------------...............-.-
ENSMODP00000040431  ......--------------------------....------------------------...............-.-
ENSMODP00000040237  ......--------------------------....------------------------...............-.-
ENSMODP00000039798  ......--------------------------....------------------------...............-.-
ENSMODP00000039454  ......--------------------------....------------------------...............-.-
ENSMODP00000040592  ......--------------------------....------------------------...............-.-
ENSMODP00000039820  ......--------------------------....------------------------...............-.-
ENSMODP00000040107  ......--------------------------....------------------------...............-.-
ENSMODP00000039515  ......--------------------------....------------------------...............-.-
ENSMODP00000039512  ......--------------------------....------------------------...............-.-
ENSMODP00000039295  ......--------------------------....------------------------...............-.-
ENSMODP00000039164  ......--------------------------....------------------------...............-.-
ENSMODP00000038871  ......--------------------------....------------------------...............-.-
ENSMODP00000039051  ......--------------------------....------------------------...............-.-
ENSMODP00000039453  ......--------------------------....------------------------...............-.-
ENSMODP00000039381  ......--------------------------....------------------------...............-.-
ENSMODP00000008720  ......--------------------------....------------------------...............-.-
ENSMODP00000038685  ......--------------------------....------------------------...............-.-
ENSMODP00000040777  ......--------------------------....------------------------...............-.-
ENSMODP00000039334  ......--------------------------....------------------------...............-.-
ENSMODP00000039385  ......--------------------------....------------------------...............-.-
ENSMODP00000040453  ......--------------------------....------------------------...............-.-
ENSMODP00000039799  ......--------------------------....------------------------...............-.-
ENSMODP00000039637  ......--------------------------....------------------------...............-.-
ENSMODP00000040012  ......--------------------------....------------------------...............-.-
ENSMODP00000024433  ......--------------------------....------------------------...............-.-
ENSMODP00000024435  ......--------------------------....------------------------...............-.-
ENSMODP00000000191  ......WLSDCLSHQYGIVLSNVFD-------....------------------------...............-.-
ENSMODP00000039903  ......--------------------------....------------------------...............-.-
ENSMODP00000040636  ......--------------------------....------------------------...............-.-
ENSMODP00000020966  ......--------------------------....------------------------...............-.-
ENSMODP00000016034  ......--------------------------....------------------------...............-.-
ENSMODP00000004997  ......MCLRCSACALNSVVQSVLNKRTLQARnmheVIELLNVCEDLAGSTGLSKETFGS...............LeE
ENSMODP00000003205  ......----------------Y---------....------------------------...............-.-
ENSMODP00000037910  ......--------------------------....------------------------...............-.-
ENSMODP00000039515  ......--------------------------....------------------------...............-.-
ENSMODP00000039336  ......--------------------------....------------------------...............-.-
ENSMODP00000038980  ......--------------------------....------------------------...............-.-
ENSMODP00000039762  ......--------------------------....------------------------...............-.-
ENSMODP00000040130  ......--------------------------....------------------------...............-.-
ENSMODP00000041120  ......--------------------------....------------------------...............-.-
ENSMODP00000040102  ......--------------------------....------------------------...............-.-
ENSMODP00000040313  ......--------------------------....------------------------...............-.-
ENSMODP00000039046  ......--------------------------....------------------------...............-.-
ENSMODP00000038811  ......--------------------------....------------------------...............-.-
ENSMODP00000039383  ......--------------------------....------------------------...............-.-
ENSMODP00000041250  ......--------------------------....------------------------...............-.-
ENSMODP00000041237  ......--------------------------....------------------------...............-.-
ENSMODP00000040431  ......--------------------------....------------------------...............-.-
ENSMODP00000040043  ......--------------------------....------------------------...............-.-
ENSMODP00000039234  ......--------------------------....------------------------...............-.-
ENSMODP00000038908  ......--------------------------....------------------------...............-.-
ENSMODP00000039691  ......--------------------------....------------------------...............-.-
ENSMODP00000039207  ......--------------------------....------------------------...............-.-
ENSMODP00000041154  ......--------------------------....------------------------...............-.-
ENSMODP00000041263  ......--------------------------....------------------------...............-.-
ENSMODP00000038922  ......--------------------------....------------------------...............-.-
ENSMODP00000040466  ......--------------------------....------------------------...............-.-
ENSMODP00000040107  ......--------------------------....------------------------...............-.-
ENSMODP00000038922  ......--------------------------....------------------------...............-.-
ENSMODP00000040185  ......--------------------------....------------------------...............-.-
ENSMODP00000040009  ......--------------------------....------------------------...............-.-
ENSMODP00000039841  ......--------------------------....------------------------...............-.-
ENSMODP00000039295  ......--------------------------....------------------------...............-.-
ENSMODP00000039454  ......--------------------------....------------------------...............-.-
ENSMODP00000038788  ......--------------------------....------------------------...............-.-
ENSMODP00000039831  ......--------------------------....------------------------...............-.-
ENSMODP00000040454  ......--------------------------....------------------------...............-.-
ENSMODP00000039924  ......--------------------------....------------------------...............-.-
ENSMODP00000041073  ......--------------------------....------------------------...............-.-
ENSMODP00000038806  ......--------------------------....------------------------...............-.-
ENSMODP00000039381  ......--------------------------....------------------------...............-.-
ENSMODP00000039798  ......--------------------------....------------------------...............-.-
ENSMODP00000040698  ......--------------------------....------------------------...............-.-
ENSMODP00000040592  ......--------------------------....------------------------...............-.-
ENSMODP00000038871  ......--------------------------....------------------------...............-.-
ENSMODP00000039820  ......--------------------------....------------------------...............-.-
ENSMODP00000039730  ......--------------------------....------------------------...............-.-
ENSMODP00000039164  ......--------------------------....------------------------...............-.-
ENSMODP00000039750  ......--------------------------....------------------------...............-.-
ENSMODP00000039973  ......--------------------------....------------------------...............-.-
ENSMODP00000040501  ......--------------------------....------------------------...............-.-
ENSMODP00000040437  ......--------------------------....------------------------...............-.-
ENSMODP00000038880  ......--------------------------....------------------------...............-.-
ENSMODP00000039575  ......--------------------------....------------------------...............-.-
ENSMODP00000008758  ......--------------------------....------------------------...............-.-
ENSMODP00000041052  ......--------------------------....------------------------...............-.-
ENSMODP00000039051  ......--------------------------....------------------------...............-.-
ENSMODP00000040944  ......--------------------------....------------------------...............-.-
ENSMODP00000040237  ......--------------------------....------------------------...............-.-
ENSMODP00000038664  ......--------------------------....------------------------...............-.-
ENSMODP00000040821  ......--------------------------....------------------------...............-.-
ENSMODP00000038848  ......--------------------------....------------------------...............-.-
ENSMODP00000032264  ......--------------------------....------------------------...............-.-
ENSMODP00000040497  ......--------------------------....------------------------...............-.-
ENSMODP00000024080  ......--------------------------....------------------------...............-.-
ENSMODP00000024075  ......--------------------------....------------------------...............-.-
ENSMODP00000039841  ......--------------------------....------------------------...............-.-
ENSMODP00000005300  ......--------L-----------------....------------------------...............-.-
ENSMODP00000038999  ......--------------------------....------------------------...............-.-
ENSMODP00000040471  ......--------------------------....------------------------...............-.-
ENSMODP00000039453  ......--------------------------....------------------------...............-.-
ENSMODP00000003431  .....lLPVHCVAHRLHLAVVDACGNIDLVKK....CDRHIRTVFKFYQSSNKRLNELQVgaaaleqeivr....L.K
ENSMODP00000041120  ......--------------------------....----------------------CL...............V.I
ENSMODP00000040625  ......--------------------------....------------------------...............-.-
ENSMODP00000039589  ......--------------------------....------------------------...............-.-
ENSMODP00000038709  ......--------------------------....------------------------...............-.-
ENSMODP00000039282  ......--------------------------....------------------------...............-.-
ENSMODP00000041052  ......--------------------------....------------------------...............-.-
ENSMODP00000039149  ......--------------------------....------------------------...............-.-
ENSMODP00000040465  ......--------------------------....------------------------...............-.-
ENSMODP00000039233  ......--------------------------....------------------------...............-.-
ENSMODP00000003608  ......--------------------------....------------------------...............-.-
ENSMODP00000040080  ......--------------------------....------------------------...............-.-
ENSMODP00000009010  ......--------------------------....------------------------...............-.-
ENSMODP00000039267  ......--------------------------....------------------------...............-.-
ENSMODP00000038982  ......--------------------------....------------------------...............-.-
ENSMODP00000038685  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000038827  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000039663  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000039944  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000040429  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000041234  ......AVVHCSAH------------------....------------------------...............-.-
ENSMODP00000039249  ......--------------------------....------------------------...............-.-
ENSMODP00000024410  ......--------------------------....------------------------...............-.-
ENSMODP00000041250  ......--------------------------....---------DFITMPKAGRYKFCL...............V.I
ENSMODP00000006552  ......VYTLCSSCALNTWLAKSIP-VVGVSV....ALGIIEEVCSFFHRSPQLLVELDNvisvlfqnseekgneL.K
ENSMODP00000003608  ......--------------------------....------------------------...............-.-
ENSMODP00000037000  ......--------------------------....------------------------...............-.-
ENSMODP00000039291  ......--------------------------....------------------------...............-.-
ENSMODP00000035244  ......--------------------------....------------------------...............-.-
ENSMODP00000040437  ......--------------------------....------------TMPKAGQYKFCL...............V.I
ENSMODP00000020968  cnhfhpIAIHCLIHQQALLCSKSLK----WDS....VMKIVVSCVNFIRANALNHRQFQEflselnvayen....V.L
ENSMODP00000040977  .....iILWHCLNHRLQLSLDDSISEIEQVNH....LKMFLDKTYSIYHLSNTSHTELETiakeleleiik....I.G
ENSMODP00000040986  ......--------------------------....------------------------...............-.-
ENSMODP00000040102  ......--------------------------....------------TMPKAGQYKFCL...............V.I
ENSMODP00000040698  ......--------------------------....------------TMPKAGQYKFCL...............V.I
ENSMODP00000040339  ......--------------------------....------------------------...............-.-


                              160        170            180                         190       200   
                                |          |              |                           |         |   
d2bw3a2               SECPTRW.NSTYT.MLRSILDNWESVIQILS.....EAGE..................TQRIVHINKSIIQTMVNILD
ENSMODP00000011848  -------.-----.-----------------.....----..................--------------------
ENSMODP00000019498  -------.-----.-----------------.....----..................--------------------
ENSMODP00000013136  -------.-----.-----------------.....PHHI..................WPTLTDEEWIKVE-------
ENSMODP00000000258  -------.-----.-----------------.....----..................--------------------
ENSMODP00000023789  -------.-----.-----------------.....G---..................--------------------
ENSMODP00000010707  -------.-----.-----------------.....----..................--------------------
ENSMODP00000003634  -------.-----.-----------------.....----..................------------H-------
ENSMODP00000023788  -------.-----.-----------------.....----..................------------H-------
ENSMODP00000003639  -------.-----.-----------------.....----..................--------------F-----
ENSMODP00000000899  -------.-----.-----------------.....----..................--------------------
ENSMODP00000022277  -------.-----.-----------------.....----..................--------------------
ENSMODP00000013136  -------.-----.-----------------.....----..................--------------------
ENSMODP00000022283  -------.-----.-----------------.....----..................--------------------
ENSMODP00000022278  -------.-----.-----------------.....----..................--------------------
ENSMODP00000014003  -------.-----.-----------------.....----..................--------------------
ENSMODP00000009125  -------.-----.-----------------.....----..................--------------------
ENSMODP00000018959  -------.-----.-----------------.....----..................--------------------
ENSMODP00000022331  -------.-----.-----------------.....----..................--------------------
ENSMODP00000006050  -------.-----.-I---------------.....----..................--------------------
ENSMODP00000008671  -------.-----.-----------------.....----..................--------------------
ENSMODP00000037687  -------.-----.-----------------.....----..................--------------------
ENSMODP00000002956  -------.-----.-----------------.....----..................--------------------
ENSMODP00000027553  -------.-----.-----------------.....----..................--------------------
ENSMODP00000009208  -------.-----.-----------------.....----..................-------------------R
ENSMODP00000017947  -------.-----.-----------------.....----..................--------------------
ENSMODP00000017401  -------.-----.-----------------.....----..................--------------------
ENSMODP00000012810  -------.-----.-----------------.....----..................--------------------
ENSMODP00000018108  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038709  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039628  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038176  QDVPSKW.STSFH.MLERLIEQKRAIDEMSI.....ECSF..................REQISCDQWEVMQSVCHALK
ENSMODP00000039944  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038788  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038827  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039663  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040429  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039575  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039383  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041234  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040821  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039730  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038999  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041237  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041263  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040130  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040009  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039973  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041154  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040497  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040043  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041073  -------.-----.-----------------.....----..................--------------------
ENSMODP00000023743  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040431  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040237  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039798  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039454  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040592  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039820  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040107  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039515  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039512  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039295  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039164  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038871  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039051  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039453  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039381  -------.-----.-----------------.....----..................--------------------
ENSMODP00000008720  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038685  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040777  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039334  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039385  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040453  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039799  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039637  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040012  -------.-----.-----------------.....----..................--------------------
ENSMODP00000024433  -------.-----.-----------------.....----..................--------------------
ENSMODP00000024435  -------.-----.-----------------.....----..................--------------------
ENSMODP00000000191  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039903  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040636  -------.-----.-----------------.....----..................--------------------
ENSMODP00000020966  -------.-----.-----------------.....----..................--------------------
ENSMODP00000016034  -------.-----.-----------------.....----..................--------------------
ENSMODP00000004997  TSPPPCW.NSVTD.SLLLVHERYEQICEFYS.....RAKK..................MNLIQNLNKHLLSNLAAILA
ENSMODP00000003205  -------.-----.-----------------.....----..................--------------------
ENSMODP00000037910  -------.-----.--------SETIRKAGL.....GTGD..................QWKLLRDFDVHLRSFVELAS
ENSMODP00000039515  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039336  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038980  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039762  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040130  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041120  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040102  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040313  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039046  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038811  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039383  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041250  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041237  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040431  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040043  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039234  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038908  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039691  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039207  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041154  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041263  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038922  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040466  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040107  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038922  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040185  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040009  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039841  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039295  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039454  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038788  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039831  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040454  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039924  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041073  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038806  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039381  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039798  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040698  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040592  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038871  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039820  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039730  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039164  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039750  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039973  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040501  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040437  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038880  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039575  -------.-----.-----------------.....----..................--------------------
ENSMODP00000008758  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041052  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039051  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040944  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040237  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038664  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040821  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038848  -------.-----.-----------------.....----..................--------------------
ENSMODP00000032264  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040497  -------.-----.-----------------.....----..................--------------------
ENSMODP00000024080  -------.-----.--------------T--.....----..................--------------------
ENSMODP00000024075  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039841  -------.-----.-----------------.....----..................--------------------
ENSMODP00000005300  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038999  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040471  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039453  -------.-----.-----------------.....----..................--------------------
ENSMODP00000003431  DLNAIRWvASKRR.TLNALIVSWPALASHLQ.....SVAEaggqighrakgml.....KLMMSFHFIKFCHFLLDFLS
ENSMODP00000041120  VDQLTRW.PEAFP.TARA-------------.....----..................--------------------
ENSMODP00000040625  -------.-----.-----------------.....----..................------Q-------------
ENSMODP00000039589  -------.-----.-----------------.....----..................--I-----------------
ENSMODP00000038709  -------.-----.-----------------.....----..................---------------L----
ENSMODP00000039282  -------.-----.-----------------.....----..................E-------------------
ENSMODP00000041052  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039149  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040465  -------.-----.--------S--------.....----..................--------------------
ENSMODP00000039233  -------.-----.-----------------.....----..................--------------------
ENSMODP00000003608  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040080  -------.-----.-----------------.....----..................--------------------
ENSMODP00000009010  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039267  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038982  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038685  -------.-----.-----------------.....----..................--------------------
ENSMODP00000038827  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039663  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039944  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040429  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041234  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039249  -------.-----.-----------------.....----..................--------------------
ENSMODP00000024410  -------.-----.-----------------.....----..................--------------------
ENSMODP00000041250  VDQLTRW.-----.-----------------.....----..................--------------------
ENSMODP00000006552  EICRSQW.TGRHD.AFEILVDLLQALVLCLD.....NINSdttvrwdnfiagqafvlgSALVDFDFIVTVVVLKNILS
ENSMODP00000003608  -------.-----.-----------------.....----..................--------------------
ENSMODP00000037000  -------.-----.-----------------.....----..................--------------------
ENSMODP00000039291  -------.-----.-----------------.....----..................--------------------
ENSMODP00000035244  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040437  VDQLTRW.-----.-----------------.....----..................--------------------
ENSMODP00000020968  YHTEVHW.LSQGR.VLRHFY--VSQIMDFIF.....SKNKev................PEFHDAEGTWHLAFLTDVTE
ENSMODP00000040977  RVLGPRW.AACSLrVATAVWRSYPALYVSFSqsssySGLA..................KRLANINFLKDLALTMDILE
ENSMODP00000040986  -------.-----.-----------------.....----..................--------------------
ENSMODP00000040102  VDQLTRW.-----.-----------------.....----..................--------------------
ENSMODP00000040698  VDQLTRW.-----.-----------------.....----..................--------------------
ENSMODP00000040339  -------.-----.-----------------.....----..................--------------------


                          210       220       230                                           240     
                            |         |         |                                             |     
d2bw3a2               GFERIFKELQTCSSPSLCFVVPSILKVKEICSPD....................................VGDVADIA
ENSMODP00000011848  ----------------------------------....................................--------
ENSMODP00000019498  ----------------------------------....................................--------
ENSMODP00000013136  ----------------------------------....................................--------
ENSMODP00000000258  ----------------------------------....................................--------
ENSMODP00000023789  ----------------------------------....................................--------
ENSMODP00000010707  --------------HILNLFFPSIYDVKYLMKS-....................................--------
ENSMODP00000003634  ----------------------------------....................................--------
ENSMODP00000023788  ----------------------------------....................................--------
ENSMODP00000003639  ----------------------------------....................................--------
ENSMODP00000000899  ----------------------------------....................................--------
ENSMODP00000022277  ----------------------------------....................................--------
ENSMODP00000013136  ----------------------------------....................................--------
ENSMODP00000022283  ----------------------------------....................................--------
ENSMODP00000022278  ----------------------------------....................................--------
ENSMODP00000014003  ----------------------------------....................................--------
ENSMODP00000009125  ----------------------------------....................................--------
ENSMODP00000018959  ----------------------------------....................................--------
ENSMODP00000022331  ----------------------------------....................................-------Q
ENSMODP00000006050  ----------------------------------....................................--------
ENSMODP00000008671  ----------------------------------....................................--------
ENSMODP00000037687  ----------------------------------....................................--------
ENSMODP00000002956  ----------------------------------....................................--------
ENSMODP00000027553  ----------------------------------....................................--------
ENSMODP00000009208  PLPESYEQFK----LNIHGLFPVLIDTKNVTKEI....................................WK------
ENSMODP00000017947  ----------------------------------....................................--------
ENSMODP00000017401  ----------------------------------....................................--------
ENSMODP00000012810  ----------------------------------....................................--------
ENSMODP00000018108  ----------------------------------....................................--------
ENSMODP00000038709  ----------------------------------....................................--------
ENSMODP00000039628  ----------------------------------....................................--------
ENSMODP00000038176  PFEAASREMSTHV-STLSQVIPMIHILNRKIEML....................................FEETMGID
ENSMODP00000039944  ----------------------------------....................................--------
ENSMODP00000038788  ----------------------------------....................................--------
ENSMODP00000038827  ----------------------------------....................................--------
ENSMODP00000039663  ----------------------------------....................................--------
ENSMODP00000040429  ----------------------------------....................................--------
ENSMODP00000039575  ----------------------------------....................................--------
ENSMODP00000039383  ----------------------------------....................................--------
ENSMODP00000041234  ----------------------------------....................................--------
ENSMODP00000040821  ----------------------------------....................................--------
ENSMODP00000039730  ----------------------------------....................................--------
ENSMODP00000038999  ----------------------------------....................................--------
ENSMODP00000041237  ----------------------------------....................................--------
ENSMODP00000041263  ----------------------------------....................................--------
ENSMODP00000040130  ----------------------------------....................................--------
ENSMODP00000040009  ----------------------------------....................................--------
ENSMODP00000039973  ----------------------------------....................................--------
ENSMODP00000041154  ----------------------------------....................................--------
ENSMODP00000040497  ----------------------------------....................................--------
ENSMODP00000040043  ----------------------------------....................................--------
ENSMODP00000041073  ----------------------------------....................................--------
ENSMODP00000023743  ----------------------------------....................................--------
ENSMODP00000040431  ----------------------------------....................................--------
ENSMODP00000040237  ----------------------------------....................................--------
ENSMODP00000039798  ----------------------------------....................................--------
ENSMODP00000039454  ----------------------------------....................................--------
ENSMODP00000040592  ----------------------------------....................................--------
ENSMODP00000039820  ----------------------------------....................................--------
ENSMODP00000040107  ----------------------------------....................................--------
ENSMODP00000039515  -----------------------L----------....................................--------
ENSMODP00000039512  ----------------------------------....................................--------
ENSMODP00000039295  ----------------------------------....................................--------
ENSMODP00000039164  ----------------------------------....................................--------
ENSMODP00000038871  ----------------------------------....................................--------
ENSMODP00000039051  ----------------------------------....................................--------
ENSMODP00000039453  ----------------------------------....................................--------
ENSMODP00000039381  ----------------------------------....................................--------
ENSMODP00000008720  ----------------------------------....................................--------
ENSMODP00000038685  ----------------------------------....................................--------
ENSMODP00000040777  ----------------------------------....................................--------
ENSMODP00000039334  ----------------------------------....................................--------
ENSMODP00000039385  ----------------------------------....................................--------
ENSMODP00000040453  ----------------------------------....................................--------
ENSMODP00000039799  ----------------------------------....................................--------
ENSMODP00000039637  ----------------------------------....................................--------
ENSMODP00000040012  ----------------------------------....................................--------
ENSMODP00000024433  ----------------------------------....................................--------
ENSMODP00000024435  ------------------N---------------....................................--------
ENSMODP00000000191  ----------------------------------....................................--------
ENSMODP00000039903  ----------------------------------....................................--------
ENSMODP00000040636  ----------------------------------....................................--------
ENSMODP00000020966  ----------------------------------....................................--------
ENSMODP00000016034  ----------------------------------....................................--------
ENSMODP00000004997  PVKQAVIELSHESRPTLQLVLPTYVKLEKLFTSK....................................ANDAGVVS
ENSMODP00000003205  ----------------------------------....................................--------
ENSMODP00000037910  LANEKLRCKENWS---------------------....................................--------
ENSMODP00000039515  ----------------------------------....................................--------
ENSMODP00000039336  ----------------------------------....................................--------
ENSMODP00000038980  ----------------------------------....................................--------
ENSMODP00000039762  ----------------------------------....................................--------
ENSMODP00000040130  ----------------------------------....................................--------
ENSMODP00000041120  ----------------------------------....................................--------
ENSMODP00000040102  ----------------------------------....................................--------
ENSMODP00000040313  ----------------------------------....................................--------
ENSMODP00000039046  ----------------------------------....................................--------
ENSMODP00000038811  ----------------------------------....................................--------
ENSMODP00000039383  ----------------------------------....................................--------
ENSMODP00000041250  ----------------------------------....................................--------
ENSMODP00000041237  ----------------------------------....................................--------
ENSMODP00000040431  ----------------------------------....................................--------
ENSMODP00000040043  ----------------------------------....................................--------
ENSMODP00000039234  ----------------------------------....................................--------
ENSMODP00000038908  ----------------------------------....................................--------
ENSMODP00000039691  ----------------------------------....................................--------
ENSMODP00000039207  ----------------------------------....................................--------
ENSMODP00000041154  ----------------------------------....................................--------
ENSMODP00000041263  ----------------------------------....................................--------
ENSMODP00000038922  ----------------------------------....................................--------
ENSMODP00000040466  ----------------------------------....................................--------
ENSMODP00000040107  ----------------------------------....................................--------
ENSMODP00000038922  ----------------------------------....................................--------
ENSMODP00000040185  ----------------------------------....................................--------
ENSMODP00000040009  ----------------------------------....................................--------
ENSMODP00000039841  ----------------------------------....................................--------
ENSMODP00000039295  ----------------------------------....................................--------
ENSMODP00000039454  ----------------------------------....................................--------
ENSMODP00000038788  ----------------------------------....................................--------
ENSMODP00000039831  ----------------------------------....................................--------
ENSMODP00000040454  ----------------------------------....................................--------
ENSMODP00000039924  ----------------------------------....................................--------
ENSMODP00000041073  ----------------------------------....................................--------
ENSMODP00000038806  ----------------------------------....................................--------
ENSMODP00000039381  ----------------------------------....................................--------
ENSMODP00000039798  ----------------------------------....................................--------
ENSMODP00000040698  ----------------------------------....................................--------
ENSMODP00000040592  ----------------------------------....................................--------
ENSMODP00000038871  ----------------------------------....................................--------
ENSMODP00000039820  ----------------------------------....................................--------
ENSMODP00000039730  ----------------------------------....................................--------
ENSMODP00000039164  ----------------------------------....................................--------
ENSMODP00000039750  ----------------------------------....................................--------
ENSMODP00000039973  ----------------------------------....................................--------
ENSMODP00000040501  ----------------------------------....................................--------
ENSMODP00000040437  ----------------------------------....................................--------
ENSMODP00000038880  ----------------------------------....................................--------
ENSMODP00000039575  ----------------------------------....................................--------
ENSMODP00000008758  ----------------------------------....................................--------
ENSMODP00000041052  ----------------------------------....................................--------
ENSMODP00000039051  ----------------------------------....................................--------
ENSMODP00000040944  ----------------------------------....................................--------
ENSMODP00000040237  ----------------------------------....................................--------
ENSMODP00000038664  ----------------------------------....................................--------
ENSMODP00000040821  ----------------------------------....................................--------
ENSMODP00000038848  ----------------------------------....................................--------
ENSMODP00000032264  ----------------------------------....................................---HRLGL
ENSMODP00000040497  ----------------------------------....................................--------
ENSMODP00000024080  ----------------------------------....................................--------
ENSMODP00000024075  ----------------------------------....................................----D---
ENSMODP00000039841  ------R---------------------------....................................--------
ENSMODP00000005300  ----------------------------------....................................--------
ENSMODP00000038999  ----------------------------------....................................--------
ENSMODP00000040471  ----------------------------------....................................--------
ENSMODP00000039453  ----------------------------------....................................--------
ENSMODP00000003431  IFRPVSEVCQKEI-VLITEVNSTLERAYIALETLrcqagpkeeefntnfkegqlygipldriemaeqrfqA-------
ENSMODP00000041120  ----------------------------------....................................--------
ENSMODP00000040625  ----------------------------------....................................--------
ENSMODP00000039589  ----------------------------------....................................--------
ENSMODP00000038709  ----------------------------------....................................--------
ENSMODP00000039282  ----------------------------------....................................--------
ENSMODP00000041052  ----------------------------------....................................--------
ENSMODP00000039149  ----------------------------------....................................--------
ENSMODP00000040465  ----------------------------------....................................--------
ENSMODP00000039233  ----------------------------------....................................--------
ENSMODP00000003608  ----------------------------------....................................--------
ENSMODP00000040080  -LDIVMSAFQ----PKINSILAMTSSC-------....................................--------
ENSMODP00000009010  ---Q------------------------------....................................--------
ENSMODP00000039267  ----------------------------------....................................--------
ENSMODP00000038982  ----------------------------------....................................--------
ENSMODP00000038685  ----------------------------------....................................--------
ENSMODP00000038827  ----------------------------------....................................--------
ENSMODP00000039663  ----------------------------------....................................--------
ENSMODP00000039944  ----------------------------------....................................--------
ENSMODP00000040429  ----------------------------------....................................--------
ENSMODP00000041234  ----------------------------------....................................--------
ENSMODP00000039249  ----------------------------------....................................--------
ENSMODP00000024410  ----------------------------------....................................--------
ENSMODP00000041250  ----------------------------------....................................--------
ENSMODP00000006552  FTRAFGKNLQGQT----SDVFFAASSLTAVLHSL....................................NEVMENIE
ENSMODP00000003608  ----------------------------------....................................--------
ENSMODP00000037000  ----------------------------------....................................--------
ENSMODP00000039291  ----------------------------------....................................--------
ENSMODP00000035244  ----------------------------------....................................--------
ENSMODP00000040437  ----------------------------------....................................--------
ENSMODP00000020968  LLNNFNVQLQGKGKLICDMQSHVKA---------....................................------FE
ENSMODP00000040977  EFSLLSTALQSRS-TNIQKAQKLIQCTIKALENL....................................KTRPGKYE
ENSMODP00000040986  ----------------------------------....................................--------
ENSMODP00000040102  ----------------------------------....................................--------
ENSMODP00000040698  ----------------------------------....................................--------
ENSMODP00000040339  ----------------------------------....................................--------


                                                                           250       260        270 
                                                                             |         |          | 
d2bw3a2               ...................................................KLKVNIIKNVRIIWEENL.SIWHYTAF
ENSMODP00000011848  ...................................................------------------.--------
ENSMODP00000019498  ...................................................------------------.--------
ENSMODP00000013136  ...................................................------------------.--------
ENSMODP00000000258  ...................................................------------------.--------
ENSMODP00000023789  ...................................................------------------.--------
ENSMODP00000010707  ...................................................------------------.--------
ENSMODP00000003634  ...................................................------------------.--------
ENSMODP00000023788  ...................................................------------------.--------
ENSMODP00000003639  ...................................................------------------.--------
ENSMODP00000000899  ...................................................------------------.--------
ENSMODP00000022277  ...................................................------------------.--------
ENSMODP00000013136  ...................................................------------------.--------
ENSMODP00000022283  ...................................................------------------.--------
ENSMODP00000022278  ...................................................------------------.--------
ENSMODP00000014003  ...................................................------------------.--------
ENSMODP00000009125  ...................................................------------------.--------
ENSMODP00000018959  ...................................................------------------.--------
ENSMODP00000022331  ...................................................------------------.--------
ENSMODP00000006050  ...................................................------------------.--------
ENSMODP00000008671  ...................................................------------------.--------
ENSMODP00000037687  ...................................................------------------.--------
ENSMODP00000002956  ...................................................------------------.--------
ENSMODP00000027553  ...................................................------------------.--------
ENSMODP00000009208  ...................................................------------------.--------
ENSMODP00000017947  ...................................................------------------.--------
ENSMODP00000017401  ...................................................------------------.--------
ENSMODP00000012810  ...................................................------------------.--------
ENSMODP00000018108  ...................................................------------------.--------
ENSMODP00000038709  ...................................................------------------.--------
ENSMODP00000039628  ...................................................-----------E------.--------
ENSMODP00000038176  ...................................................TMLKSLKEAMVSRLSSTLhDPRYIFAT
ENSMODP00000039944  ...................................................------------------.LNQIYSCL
ENSMODP00000038788  ...................................................------------------.LNQIYSCL
ENSMODP00000038827  ...................................................------------------.LNQIYSCL
ENSMODP00000039663  ...................................................------------------.LNQIYSCL
ENSMODP00000040429  ...................................................------------------.LNQIYSCL
ENSMODP00000039575  ...................................................------------------.LNQIYSCL
ENSMODP00000039383  ...................................................------------------.LNQIYSCL
ENSMODP00000041234  ...................................................------------------.LNQIYSCL
ENSMODP00000040821  ...................................................------------------.-NQIYSCL
ENSMODP00000039730  ...................................................------------------.LNQIYSCL
ENSMODP00000038999  ...................................................------------------.LNQIYSCL
ENSMODP00000041237  ...................................................------------------.LNQIYSCL
ENSMODP00000041263  ...................................................------------------.LNQIYSCL
ENSMODP00000040130  ...................................................------------------.LNQIYSCL
ENSMODP00000040009  ...................................................------------------.-NQIYSCL
ENSMODP00000039973  ...................................................------------------.LNEIYSCL
ENSMODP00000041154  ...................................................------------------.LNQIYSCL
ENSMODP00000040497  ...................................................------------------.LNQIYSCL
ENSMODP00000040043  ...................................................------------------.-NQIYSCL
ENSMODP00000041073  ...................................................------------------.LNQIYSCL
ENSMODP00000023743  ...................................................------------------.--------
ENSMODP00000040431  ...................................................------------------.-NQIYSCL
ENSMODP00000040237  ...................................................------------------.LNQIYSCL
ENSMODP00000039798  ...................................................------------------.LNQIYSCL
ENSMODP00000039454  ...................................................------------------.-NQIYSCL
ENSMODP00000040592  ...................................................------------------.LNQIYSCL
ENSMODP00000039820  ...................................................------------------.LNQIYSCL
ENSMODP00000040107  ...................................................------------------.LNQIYSCL
ENSMODP00000039515  ...................................................------------------.--------
ENSMODP00000039512  ...................................................------------------.--------
ENSMODP00000039295  ...................................................------------------.LNQIYSCL
ENSMODP00000039164  ...................................................------------------.-NQIYSCL
ENSMODP00000038871  ...................................................------------------.-NQIYSCL
ENSMODP00000039051  ...................................................------------------.-N------
ENSMODP00000039453  ...................................................------------------.--------
ENSMODP00000039381  ...................................................------------------.LNQIYSCL
ENSMODP00000008720  ...................................................------------------.--------
ENSMODP00000038685  ...................................................------------------.LNQIYSCL
ENSMODP00000040777  ...................................................------------------.LNQIYSCL
ENSMODP00000039334  ...................................................------------------.-NQIYSCL
ENSMODP00000039385  ...................................................------------------.-NQIYSCL
ENSMODP00000040453  ...................................................------------------.-NQIYSCL
ENSMODP00000039799  ...................................................------------------.-NQIYSCL
ENSMODP00000039637  ...................................................------------------.-NQIYSCL
ENSMODP00000040012  ...................................................------------------.-NQIYSCL
ENSMODP00000024433  ...................................................------------------.--------
ENSMODP00000024435  ...................................................------------------.--------
ENSMODP00000000191  ...................................................------------------.--------
ENSMODP00000039903  ...................................................------------------.LNQIYSCL
ENSMODP00000040636  ...................................................------------------.--------
ENSMODP00000020966  ...................................................------------------.--------
ENSMODP00000016034  ...................................................------------------.--------
ENSMODP00000004997  ...................................................KLCHLFLEALKENFKVH-.-SAHKVAM
ENSMODP00000003205  ...................................................------------------.--------
ENSMODP00000037910  ...................................................------------------.--------
ENSMODP00000039515  ...................................................------------------.--------
ENSMODP00000039336  ...................................................------------------.--------
ENSMODP00000038980  ...................................................------------------.--------
ENSMODP00000039762  ...................................................------------------.--------
ENSMODP00000040130  ...................................................------------------.--------
ENSMODP00000041120  ...................................................------------------.--------
ENSMODP00000040102  ...................................................------------------.--------
ENSMODP00000040313  ...................................................------------------.--------
ENSMODP00000039046  ...................................................------------------.--------
ENSMODP00000038811  ...................................................------------------.--------
ENSMODP00000039383  ...................................................------------------.--------
ENSMODP00000041250  ...................................................------------------.--------
ENSMODP00000041237  ...................................................------------------.--------
ENSMODP00000040431  ...................................................------------------.--------
ENSMODP00000040043  ...................................................------------------.--------
ENSMODP00000039234  ...................................................------------------.--------
ENSMODP00000038908  ...................................................------------------.--------
ENSMODP00000039691  ...................................................------------------.--------
ENSMODP00000039207  ...................................................------------------.--------
ENSMODP00000041154  ...................................................------------------.--------
ENSMODP00000041263  ...................................................------------------.--------
ENSMODP00000038922  ...................................................------------------.--------
ENSMODP00000040466  ...................................................------------------.--------
ENSMODP00000040107  ...................................................------------------.--------
ENSMODP00000038922  ...................................................------------------.LNQIYSCL
ENSMODP00000040185  ...................................................------------------.--------
ENSMODP00000040009  ...................................................------------------.--------
ENSMODP00000039841  ...................................................------------------.--------
ENSMODP00000039295  ...................................................------------------.--------
ENSMODP00000039454  ...................................................------------------.--------
ENSMODP00000038788  ...................................................------------------.--------
ENSMODP00000039831  ...................................................------------------.--------
ENSMODP00000040454  ...................................................------------------.--------
ENSMODP00000039924  ...................................................------------------.--------
ENSMODP00000041073  ...................................................------------------.--------
ENSMODP00000038806  ...................................................------------------.--------
ENSMODP00000039381  ...................................................------------------.--------
ENSMODP00000039798  ...................................................------------------.--------
ENSMODP00000040698  ...................................................------------------.--------
ENSMODP00000040592  ...................................................------------------.--------
ENSMODP00000038871  ...................................................------------------.--------
ENSMODP00000039820  ...................................................------------------.--------
ENSMODP00000039730  ...................................................------------------.--------
ENSMODP00000039164  ...................................................------------------.--------
ENSMODP00000039750  ...................................................------------------.--------
ENSMODP00000039973  ...................................................------------------.--------
ENSMODP00000040501  ...................................................------------------.--------
ENSMODP00000040437  ...................................................------------------.--------
ENSMODP00000038880  ...................................................------------------.--------
ENSMODP00000039575  ...................................................------------------.--------
ENSMODP00000008758  ...................................................------------------.--------
ENSMODP00000041052  ...................................................------------------.--------
ENSMODP00000039051  ...................................................------------------.--------
ENSMODP00000040944  ...................................................------------------.--------
ENSMODP00000040237  ...................................................------------------.--------
ENSMODP00000038664  ...................................................------------------.--------
ENSMODP00000040821  ...................................................------------------.--------
ENSMODP00000038848  ...................................................------------------.--------
ENSMODP00000032264  ...................................................PYKRALRTLMADYLKR--.--------
ENSMODP00000040497  ...................................................------------------.--------
ENSMODP00000024080  ...................................................------------------.--------
ENSMODP00000024075  ...................................................------------------.--------
ENSMODP00000039841  ...................................................------------------.--------
ENSMODP00000005300  ...................................................------------------.--------
ENSMODP00000038999  ...................................................------------------.--------
ENSMODP00000040471  ...................................................------------------.--------
ENSMODP00000039453  ...................................................------------------.--------
ENSMODP00000003431  ...................................................------------------.--------
ENSMODP00000041120  ...................................................------------------.--------
ENSMODP00000040625  ...................................................------------------.--------
ENSMODP00000039589  ...................................................------------------.--------
ENSMODP00000038709  ...................................................------------------.--------
ENSMODP00000039282  ...................................................------------------.--------
ENSMODP00000041052  ...................................................------------------.--------
ENSMODP00000039149  ...................................................------------------.--------
ENSMODP00000040465  ...................................................------------------.--------
ENSMODP00000039233  ...................................................------------------.--------
ENSMODP00000003608  ...................................................------------------.--------
ENSMODP00000040080  ...................................................------------------.--------
ENSMODP00000009010  ...................................................------------------.--------
ENSMODP00000039267  ...................................................------------------.--------
ENSMODP00000038982  ...................................................------------------.--------
ENSMODP00000038685  ...................................................------------------.--------
ENSMODP00000038827  ...................................................------------------.--------
ENSMODP00000039663  ...................................................------------------.--------
ENSMODP00000039944  ...................................................------------------.--------
ENSMODP00000040429  ...................................................------------------.--------
ENSMODP00000041234  ...................................................------------------.--------
ENSMODP00000039249  ...................................................------------------.--------
ENSMODP00000024410  ...................................................------------------.--------
ENSMODP00000041250  ...................................................------------------.--------
ENSMODP00000006552  vyhefwfeeatnlatkldieiklpgkfrrsqqanlepevtsesyykevlsvPTVEHIIQELKDIFSEQH.--------
ENSMODP00000003608  ...................................................------------------.--------
ENSMODP00000037000  ...................................................------------------.--------
ENSMODP00000039291  ...................................................------------------.--------
ENSMODP00000035244  ...................................................-------KTVLQVYGSYChWKHVVDFV
ENSMODP00000040437  ...................................................------------------.--------
ENSMODP00000020968  ...................................................VKLGLLIKQMKEENF---.--------
ENSMODP00000040977  ...................................................SQIED-------LIKSNE.--------
ENSMODP00000040986  ...................................................------------------.--------
ENSMODP00000040102  ...................................................------------------.--------
ENSMODP00000040698  ...................................................------------------.--------
ENSMODP00000040339  ...................................................-----------T------.--------


                            280       290                                       300       310       
                              |         |                                         |         |       
d2bw3a2               FFYPPALHMQQEKVAQIKE..FCLSKM..............................EDLELINRMSSFNELSATQLN
ENSMODP00000011848  -------------------..------..............................---------------------
ENSMODP00000019498  -------------------..------..............................---------------------
ENSMODP00000013136  -------------------..------..............................---------------------
ENSMODP00000000258  -------------------..------..............................---------------------
ENSMODP00000023789  -------------------..------..............................---------------------
ENSMODP00000010707  -------------------..------..............................---------------------
ENSMODP00000003634  -------------------..------..............................---------------------
ENSMODP00000023788  -------------------..------..............................---------------------
ENSMODP00000003639  -------------------..------..............................---------------------
ENSMODP00000000899  ------------------S..------..............................---------------------
ENSMODP00000022277  -----------I-------..------..............................---------------------
ENSMODP00000013136  -------------------..------..............................---------------------
ENSMODP00000022283  -------------------..------..............................----I----------------
ENSMODP00000022278  -------------------..------..............................---------------------
ENSMODP00000014003  -------------------..------..............................---------------------
ENSMODP00000009125  -------------------..------..............................---------------------
ENSMODP00000018959  -------------------..------..............................---------------------
ENSMODP00000022331  -------------------..------..............................---------------------
ENSMODP00000006050  -------------------..------..............................---------------------
ENSMODP00000008671  -------------------..------..............................---------------------
ENSMODP00000037687  -------------------..------..............................---------------------
ENSMODP00000002956  -------------------..------..............................-------------------I-
ENSMODP00000027553  -------------------..------..............................---------------------
ENSMODP00000009208  -------------------..------..............................---------------------
ENSMODP00000017947  -------------------..------..............................---------------------
ENSMODP00000017401  -------------------..------..............................-----------------Y---
ENSMODP00000012810  -------------------..------..............................---------------------
ENSMODP00000018108  -------------------..------..............................---------------------
ENSMODP00000038709  -------------------..------..............................---------------------
ENSMODP00000039628  -------------------..------..............................---------------------
ENSMODP00000038176  LLDPRYKASLFT-------..----EE..............................EAEQYKQDLIRELEILSSTSD
ENSMODP00000039944  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000038788  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000038827  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000039663  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000040429  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000039575  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000039383  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000041234  GITPKFHV-----------..-PYHPQ..............................SSGQV----------------
ENSMODP00000040821  GITPKFHV-----------..-PYHPQ..............................---------------------
ENSMODP00000039730  GITPKFHV-----------..-PYHPQ..............................---------------------
ENSMODP00000038999  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000041237  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000041263  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000040130  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000040009  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000039973  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000041154  GITPKFHV-----------..-PYHPQ..............................SSGQV----------------
ENSMODP00000040497  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000040043  GITPKFHV-----------..------..............................---------------------
ENSMODP00000041073  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000023743  -------------------..------..............................---------------------
ENSMODP00000040431  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000040237  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000039798  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000039454  GITPKFHVP----------..------..............................---------------------
ENSMODP00000040592  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000039820  GITPKFHV-----------..-PYHPQ..............................SSG------------------
ENSMODP00000040107  GITPKFHV-----------..-PYHPQ..............................SS-------------------
ENSMODP00000039515  -------------------..------..............................---------------------
ENSMODP00000039512  -------------------..------..............................---------------------
ENSMODP00000039295  GITPKFHV-----------..-PYHPQ..............................SSGQV----------------
ENSMODP00000039164  GITPKFHVP----------..------..............................---------------------
ENSMODP00000038871  GITPKFHV-----------..------..............................---------------------
ENSMODP00000039051  -------------------..------..............................---------------------
ENSMODP00000039453  -------------------..------..............................---------------------
ENSMODP00000039381  GITPKFHV-----------..-PYHPQ..............................SSGQVE---------------
ENSMODP00000008720  -------------------..------..............................---------------------
ENSMODP00000038685  GITPKFHV-----------..-PYHPQ..............................SSGQV----------------
ENSMODP00000040777  GITPKFHI-----------..------..............................---------------------
ENSMODP00000039334  GITPKFHV-----------..-PYHPQ..............................SSGQVERMNK-----------
ENSMODP00000039385  GITPKFHV-----------..-PYHPQ..............................SSGQVER--------------
ENSMODP00000040453  GITPKFHV-----------..-PYHPQ..............................SSGQVERMN------------
ENSMODP00000039799  GITPKFHVPYHP-------..-----Q..............................---------------------
ENSMODP00000039637  GITPKFHV-----------..-PYHPQ..............................SSGQVERMN------------
ENSMODP00000040012  GITPKFHV-----------..-PYHPQ..............................SSGQVERM-------------
ENSMODP00000024433  -------------------..------..............................---------------------
ENSMODP00000024435  -------------------..------..............................---------------------
ENSMODP00000000191  -------------------..------..............................---------------------
ENSMODP00000039903  GITPKFHV-----------..-PYYPQ..............................SSGQVERMNKEL---------
ENSMODP00000040636  -------------------..------..............................---------------------
ENSMODP00000020966  -------------------..------..............................---------------------
ENSMODP00000016034  -------------------..------..............................---------------------
ENSMODP00000004997  ILDPQQKLRPVPPYQHEEI..IGKVCE..............................LINEVKESWSEEVDFEPSTKK
ENSMODP00000003205  -------------------..------..............................---------------------
ENSMODP00000037910  -------------------..------..............................---------------------
ENSMODP00000039515  -------------------..------..............................---------------------
ENSMODP00000039336  -------------------..------..............................---------------------
ENSMODP00000038980  -------------------..------..............................---------------------
ENSMODP00000039762  -------------------..------..............................---------------------
ENSMODP00000040130  -------------------..------..............................---------------------
ENSMODP00000041120  -------------------..------..............................---------------------
ENSMODP00000040102  -------------------..------..............................---------------------
ENSMODP00000040313  -------------------..------..............................---------------------
ENSMODP00000039046  -------------------..------..............................---------------------
ENSMODP00000038811  -------------------..------..............................---------------------
ENSMODP00000039383  -------------------..------..............................---------------------
ENSMODP00000041250  -------------------..------..............................---------------------
ENSMODP00000041237  -------------------..------..............................---------------------
ENSMODP00000040431  -------------------..------..............................---------------------
ENSMODP00000040043  -------------------..------..............................---------------------
ENSMODP00000039234  -------------------..------..............................---------------------
ENSMODP00000038908  -------------------..------..............................---------------------
ENSMODP00000039691  -------------------..------..............................---------------------
ENSMODP00000039207  -------------------..------..............................---------------------
ENSMODP00000041154  -------------------..------..............................---------------------
ENSMODP00000041263  -------------------..------..............................---------------------
ENSMODP00000038922  -------------------..------..............................---------------------
ENSMODP00000040466  -------------------..------..............................---------------------
ENSMODP00000040107  -------------------..------..............................---------------------
ENSMODP00000038922  GITPKFHV-----------..------..............................---------------------
ENSMODP00000040185  -------------------..------..............................---------------------
ENSMODP00000040009  -------------------..------..............................---------------------
ENSMODP00000039841  -------------------..------..............................---------------------
ENSMODP00000039295  -------------------..------..............................---------------------
ENSMODP00000039454  -------------------..------..............................---------------------
ENSMODP00000038788  -------------------..------..............................---------------------
ENSMODP00000039831  -------------------..------..............................---------------------
ENSMODP00000040454  -------------------..------..............................---------------------
ENSMODP00000039924  -------------------..------..............................---------------------
ENSMODP00000041073  -------------------..------..............................---------------------
ENSMODP00000038806  -------------------..------..............................---------------------
ENSMODP00000039381  -------------------..------..............................---------------------
ENSMODP00000039798  -------------------..------..............................---------------------
ENSMODP00000040698  -------------------..------..............................---------------------
ENSMODP00000040592  -------------------..------..............................---------------------
ENSMODP00000038871  -------------------..------..............................---------------------
ENSMODP00000039820  -------------------..------..............................---------------------
ENSMODP00000039730  -------------------..------..............................---------------------
ENSMODP00000039164  -------------------..------..............................---------------------
ENSMODP00000039750  -------------------..------..............................---------------------
ENSMODP00000039973  -------------------..------..............................---------------------
ENSMODP00000040501  -------------------..------..............................---------------------
ENSMODP00000040437  -------------------..------..............................---------------------
ENSMODP00000038880  -------------------..------..............................---------------------
ENSMODP00000039575  -------------------..------..............................---------------------
ENSMODP00000008758  -------------------..------..............................---------------------
ENSMODP00000041052  -------------------..------..............................---------------------
ENSMODP00000039051  -------------------..------..............................---------------------
ENSMODP00000040944  -------------------..------..............................---------------------
ENSMODP00000040237  -------------------..------..............................---------------------
ENSMODP00000038664  -------------------..------..............................---------------------
ENSMODP00000040821  -------------------..------..............................---------------------
ENSMODP00000038848  -------------------..------..............................---------------------
ENSMODP00000032264  -------------------..------..............................---------------------
ENSMODP00000040497  -------------------..------..............................---------------------
ENSMODP00000024080  -------------------..------..............................---------------------
ENSMODP00000024075  -------------------..------..............................---------------------
ENSMODP00000039841  -------------------..------..............................---------------------
ENSMODP00000005300  -------------------..------..............................---------------------
ENSMODP00000038999  -------------------..------..............................---------------------
ENSMODP00000040471  -------------------..------..............................---------------------
ENSMODP00000039453  -------------------..------..............................---------------------
ENSMODP00000003431  -------------------..--DREN..............................VILTGIEYLQQR---------
ENSMODP00000041120  -------------------..------..............................---------------------
ENSMODP00000040625  -------------------..------..............................---------------------
ENSMODP00000039589  -------------------..------..............................---------------------
ENSMODP00000038709  -------------------..------..............................---------------------
ENSMODP00000039282  -------------------..------..............................---------------------
ENSMODP00000041052  -------------------..------..............................---------------------
ENSMODP00000039149  -------------------..------..............................---------------------
ENSMODP00000040465  -------------------..------..............................---------------------
ENSMODP00000039233  -------------------..------..............................---------------------
ENSMODP00000003608  -------------------..------..............................---------------------
ENSMODP00000040080  -------------------..------..............................---------------------
ENSMODP00000009010  -------------------..------..............................---------------------
ENSMODP00000039267  -------------------..------..............................---------------------
ENSMODP00000038982  -------------------..------..............................---------------------
ENSMODP00000038685  -------------------..------..............................---------------------
ENSMODP00000038827  -------------------..------..............................---------------------
ENSMODP00000039663  -------------------..------..............................---------------------
ENSMODP00000039944  -------------------..------..............................---------------------
ENSMODP00000040429  -------------------..------..............................---------------------
ENSMODP00000041234  -------------------..------..............................---------------------
ENSMODP00000039249  -------------------..------..............................---------------------
ENSMODP00000024410  -------------------..------..............................---------------------
ENSMODP00000041250  -------------------..------..............................---------------------
ENSMODP00000006552  -------------------..-LKALK..............................CLSLVPSVMGQL-------KF
ENSMODP00000003608  -------------------..------..............................---------------------
ENSMODP00000037000  -------------------..------..............................---------------------
ENSMODP00000039291  -------------------..------..............................-------------D-------
ENSMODP00000035244  VLDPRIAAWLLD-------..------..............................---------------------
ENSMODP00000040437  -------------------..------..............................---------------------
ENSMODP00000020968  -------------CHLPLT..QNLLAEkpliafpketcvdsleklqkkafpysfsitHFLLTLKMWI-----------
ENSMODP00000040977  -----FKDIPFNKNNKFNTlpRNLLLE..............................KIIQHMHLRLLLEGNDD----
ENSMODP00000040986  -------------------..------..............................---------------------
ENSMODP00000040102  -------------------..------..............................---------------------
ENSMODP00000040698  -------------------..------..............................---------------------
ENSMODP00000040339  -------------------..------..............................---------------------


                      320                   330        340                               350       3
                        |                     |          |                                 |        
d2bw3a2               QSDSN............SHNSIDLTSHSKDIS.TTSFFFP........................QLTQNNSREPPVCP
ENSMODP00000011848  -----............---------------.-------........................--------------
ENSMODP00000019498  -----............---------------.-------........................-------------K
ENSMODP00000013136  -----............---------------.-------........................--------------
ENSMODP00000000258  -----............---------------.-------........................--------------
ENSMODP00000023789  -----............---------------.-------........................--------------
ENSMODP00000010707  -----............---------------.-------........................--------------
ENSMODP00000003634  -----............---------------.-------........................--------------
ENSMODP00000023788  -----............---------------.-------........................--------------
ENSMODP00000003639  -----............---------------.-------........................--------------
ENSMODP00000000899  -----............---------------.-------........................--------------
ENSMODP00000022277  -----............---------------.-------........................--------------
ENSMODP00000013136  -----............---------------.-------........................--------------
ENSMODP00000022283  -----............---------------.-------........................--------------
ENSMODP00000022278  -----............---------------.-------........................--------------
ENSMODP00000014003  -----............---------------.-------........................--------------
ENSMODP00000009125  -----............---------------.-------........................--------------
ENSMODP00000018959  -----............---------------.-------........................--------------
ENSMODP00000022331  -----............---------------.-------........................--------------
ENSMODP00000006050  -----............---------------.-------........................--------------
ENSMODP00000008671  -L---............---------------.-------........................--------------
ENSMODP00000037687  -----............---------------.-------........................--------------
ENSMODP00000002956  -----............---------------.-------........................--------------
ENSMODP00000027553  -----............---------------.-------........................--------------
ENSMODP00000009208  -----............---------------.-------........................--------------
ENSMODP00000017947  -----............---------------.-------........................--------------
ENSMODP00000017401  -----............---------------.-------........................--------------
ENSMODP00000012810  -----............---------------.-------........................--------------
ENSMODP00000018108  -----............---------------.-------........................--------------
ENSMODP00000038709  -----............---------------.-------........................--------------
ENSMODP00000039628  -----............---------------.-------........................--------------
ENSMODP00000038176  DKPVS............NGCDIGSPSTNSVAEdSLWSLMA........................KLKKKDLKDKTKLP
ENSMODP00000039944  -----............---------------.-------........................--------------
ENSMODP00000038788  -----............---------------.-------........................--------------
ENSMODP00000038827  -----............---------------.-------........................--------------
ENSMODP00000039663  -----............---------------.-------........................--------------
ENSMODP00000040429  -----............---------------.-------........................--------------
ENSMODP00000039575  -----............---------------.-------........................--------------
ENSMODP00000039383  -----............---------------.-------........................--------------
ENSMODP00000041234  -----............---------------.-------........................--------------
ENSMODP00000040821  -----............---------------.-------........................--------------
ENSMODP00000039730  -----............---------------.-------........................--------------
ENSMODP00000038999  -----............---------------.-------........................--------------
ENSMODP00000041237  -----............---------------.-------........................--------------
ENSMODP00000041263  -----............---------------.-------........................--------------
ENSMODP00000040130  -----............---------------.-------........................--------------
ENSMODP00000040009  -----............---------------.-------........................--------------
ENSMODP00000039973  -----............---------------.-------........................--------------
ENSMODP00000041154  -----............---------------.-------........................--------------
ENSMODP00000040497  -----............---------------.-------........................--------------
ENSMODP00000040043  -----............---------------.-------........................--------------
ENSMODP00000041073  -----............---------------.-------........................--------------
ENSMODP00000023743  -----............---------------.-------........................--------------
ENSMODP00000040431  -----............---------------.-------........................--------------
ENSMODP00000040237  -----............---------------.-------........................--------------
ENSMODP00000039798  -----............---------------.-------........................--------------
ENSMODP00000039454  -----............---------------.-------........................--------------
ENSMODP00000040592  -----............---------------.-------........................--------------
ENSMODP00000039820  -----............---------------.-------........................--------------
ENSMODP00000040107  -----............---------------.-------........................--------------
ENSMODP00000039515  -----............---------------.-------........................--------------
ENSMODP00000039512  -----............---------------.-------........................--------------
ENSMODP00000039295  -----............---------------.-------........................--------------
ENSMODP00000039164  -----............---------------.-------........................--------------
ENSMODP00000038871  -----............---------------.-------........................--------------
ENSMODP00000039051  -----............---------------.-------........................--------------
ENSMODP00000039453  -----............---------------.-------........................--------------
ENSMODP00000039381  -----............---------------.-------........................--------------
ENSMODP00000008720  -----............---------------.-------........................-------------I
ENSMODP00000038685  -----............---------------.-------........................--------------
ENSMODP00000040777  -----............---------------.-------........................--------------
ENSMODP00000039334  -----............---------------.-------........................--------------
ENSMODP00000039385  -----............---------------.-------........................--------------
ENSMODP00000040453  -----............---------------.-------........................--------------
ENSMODP00000039799  -----............---------------.-------........................--------------
ENSMODP00000039637  -----............---------------.-------........................--------------
ENSMODP00000040012  -----............---------------.-------........................--------------
ENSMODP00000024433  -----............---------------.-------........................---V----------
ENSMODP00000024435  -----............---------------.-------........................--------------
ENSMODP00000000191  -----............---------------.-------........................--------------
ENSMODP00000039903  -----............---------------.-------........................--------------
ENSMODP00000040636  -----............---------------.-------........................--------------
ENSMODP00000020966  -----............---------------.-------........................--------------
ENSMODP00000016034  -----............---SGIRPEDIKHGE.KF-----........................--------------
ENSMODP00000004997  PRAS-............---------------.-----GD........................AT---PAQEDDRFG
ENSMODP00000003205  -----............---------------.-------........................--------------
ENSMODP00000037910  -----............---------------.-------........................--------------
ENSMODP00000039515  -----............---------------.-------........................--------------
ENSMODP00000039336  -----............---------------.-------........................--------------