SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Zn-dependent exopeptidases alignments

These alignments are sequences aligned to the 0046134 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1cg2a1                              qkrdnv.........................................................
gi|269926470|ref|YP_003323093.1|   gesvnlartlaneppnvlttrefarraqslcevngltceileeedlrqrgysailavasgsse
gi|269926320|ref|YP_003322943.1|   s..............................................................
gi|269925335|ref|YP_003321958.1|   s..............................................................
gi|269925376|ref|YP_003321999.1|   dr.............................................................
gi|269925438|ref|YP_003322061.1|   q..............................................................
gi|269926083|ref|YP_003322706.1|   yt.............................................................
gi|269838949|ref|YP_003323641.1|   gpl............................................................
gi|269926500|ref|YP_003323123.1|   si.............................................................
TLn_gi|427723016|ref|YP_007070293.1| cegtiyarelvnspanvinpvtlaasvkeladeygleltvlgqdeceaqnmgsylgvaeatdl
TLn_gi|427722057|ref|YP_007069334.1| r..............................................................
TLn_gi|427722694|ref|YP_007069971.1| e..............................................................
TLn_gi|427723545|ref|YP_007070822.1| vv.............................................................
TLn_gi|427726210|ref|YP_007073487.1| lf.............................................................
TLn_gi|427724197|ref|YP_007071474.1| rnrd...........................................................
TLn_gi|427725916|ref|YP_007073193.1| atilldpghggnesgaagstgypekavnlvisqkiqaaleakgatvnltrttdidvslgdrqk
TLn_gi|427723370|ref|YP_007070647.1| drlaiqvykfvgaqpgakvyiqanlhgceivgnavvhqlieylsdvdkgaiageiwlvptcnp
TLn_gi|427724429|ref|YP_007071706.1| rifisaghgglegglldpgavagntteaqqmillrdqlvpevrrlnleilavpddlsaadtvr
Cy2_gi|428218721|ref|YP_007103186.1| iadgviltrelvsapanvitpealaetalaiasdysdcmtvevlereqceamgmgaylgvsqa
Cy2_gi|428217331|ref|YP_007101796.1| si.............................................................
Cy2_gi|428218965|ref|YP_007103430.1| hrldlpvarlptqtmmslpitvingaiagprlwlsaaihgdeingveiirqvlnqinvnhlvg
Cy2_gi|428218329|ref|YP_007102794.1| vi.............................................................
Cy2_gi|428218498|ref|YP_007102963.1| lt.............................................................
Cy2_gi|428218676|ref|YP_007103141.1| l..............................................................
Cy2_gi|428218275|ref|YP_007102740.1| gvkilldqghgsnedlgargptgypekdvtlvlgklvrdelvk....................
Cy2_gi|428217320|ref|YP_007101785.1| lelnatelhqqlsgptlihfpgqkepplfvsvllhgnettgwraiqqlltkyanqplpralsl
Cy2_gi|428217360|ref|YP_007101825.1| qifvsaghggfdarfrnpgaraggtteaa..................................
Cy2_gi|428217620|ref|YP_007102085.1| akiflsaghggfegafrdpgvvvnntsea..................................
gi|158336127|ref|YP_001517301.1|   cagviltrelvaapanvvtpsalaetaaqiaedhgltlevlereeceaqgmgaflgvslasel
gi|158335082|ref|YP_001516254.1|   d..............................................................
gi|158334581|ref|YP_001515753.1|   r..............................................................
gi|158339037|ref|YP_001520214.1|   hirqvvivggthgneriglylvkkfnqdssllfrpnlttnclignpqackenqryietdlnrc
gi|158335668|ref|YP_001516840.1|   kvvv...........................................................
gi|158335292|ref|YP_001516464.1|   kv.............................................................
gi|158338092|ref|YP_001519268.1|   k..............................................................
gi|158337208|ref|YP_001518383.1|   ttaplpvtaeppplvngdrlmadlnalnf..................................
gi|158338413|ref|YP_001519590.1|   vkvlldpghgsendlgargptglpekevtivv...............................
gi|158336876|ref|YP_001518051.1|   lsidvarygsksphttllvssglhgvegycgsaiqwalltdvlpqltlpkgvavllihalnpy
gi|16330631|ref|NP_441359.1|       vsgvilaremvaapanevtpltfteiatelaqtyglelevlgqtecealgmgaflgvakasel
gi|16332230|ref|NP_442958.1|       i..............................................................
gi|16331842|ref|NP_442570.1|       e..............................................................
gi|16329830|ref|NP_440558.1|       savrslaivggvhgnertgvevvrrwqqkdfaryfpalkchyflanpraiaanrryinqdlnr
gi|16330558|ref|NP_441286.1|       fdfshyftyqeidqflqqlqtsygslltvqtigqsyagrdiwvaiatnqatgdyrnkpgywid
gi|16330376|ref|NP_441104.1|       rlv............................................................
gi|16329723|ref|NP_440451.1|       ftvvl..........................................................
gi|16330213|ref|NP_440941.1|       gvkilldpghggseagavgptgyaekdinllis..............................
toq_gi|571027785|ref|YP_008899903.1| cdgvilarelvnapanevtpvtlaetaqqlaatyglrakilerdecaalgmgaflgvaqasdl
toq_gi|571026933|ref|YP_008899051.1| pe.............................................................
toq_gi|571028537|ref|YP_008900657.1| ir.............................................................
toq_gi|571027463|ref|YP_008899581.1| fvvvidpghggsdpgaigiggirekdivldislqvsqflqqqgvqvimtrttdidldlaprva
toq_gi|571027813|ref|YP_008899931.1| gikilidpghggpedlgargpdgtpekvvtlt...............................
gi|22299288|ref|NP_682535.1|       cdgvilarelvnapanevtpvtlaetaqqlaatygltakileredcgalgmgaflgvaqasdl
gi|22299990|ref|NP_683237.1|       pe.............................................................
gi|22297557|ref|NP_680804.1|       ir.............................................................
gi|22297795|ref|NP_681042.1|       fvvvvdpghgasdpgaigiggirekdivldislqvsqflqqqgvqvimtrttdidldlaprva
gi|22299317|ref|NP_682564.1|       gikilidpghggpedlgargpdgtpekvvtft...............................
fN9_gi|428220463|ref|YP_007104633.1| csgvilarelvaapanivtpqalateaqviadaytyvslevlekadcealgmgaflgvsqasd
fN9_gi|428222328|ref|YP_007106498.1| eilr...........................................................
fN9_gi|428221241|ref|YP_007105411.1| tkvs...........................................................
fN9_gi|428222603|ref|YP_007106773.1| vivldpghggndvgavgngiyean.......................................
fN9_gi|428221486|ref|YP_007105656.1| alkqnleilageigdrnyl............................................
fN9_gi|428221848|ref|YP_007106018.1| lkilldpghgskedlgarggngypekdvtliv...............................
fN9_gi|428221485|ref|YP_007105655.1| tktdddltidvairwgtsqkalvvssglhgaegflgsavqlsllksainprttlilihalnpy
qVl_gi|427712524|ref|YP_007061148.1| aegvilarelvnapanvitpvtlaekaqaiastygleseileqadcealgmgaylgvaqasdl
qVl_gi|427712396|ref|YP_007061020.1| plr............................................................
qVl_gi|427714252|ref|YP_007062876.1| q..............................................................
qVl_gi|427711704|ref|YP_007060328.1| vvvidpghggidpgaigiggirekdivldiglqvaailqqqgvqviltrksdlppnveldlpp
qVl_gi|427711553|ref|YP_007060177.1| v..............................................................
qVl_gi|427714522|ref|YP_007063146.1| lkilldaghggpedsgaigptgepekkftlil...............................
qVl_gi|427713716|ref|YP_007062340.1| krivldpghgeidggvndpgavnvplgkner................................
gi|113954246|ref|YP_731406.1|      cag............................................................
gi|113955421|ref|YP_729363.1|      l..............................................................
gi|113954748|ref|YP_731585.1|      qthgcevlpvignpdayaegcryldrdlnrsfrpdllqqvgaeqipsskldrevqrafdlvsr
gi|113954650|ref|YP_730754.1|      yrv............................................................
gi|81299999|ref|YP_400207.1|       vagv...........................................................
gi|81299067|ref|YP_399275.1|       tvr............................................................
gi|81300780|ref|YP_400988.1|       rir............................................................
gi|81300390|ref|YP_400598.1|       nfacdrfyrydeltqllqdcaaaypqllkleslgkshegrelwllritdyskgddtekpalwi
gi|81301169|ref|YP_401377.1|       i..............................................................
gi|81300943|ref|YP_401151.1|       a..............................................................
gi|81299525|ref|YP_399733.1|       lriyldpghgsaedlgargpdgtpekdvtlt................................
gi|81301079|ref|YP_401287.1|       eia............................................................
gi|81300779|ref|YP_400987.1|       ydahyefhyrrgvpsvqnde...........................................
gi|123966726|ref|YP_001011807.1|   cegvelarrlvaappnsltplemsrqasiiakehgleikildrkecedlgmgaylavakgsdl
gi|123967035|ref|YP_001012116.1|   k..............................................................
gi|123965487|ref|YP_001010568.1|   gkilivssthgneinpvwsvnqyskqgniidknieykfiignplayekgcryidkdlnrsfnl
gi|123965916|ref|YP_001010997.1|   f..............................................................
JuK_gi|428313309|ref|YP_007124286.1| csgvilarelvaapanivtpislaetaeaiasqyglslevlewedceklgmgaflgvaqasem
JuK_gi|428311057|ref|YP_007122034.1| irla...........................................................
JuK_gi|428309062|ref|YP_007120039.1| r..............................................................
JuK_gi|428312940|ref|YP_007123917.1| qinrvaivggihgneltgvylvkkfeqfpqliqrssfetftllgnpqafklgrryidkdlnrc
JuK_gi|428309925|ref|YP_007120902.1| vv.............................................................
JuK_gi|428310093|ref|YP_007121070.1| tlrkdleklageigqrhyl............................................
JuK_gi|428313512|ref|YP_007124489.1| ivv............................................................
JuK_gi|428309552|ref|YP_007120529.1| lv.............................................................
JuK_gi|428313083|ref|YP_007124060.1| gvkilldpghggaesgalgptrypek.....................................
JuK_gi|428310554|ref|YP_007121531.1| lf.............................................................
JuK_gi|428310231|ref|YP_007121208.1| kygidighncnpdigargirqedhltmevgtrvisklkslghqvinckpsrassvgnslqqrc
JuK_gi|428312499|ref|YP_007123476.1| lyiqvykfigakpgkkaylqsnlhgaeivgnavihqlieflmtlddsqiageiwlvpvcnpls
JuK_gi|428313236|ref|YP_007124213.1| rifisaghggteqggrdygsivgstneat..................................
JuK_gi|428313477|ref|YP_007124454.1| krifisaandlkdpgvvalet..........................................
JuK_gi|428311704|ref|YP_007122681.1| hrvileighgpgvpfdpgaiahdnkttehelnii.............................
gi|113473990|ref|YP_720051.1|      csgvifarelvaapansctpitmaetaqtlakefgltleilekedceklgmgaflgvaqgsdl
gi|113475511|ref|YP_721572.1|      rpei...........................................................
gi|113477163|ref|YP_723224.1|      n..............................................................
gi|113478073|ref|YP_724134.1|      kinklaivggthgneftgiylvkkfeefpelisrrnfdtqtllanpqgfelvkryidtdlnrc
gi|113476499|ref|YP_722560.1|      fdfshyykyqeivnflhqmreknphlielkvigksyggldiflatltnqntgkarekpgywid
gi|113474224|ref|YP_720285.1|      mividpghggpmdfggvgfggmrekdivlpmslevaqileqnniqvvmt..............
gi|113477463|ref|YP_723524.1|      gmkilidaghgsendlgaigptgypeknvtliiskllqnelinrgalvymtrkaeedlypkdr
gi|113476944|ref|YP_723005.1|      lqvykfignqagkkayiqanlhgaeisgnaviyhlieflmnldnnqligeiwlvpvcnpegvn
gi|113474394|ref|YP_720455.1|      ynearnkfcdaakaanakletielysqncpnnslytdiawlgnskphnvilhssglhgvegfa
HFg_gi|428224156|ref|YP_007108253.1| ctgvilarhlvaappnavtaitlaetataiaqehgleleileqadceelgmgaflgvarasdl
HFg_gi|428226397|ref|YP_007110494.1| ir.............................................................
HFg_gi|428224388|ref|YP_007108485.1| q..............................................................
HFg_gi|428223916|ref|YP_007108013.1| rleipiarlpthalvslpvtviqgtgpgprlwlsaaihgdelngveiirrvlnrvdpqtlqgt
HFg_gi|428226743|ref|YP_007110840.1| vavidaghgggdpgavgigglmekeinlsisqevarlleqqgvqvvm................
HFg_gi|428224382|ref|YP_007108479.1| i..............................................................
HFg_gi|428223590|ref|YP_007107687.1| lf.............................................................
HFg_gi|428224655|ref|YP_007108752.1| yfaaa..........................................................
HFg_gi|428226160|ref|YP_007110257.1| gvtvlldpghgsendlgargptgypek....................................
HFg_gi|428226051|ref|YP_007110148.1| aaeptptpipqvvgdrlwqdlealsferfs.................................
HFg_gi|428224780|ref|YP_007108877.1| riiisaghggyedgridpgaivasttearemmll.............................
gi|257061661|ref|YP_003139549.1|   ssgvilarelvnspantitpvtfaetaqeiaqtsgltceileqedceklgmgsflgvakasdl
gi|257062162|ref|YP_003140050.1|   eir............................................................
gi|257059081|ref|YP_003136969.1|   s..............................................................
gi|257058278|ref|YP_003136166.1|   kirnialiggthgnemtgvylikkfqkyphliersslkiltflanpraiearqryietdlnrc
gi|257060857|ref|YP_003138745.1|   fdfshyytytelvdylnqmathypqlvqlktigqsyaerdiwvmiltnqktgnylekpgywid
gi|257061491|ref|YP_003139379.1|   gytvvidpghggkdpgaiglgglqekdvvlsislqlaeilkkrgvrvimtrs...........
gi|257058498|ref|YP_003136386.1|   vlvvidpghggkdpgaiglgglqeknvilpisldvsrllqergvqvmltrnadyfvslqgrtq
gi|257060846|ref|YP_003138734.1|   gikilldpghggqesgakgpngypeksvnlsvsq.............................
gi|257057955|ref|YP_003135843.1|   aq.............................................................
5BT_gi|434391707|ref|YP_007126654.1| csgvnlarelvaappnevtpitlaetaqkiaedhglqveilereeceklgmgaflgvaqasdl
5BT_gi|434395368|ref|YP_007130315.1| rir............................................................
5BT_gi|434393016|ref|YP_007127963.1| r..............................................................
5BT_gi|434392062|ref|YP_007127009.1| valipvvngdrlnrnisqlaeigklpgggvsrv..............................
5BT_gi|434395507|ref|YP_007130454.1| r..............................................................
5BT_gi|434391636|ref|YP_007126583.1| a..............................................................
5BT_gi|434395491|ref|YP_007130438.1| tvvs...........................................................
5BT_gi|434391354|ref|YP_007126301.1| dpyla..........................................................
5BT_gi|434391607|ref|YP_007126554.1| gikilldpghggaelgargpngypekeinlvisklvrdqlvargatvymtreedtelslgdrv
5BT_gi|434395336|ref|YP_007130283.1| e..............................................................
5BT_gi|434391236|ref|YP_007126183.1| drlslqvyrfvgdksgkkayiqanlhgaeiagnavihqlieffqtlqnteligevwlvpvcnp
5BT_gi|434391792|ref|YP_007126739.1| tliqqtktlgayveeigvsgegrsiygvtvgneqasprvvivaglhaaeviapltaisilqtl
5BT_gi|434395419|ref|YP_007130366.1| waltqgdgpivavalhdghdireevapllsvteadrwreedpytahwtkiadtrivvrrsrfe
gi|284929626|ref|YP_003422148.1|   csgvimarelvnapanyinpitftevakklaneydleieileqdecaklgmgaflgvaqasdl
gi|284928900|ref|YP_003421422.1|   e..............................................................
gi|284929040|ref|YP_003421562.1|   isiqiykfigqksdkkvyiqsnlhgseivgnavihqlinflstlnksqvngeiwlvpvcnplg
8V2_gi|428775164|ref|YP_007166951.1| cdgvifakelvaapansltsvtlanaveamatehgleleilekedceklgmgaylgvaqasdi
8V2_gi|428777931|ref|YP_007169718.1| k..............................................................
8V2_gi|428776138|ref|YP_007167925.1| releipvarlithtllslpvtilngiesgpclwisaaihgdeingveiirrvleqlnpqtlrg
8V2_gi|428777938|ref|YP_007169725.1| ll.............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| fn.............................................................
8V2_gi|428777769|ref|YP_007169556.1| gmrilvdpghggeelgakgptg.........................................
8V2_gi|428775818|ref|YP_007167605.1| nlalqvyqfqgklgqktyiqanlhgaeivgniviseifrwlseidpekiwgeiwlvpacnpvg
gi|166368941|ref|YP_001661214.1|   csgvilarelvnapantvtpltmaetaeqiaaeyglslnileqeeceslgmgaflgvakasdi
gi|166365183|ref|YP_001657456.1|   irc............................................................
gi|166366573|ref|YP_001658846.1|   e..............................................................
gi|166362930|ref|YP_001655203.1|   qkttiknlaliagvhgneltpaylvkylqkspnliarssfqshslianplalkqrfryidtdl
gi|166364322|ref|YP_001656595.1|   mfdfshyypyaelvsflknlassypnlisltsigksyenrdiwlttltnqatghylekpaywi
gi|166368299|ref|YP_001660572.1|   flvvi..........................................................
gi|166366765|ref|YP_001659038.1|   d..............................................................
gi|166368835|ref|YP_001661108.1|   gkvilldpghggketgavgptgytekeinlv................................
gi|166366493|ref|YP_001658766.1|   lf.............................................................
gi|166363064|ref|YP_001655337.1|   kfgidmghncpphdigasgvrqedvvikevgtrliaklaaaghsvinctptsavslndslrkr
gi|166366413|ref|YP_001658686.1|   vlidpghspihsgtdakdgtpeyemnllqakivkaeldkasisaeifdpasdprdligqkaad
gi|37522180|ref|NP_925557.1|       aegtifarelvsapanyvtsvtlaeqataiaeangleceilekedcerlgmgaylgvaqgtdl
gi|37519943|ref|NP_923320.1|       ig.............................................................
gi|37522109|ref|NP_925486.1|       aisaeth........................................................
gi|37520936|ref|NP_924313.1|       sli............................................................
gi|37523992|ref|NP_927369.1|       gkdwwshvrf.....................................................
gi|37520534|ref|NP_923911.1|       grrivldaghggkdpgamregvrekdlnlaivrrlnnklraagyytilarsddtfislgervd
gi|37520091|ref|NP_923468.1|       arvmidpghggaqtgsigpsgipektvnlaialrlgeqlrragaevlftrtadvdvplaersr
gi|37522227|ref|NP_925604.1|       aerlg..........................................................
gi|37522043|ref|NP_925420.1|       yrrtsrydediayaqrlaaasplvqlqllgkspegraipvlvvskdkaftpeaaratgkdivl
gi|37523548|ref|NP_926925.1|       aeqevtiltglhgdeldggyichrlsqflqrlpvgwrlegavnllpsanplagslgerfvpea
gi|37523547|ref|NP_926924.1|       fgrgrpvlsvvgglhgdayngvytchlliewlrrqelrqgpyqlrgkvrvlpavnppglllas
gi|37520329|ref|NP_923706.1|       anydqtavywrkldqesdrmrlvtigktaegrpqlmailtspenhkklgryqeiarklalaeg
gi|37520932|ref|NP_924309.1|       tvvldpghggtrkiggsspnnaisasgikektmtleiallirdalqqiaaqngydlrvvltrt
ADw_gi|427733727|ref|YP_007053271.1| vsgvmlarelvaapaneltpvtmaeiaqdiasehgleieilereeceklgmgaflgvalasdl
ADw_gi|427739887|ref|YP_007059431.1| irs............................................................
ADw_gi|427738968|ref|YP_007058512.1| r..............................................................
ADw_gi|427737605|ref|YP_007057149.1| piervalvggthggeitgvflakkfqrfplqiqrngvetvtllankkaiamgrryidtdlnra
ADw_gi|427737907|ref|YP_007057451.1| vkrvaliggthggeltgvflvkkfqqfpqmiqrqgvetialianekaiamgrryidtdlnrtf
ADw_gi|427736327|ref|YP_007055871.1| kslpivaniphsglfvpediatqftaehlnsl...............................
ADw_gi|427735146|ref|YP_007054690.1| viv............................................................
ADw_gi|427735148|ref|YP_007054692.1| sviidpghggkdpgaigrgglrekdvilpisirvaqilqqngvqavltrnsdyfvslkgr...
ADw_gi|427734182|ref|YP_007053726.1| ynny...........................................................
ADw_gi|427738036|ref|YP_007057580.1| ipqvepe........................................................
ADw_gi|427737291|ref|YP_007056835.1| gikilidpghggkelgavgptglpekdvn..................................
ADw_gi|427733824|ref|YP_007053368.1| lf.............................................................
ADw_gi|427734438|ref|YP_007053982.1| at.............................................................
ADw_gi|427737664|ref|YP_007057208.1| rfgidighnsppdtgangikyednltl....................................
ADw_gi|427735400|ref|YP_007054944.1| mkiaidlghnvrcdggavgikrendlimavgenviyrlrksghqvveckptwassvydslnrr
ADw_gi|427736713|ref|YP_007056257.1| fgidighncpprdigavsgkhredvytkqvgelvisklkhrghlavsvtprraysvgnsliqr
ADw_gi|427735785|ref|YP_007055329.1| ffaidighncppydtgartnkysedaltklvgelvigklrlrkhkvisvtpqsaystddslmq
ADw_gi|427733974|ref|YP_007053518.1| lhainysipvrkkvslaelkehlftipeypdwipyrtsyyqemwgfclshnqylelrdeeyev
ADw_gi|427735097|ref|YP_007054641.1| dilslqvykfigatpgkkvyiqsnlhgaeivgnavihqlieflwmldntdligeiwllpvcnp
ADw_gi|427734372|ref|YP_007053916.1| rifisaghggkeaggidpgsvaggtteak..................................
ADw_gi|427738248|ref|YP_007057792.1| vmlevghgknpkvwepgaigfngireydlnllaakaaknaldqagvpcvisdsgrdl......
rbN_gi|427718504|ref|YP_007066498.1| vsgvilarqlvaapanevtpitlaetaqaiakeyglqveileredceklgmgaflgvaqasdl
rbN_gi|427717245|ref|YP_007065239.1| ir.............................................................
rbN_gi|427716398|ref|YP_007064392.1| r..............................................................
rbN_gi|427716007|ref|YP_007064001.1| isrvaivggthgneftgayliqkftqfphlitkssfvtitllanprafqvarryldkdlnrcf
rbN_gi|427716207|ref|YP_007064201.1| vvv............................................................
rbN_gi|427716208|ref|YP_007064202.1| llvvidpghggkdsgapgiggllekdvvl..................................
rbN_gi|427720501|ref|YP_007068495.1| gikilldpghggkesgasgptgylekdan..................................
rbN_gi|427720149|ref|YP_007068143.1| ppqsppvkstlqisad...............................................
rbN_gi|427717825|ref|YP_007065819.1| e..............................................................
rbN_gi|427716163|ref|YP_007064157.1| l..............................................................
rbN_gi|427716185|ref|YP_007064179.1| kfgidsghncppdtgakgfkfednltldvgnrviaklqalghevvvcrp..............
rbN_gi|427715920|ref|YP_007063914.1| rifisaahggieagrsdpgaiaggtteake.................................
gi|75908939|ref|YP_323235.1|       vsgvilarqlvaapansvtpitmaetaqqiaqdyglqieileqedceklgmgaflgvalasdl
gi|75908435|ref|YP_322731.1|       ai.............................................................
gi|75907282|ref|YP_321578.1|       i..............................................................
gi|75910294|ref|YP_324590.1|       ek.............................................................
gi|75908006|ref|YP_322302.1|       kinrvaiiggthgneftgaflvkkfqqfpeviqkpsfetltilgnpkafeagkryiekdlnrc
gi|75907687|ref|YP_321983.1|       lv.............................................................
gi|75907688|ref|YP_321984.1|       llvvidpghggkdsgapglggllekdvvlpiglrvaaileqngvqavltrnsdffvelqgrvd
gi|75908485|ref|YP_322781.1|       gikilldpghggkesgatgptgylekdvn..................................
gi|75908181|ref|YP_322477.1|       t..............................................................
gi|75907143|ref|YP_321439.1|       ar.............................................................
gi|75909389|ref|YP_323685.1|       n..............................................................
gi|75910593|ref|YP_324889.1|       rygidighncspdtgargikfednltldvgnrvisklkalghevisckpdratsvkdslsqrc
gi|75909995|ref|YP_324291.1|       rifisaahggkeaggvdpgsiaggttear..................................
gi|298491029|ref|YP_003721206.1|   vsgvilarqlvaapanavtpitmaetakaiakdhglhleileqeeceklgmgaflgvaqasdl
gi|298492645|ref|YP_003722822.1|   qi.............................................................
gi|298490648|ref|YP_003720825.1|   r..............................................................
gi|298491800|ref|YP_003721977.1|   npinrlaivggihgneligvylvkkfqkyphlinrnsfeslallgnlqailarrryvdidlnr
gi|298490223|ref|YP_003720400.1|   llv............................................................
gi|298490222|ref|YP_003720399.1|   livvidpghggkd..................................................
gi|298492458|ref|YP_003722635.1|   gikivldpghggkesgasgptgylekdvnlivskllrdelvqrgatvmmtreddqdvslverq
gi|298492145|ref|YP_003722322.1|   kfgidmghncppdtgakgiklednltvevstkviaklrslgheaisckpdradsvsqslgrrc
gi|298492188|ref|YP_003722365.1|   rifisaahggreaggidsgaiaggtteakemillrdlivteirvrtvevlavpddlsaaqtit
gi|298491532|ref|YP_003721709.1|   pqpqnkntntllv..................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   parmviikyeasdspytigfvgkgitfdtggislkpaenmhrmksdm................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ppqfihliykpegtprkklaiigkgltfdsggynikpsgpsiammkmdm..............
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| aireqkptlalsvhynalp............................................
TLn_gi|427723370|ref|YP_007070647.1| lgtnqrghfyatggfhsysgedwnrifweyeptvdelsqfvdkhlgsdeaeiiqayrgqilaa
TLn_gi|427724429|ref|YP_007071706.1| winsrarsgdialelqtda............................................
Cy2_gi|428218721|ref|YP_007103186.1| selppkfihltysgkssgdeaakrklaivgkgvtfdsgglnikagansgiammktdm......
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| tliavpiinvfgflehsrylpdrrdlnrcfpgsprgslaariahlfineivkkcthgidlhta
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| fignvaaakhqkrhlehqpdynriwqpghtpeqemaqqvladmrsrgvfasidihnntgrnph
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ppkfihltykpsgtprrklaivgkgvtfdsgglnlkvggsgietmkm................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   fikadldnhllgrheekqakvlheqlgpkgnsenflldlhsttanmgltlilvndhpfnlhla
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   gfawnrrcnednidlnrnfllpeqsftgspeaytqldaflnprqpptpqelytlkllgyalry
gi|16330631|ref|NP_441359.1|       ppqfihltyrpanpvkklaiigksltfdsgglnikgagsgietmk..................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       cfrpqdrknpylmgyeqlrarqlahqislagidfivdlhtttaamgttlilncphplllnlaa
gi|16330558|ref|NP_441286.1|       anthagevtgsavalyclhqlmtkygedaqithlldhytvyvlprlamdgaekylttpyllrs
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ppkfihltytplgnvqkkialigkgltfdsgglnlktqggietmkmdm...............
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ia.............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ppkfihltytspgtvhrkialvgkgltfdsgglnlktqggietmkmdm...............
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       iaeraranafvs...................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| lppkfihltyrpqtvtkklgiigkgvtfdsgglnikagpgssiemmkmdm.............
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| gfkylrrtnednidlnrnfllegdlyagspplyaklnqffnpasppprfepyllkaiaiiary
qVl_gi|427712524|ref|YP_007061148.1| ppkfihltyrpqgtatrklaiigkgltfdsgglnlkvsgsgietmkmdm..............
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ygiggidacgvvidlhsttssmgnslvvygrrpadlalaalvqgrl.................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       dgnihatelaassaclhflqvllrgfeqgnpvvqrclqrctiylcprqnpdgaelaladqpqf
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   epkfihltlkskspikekialvgkgltfdsggynlkvgasqiemmkydm..............
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   iknnhdtsiyeirranflvekfgvngsepcdiaidlhtttanmgtsivmygr...........
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ppkfihltykpegtakrklaivgkgltfdsgglnikgagsgietmkmdm..............
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| fysqdlhdptlssyeehraktiyqqlkppgkspvdliidlhsttanmgltlilgnthpfnlql
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| nianf..........................................................
JuK_gi|428312499|ref|YP_007123476.1| tnqrthvfstgrfnvhdgkdwnrifwdyekecedleafaksqvdfepdvirknylekiqlgfk
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ppkfihvtykpevtprrklaivgkgltfdsgglnlkvsgsgiemmkidm..............
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      fkvedlenntslnyeesrakfinqm......................................
gi|113476499|ref|YP_722560.1|      gnihavevtgsavalyiiyhllnnynsnpqvtylldnhtiyilpriavdgaekylttpyivrs
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      veminqqvpdlalsvhynalpdygdalkt..................................
gi|113476944|ref|YP_723005.1|      vrshqfssgrynsydgkdwnrifwdyekenvdieafakaqinlseteiknnyrqeilrsfnqq
gi|113474394|ref|YP_720455.1|      gsaiqtcllknlpvlrdedalilvhclnpygminl............................
HFg_gi|428224156|ref|YP_007108253.1| ppkfihltykpagtprrklaiigkgltfdsgglnlkgpgsgietmkm................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| liavpivnvfgfldqsrylpdrrdlnrsfpgsvrgslasrlarlfmervvkqcthgidlhtas
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ppkfihltykpsgtpkkklaivgksltfdcgglnlkvagasiemmkm................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   fsrealdepetffyeqilaknidqkirdhqtdliidlhsttsqmgltiiicdghpfhfqlvay
gi|257060857|ref|YP_003138745.1|   anthagevtgsavacyiiyqlltqypndpaiarlldkytvyvlprlavdgaekyltsphwlrs
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   manqarani......................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ppkfihltykpegtpkrrlaiigkgltfdsgglnikagagssiemmkmdmg............
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| amidklepaialslhynalp...........................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| lgvnqrshhfasgrycvyegkdwnrifwdyekrqkdlkefaqtqinldkntirinylnkiinc
5BT_gi|434391792|ref|YP_007126739.1| vchklptvqfcivpvadpdfvsrnaselpttv...............................
5BT_gi|434395419|ref|YP_007130366.1| fdlnrsrdkavyikpedawglkvwkkrppraiverswaehdafyamlekvlsdierrhrrf..
gi|284929626|ref|YP_003422148.1|   ppkfihltykskdiakrkiaiigksltfdsgglnlkgsssgievmkm................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   tnqrnhffssgrfnsydgkdwnrifwdyekvlsdledfvknnlnfdyltiqknflkqqkivfs
8V2_gi|428775164|ref|YP_007166951.1| ppkfihltykpdgtprrklaivgkgvtfdsgglnlkpsgsgietmkmdmggagatfgaakaia
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| tliavpivnvfgfleqsrylpdrrdlnrcfpgspegslasrlanlfmqeivsrcthg......
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| mnqrshffnsgrynsydgqdwnrifwdystetdeiydfakqhleseietiyqgyiaqiktwfq
gi|166368941|ref|YP_001661214.1|   ppkflhliykpqgtpkrklaivgksltfdsgglnikgagsgietmk.................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   nrcfnqkdlvnpdcqqyeqkrakkivkeireksidllidihsttsnmmlaiiysnphpwllkl
gi|166364322|ref|YP_001656595.1|   danthagevtgsavalytishllrqyghnsqitrlldhytvyilprlavdgaekylttpyllr
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ankansnnvdifvsihf..............................................
gi|166366413|ref|YP_001658686.1|   hsmfls.........................................................
gi|37522180|ref|NP_925557.1|       ppkfihltykpahsaprkriaiigkgitfdsgglsikpakgmelmkvdm..............
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       itkatqgdifvsvhvntmpsrsdiqgietyyth..............................
gi|37520091|ref|NP_923468.1|       mleakqptvflslhhnalpdag.........................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       vnaaihpgeipgkdagfafvrdlvisgkhaalldgailvfipvfgvdgherfgpytrinqngp
gi|37523548|ref|NP_926925.1|       gsdlnrifpgdpdgsewerlaaaifaiagrstacfdihssnsfleelpqvrvvheprliewan
gi|37523547|ref|NP_926924.1|       rhwpfdntdldrvfpgyaqgettqrl.....................................
gi|37520329|ref|NP_923706.1|       lndsqakalaaegkaviwidgglhatevvgthqlietvyqmasatdeetkrilddvillavha
gi|37520932|ref|NP_924309.1|       advnvgiaer.....................................................
ADw_gi|427733727|ref|YP_007053271.1| ppkfihitykpqgtpkrklaivgkgltfdsgglnikgagsgietmkm................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| fnpqdlenpllmnyeqstaksiaqriq....................................
ADw_gi|427737907|ref|YP_007057451.1| krqdlenpqlnnheqllakkla.........................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| vqtansfradvfasihfnafngqa.......................................
ADw_gi|427736713|ref|YP_007056257.1| arranwlrvdyfvsihfnaagnrsaggteifvynyhss.........................
ADw_gi|427735785|ref|YP_007055329.1| rarkanqldadyfisih..............................................
ADw_gi|427733974|ref|YP_007053518.1| yidsslepgcltygeyfiqgktadevlisch................................
ADw_gi|427735097|ref|YP_007054641.1| mgtnqrshhfssgrycvyeakdwnrifwdyekdisqsnqsgenqlltfaksqinldieeirin
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ppkfihltykpdgtptrklaiigkgltfdsgglnikgagsgietmkid...............
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| lqqdlqnrylgsyeemraksiykilgskgss................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ppkfihltykpestpkrklaivgkgltfdsgglnikgagsgietmkid...............
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       flteslqnpnlssyedirakqiagvlgeen.................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       i..............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       nkanankvevfvs..................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ppkfihliykpattpkrklaiigkgltfdsgglnikgagsgietmkidm..............
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   cfigdnlpatkssiyeelrakeiqailqpenqefvdviidlhtttanmglciiignihpll..
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   eiiskeepaialsihynslpdd.........................................
gi|298492145|ref|YP_003722322.1|   nianrnkvdifvsihfnafngqangtev...................................
gi|298492188|ref|YP_003722365.1|   winsrgrtgdvaveihtdaagspt.......................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| fekelakqnhpcgvsvpeyfr..........................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| achrinmpqiranlndpat............................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ygcisqcdrrslh..................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   aylthhnpqvrv...................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   gvsslkqalpvgqyefpqglffggqa.....................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ylsaqdeeirvlqyspqkdlpyirglce...................................
gi|16330558|ref|NP_441286.1|       svrpypypeerdglypedvngdglilqmrlldpcgawkisdqdprvmigrspeefggeyytll
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| gikamketlpvgqydy...............................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       lrsstrpyplrdrdssglqeadidgdgrillmripdphgawkvhpqeprllvrrdpvetggqy
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| a..............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| kqlekiqapsglpfseryryqlqslclda..................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      sirhypypeekdglhwedingdglilqmrlkdncgawkissedprimvprepdefggtyysil
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      lekinspsstpfykqyryqlqslcldad...................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| hhrvnlpqiran...................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ltslnpnikvlryry................................................
gi|257060857|ref|YP_003138745.1|   sirpypypdeqdglhredingdglilemrikddcgawkvseldprimvhrepeefggtyytll
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| fatlaekihspssvpftelfryrlqslsidad...............................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ehvkkiqssssaplfeqyryklqslamdanylidihsssnkcidylfsfpgtqqenaayfkln
8V2_gi|428775164|ref|YP_007166951.1| qlkpdve........................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| eqtarryqscyvpypvkyqqtlqflcwdanhvidihsssnqgldylftfpgqeeat.......
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ftyl...........................................................
gi|166364322|ref|YP_001656595.1|   ssirpyphtdekpglypedingdglilqmrqkdtcgawkiseqdprimvrrepeefegtfytl
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       eesgwrttaqn....................................................
gi|37523548|ref|NP_926925.1|       clgldvvwshs....................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       npdgqqlvsdwymrkaepkerafndiprlyqkyighdnnrdsfmnnmpetkn...........
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| fldaikqqfvklsdkvnsdsgvaytekfryklqslsldadylidih.................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       peglvrnydgyefdlaptqegldfnrnyphqwapegqqqgagdfpfsepetraeaef......
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       yrvlpegliqdydgdliplqprqqgldlnrnypidwrpeheqlgagpfpasepevqavvkfls
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      pegmiknydgynikvapskggidfnrnyphewqpegkqkgagdfpfsepetlavaefwrehpn
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   seglirnydgygfkiappvegmdfnrnyphlwapegkqkgsgdfplsepetraevefwqenrn
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ygvlmdtfng.....................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   lteglirdydgynfttaptlegldfnrnypvywvpegeqqgagdfpfsepetraeaefwannt
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                   10        20          30         
                                                                    |         |           |         
d1cg2a1                              ......................------LFQAATDEQPAVIKTLEKLVN..IETGT.......
gi|269926470|ref|YP_003323093.1|   ......................---------------------------..-----.......
gi|269926320|ref|YP_003322943.1|   ......................--------------------LLRDLLT..TPGVS.......
gi|269925335|ref|YP_003321958.1|   ......................----DEVFSRIDASSHKYLEDLKEFLR..IPSIS.......
gi|269925376|ref|YP_003321999.1|   ......................------LREVAASHRDRIADFCSRLIQ..TPSLP.......
gi|269925438|ref|YP_003322061.1|   ......................------------------LDILREMLE..LYSPT.......
gi|269926083|ref|YP_003322706.1|   ......................-----KLYAFYQDGLQEYLRDLQMLVN..QDSGT.......
gi|269838949|ref|YP_003323641.1|   ......................-----------PFDRRRAWGYLLRQVA..FGPRV.......
gi|269926500|ref|YP_003323123.1|   ......................---------------ENVLSIILRLVK..HPSFT.......
TLn_gi|427723016|ref|YP_007070293.1| ......................---------------------------..-----.......
TLn_gi|427722057|ref|YP_007069334.1| ......................------IRPAIQALQTELVEWRRTFHK..KPELA.......
TLn_gi|427722694|ref|YP_007069971.1| ......................------IKALAEKLSPRLIEIRRHLHA..HPELS.......
TLn_gi|427723545|ref|YP_007070822.1| ......................---------------------------..-----.......
TLn_gi|427726210|ref|YP_007073487.1| ......................-------------------EQIETLVM..HHSPS.......
TLn_gi|427724197|ref|YP_007071474.1| ......................---------------------------..---PY.......
TLn_gi|427725916|ref|YP_007073193.1| ......................---------------------------..-----.......
TLn_gi|427723370|ref|YP_007070647.1| ......................---------------------------..-----.......
TLn_gi|427724429|ref|YP_007071706.1| ......................-------------------------F-..-----.......
Cy2_gi|428218721|ref|YP_007103186.1| ......................---------------------------..-----.......
Cy2_gi|428217331|ref|YP_007101796.1| ......................-------RTAIEQLQSQLVQWRRGFHM..WPELG.......
Cy2_gi|428218965|ref|YP_007103430.1| ......................---------------------------..-----.......
Cy2_gi|428218329|ref|YP_007102794.1| ......................---------------------------..-----.......
Cy2_gi|428218498|ref|YP_007102963.1| ......................-------------------THLQQIVR..QRDPY.......
Cy2_gi|428218676|ref|YP_007103141.1| ......................------------------YDLISELVM..CHSPS.......
Cy2_gi|428218275|ref|YP_007102740.1| ......................---------------------------..-----.......
Cy2_gi|428217320|ref|YP_007101785.1| ......................---------------------------..-----.......
Cy2_gi|428217360|ref|YP_007101825.1| ......................---------------------------..-----.......
Cy2_gi|428217620|ref|YP_007102085.1| ......................---------------------------..-----.......
gi|158336127|ref|YP_001517301.1|   ......................---------------------------..-----.......
gi|158335082|ref|YP_001516254.1|   ......................-----------------LVSWRRHLHQ..YPELG.......
gi|158334581|ref|YP_001515753.1|   ......................------IKQLAETLSPRLIEIRRHLHS..YPELS.......
gi|158339037|ref|YP_001520214.1|   ......................---------------------------..-----.......
gi|158335668|ref|YP_001516840.1|   ......................---------------------------..-----.......
gi|158335292|ref|YP_001516464.1|   ......................---------------------------..-----.......
gi|158338092|ref|YP_001519268.1|   ......................----------------RLLQHLSHLAR..ERDPY.......
gi|158337208|ref|YP_001518383.1|   ......................---------------------------..---ER.......
gi|158338413|ref|YP_001519590.1|   ......................---------------------------..-----.......
gi|158336876|ref|YP_001518051.1|   ......................---------------------------..-----.......
gi|16330631|ref|NP_441359.1|       ......................---------------------------..-----.......
gi|16332230|ref|NP_442958.1|       ......................-----------QALHGQLIQWRRQFHQ..YPELG.......
gi|16331842|ref|NP_442570.1|       ......................------LKNLAQTLLPRLVEIRRHLHA..HPELS.......
gi|16329830|ref|NP_440558.1|       ......................---------------------------..-----.......
gi|16330558|ref|NP_441286.1|       ......................---------------------------..-----.......
gi|16330376|ref|NP_441104.1|       ......................---------------------------..-----.......
gi|16329723|ref|NP_440451.1|       ......................---------------------------..-----.......
gi|16330213|ref|NP_440941.1|       ......................---------------------------..-----.......
toq_gi|571027785|ref|YP_008899903.1| ......................---------------------------..-----.......
toq_gi|571026933|ref|YP_008899051.1| ......................----------VAALQPELVQWRRYLHQ..RPELG.......
toq_gi|571028537|ref|YP_008900657.1| ......................--------QITQTLTPRLIEIRRHLHR..YPELS.......
toq_gi|571027463|ref|YP_008899581.1| ......................---------------------------..-----.......
toq_gi|571027813|ref|YP_008899931.1| ......................---------------------------..-----.......
gi|22299288|ref|NP_682535.1|       ......................---------------------------..-----.......
gi|22299990|ref|NP_683237.1|       ......................----------VAALQPELVQWRRYLHQ..RPELG.......
gi|22297557|ref|NP_680804.1|       ......................--------QITHTLTPRLIEIRRHLHR..YPELS.......
gi|22297795|ref|NP_681042.1|       ......................---------------------------..-----.......
gi|22299317|ref|NP_682564.1|       ......................---------------------------..-----.......
fN9_gi|428220463|ref|YP_007104633.1| ......................---------------------------..-----.......
fN9_gi|428222328|ref|YP_007106498.1| ......................-------------LQSDLVHWRRSLHR..FPELG.......
fN9_gi|428221241|ref|YP_007105411.1| ......................------------INSDRLLNTIAKLGT..IGQLAnggvqri
fN9_gi|428222603|ref|YP_007106773.1| ......................---------------------------..-----.......
fN9_gi|428221486|ref|YP_007105656.1| ......................---------------------------..-----.......
fN9_gi|428221848|ref|YP_007106018.1| ......................---------------------------..-----.......
fN9_gi|428221485|ref|YP_007105655.1| ......................---------------------------..-----.......
qVl_gi|427712524|ref|YP_007061148.1| ......................---------------------------..-----.......
qVl_gi|427712396|ref|YP_007061020.1| ......................--------PTIKALQPELVVWRRYLHQ..RPELA.......
qVl_gi|427714252|ref|YP_007062876.1| ......................------IKHLAETLQPRLLEIRRHLHS..HPELS.......
qVl_gi|427711704|ref|YP_007060328.1| ......................---------------------------..-----.......
qVl_gi|427711553|ref|YP_007060177.1| ......................---------------------------..-----.......
qVl_gi|427714522|ref|YP_007063146.1| ......................---------------------------..-----.......
qVl_gi|427713716|ref|YP_007062340.1| ......................---------------------------..-----.......
gi|113954246|ref|YP_731406.1|      ......................------------------VELARELVA..APPNS.......
gi|113955421|ref|YP_729363.1|      ......................-------KQRLEAILPDLIELRRHLHA..HPELS.......
gi|113954748|ref|YP_731585.1|      ......................---------------------------..-----.......
gi|113954650|ref|YP_730754.1|      ......................---------------------------..-----.......
gi|81299999|ref|YP_400207.1|       ......................-------------------ELARQLVA..APANV.......
gi|81299067|ref|YP_399275.1|       ......................--------PAVRDRHAQIVAWRQQLHR..RPELG.......
gi|81300780|ref|YP_400988.1|       ......................--------EVATRLEPRLLEIRRHLHA..HPELS.......
gi|81300390|ref|YP_400598.1|       .............drtnlfaai---------------------------..-----.......
gi|81301169|ref|YP_401377.1|       ......................---------------------------..-----.......
gi|81300943|ref|YP_401151.1|       ......................---------------------------..-----.......
gi|81299525|ref|YP_399733.1|       ......................---------------------------..-----.......
gi|81301079|ref|YP_401287.1|       ......................-----------------------ALQA..CHSPS.......
gi|81300779|ref|YP_400987.1|       ......................---------------------------..-----.......
gi|123966726|ref|YP_001011807.1|   ......................---------------------------..-----.......
gi|123967035|ref|YP_001012116.1|   ......................------LLKKIDSFNDELISIRRHIHA..HPELS.......
gi|123965487|ref|YP_001010568.1|   ......................---------------------------..-----.......
gi|123965916|ref|YP_001010997.1|   ......................---------------------------..-----.......
JuK_gi|428313309|ref|YP_007124286.1| ......................---------------------------..-----.......
JuK_gi|428311057|ref|YP_007122034.1| ......................----------IRSLQPQLVEWRRHLHQ..RPELG.......
JuK_gi|428309062|ref|YP_007120039.1| ......................------IKDLAEKLAPRLIEIRRHLHS..HPELS.......
JuK_gi|428312940|ref|YP_007123917.1| ......................---------------------------..-----.......
JuK_gi|428309925|ref|YP_007120902.1| ......................---------------------------..-----.......
JuK_gi|428310093|ref|YP_007121070.1| ......................---------------------------..-----.......
JuK_gi|428313512|ref|YP_007124489.1| ......................---------------------------..-----.......
JuK_gi|428309552|ref|YP_007120529.1| ......................---------------------------..-----.......
JuK_gi|428313083|ref|YP_007124060.1| ......................---------------------------..-----.......
JuK_gi|428310554|ref|YP_007121531.1| ......................-------------------QTIEELVL..HHSPS.......
JuK_gi|428310231|ref|YP_007121208.1| ......................---------------------------..-----.......
JuK_gi|428312499|ref|YP_007123476.1| ......................---------------------------..-----.......
JuK_gi|428313236|ref|YP_007124213.1| ......................---------------------------..-----.......
JuK_gi|428313477|ref|YP_007124454.1| ......................---------------------------..-----.......
JuK_gi|428311704|ref|YP_007122681.1| ......................---------------------------..-----.......
gi|113473990|ref|YP_720051.1|      ......................---------------------------..-----.......
gi|113475511|ref|YP_721572.1|      ......................-----------RKMQPLLVEWRRHLHQ..RPELG.......
gi|113477163|ref|YP_723224.1|      ......................-----KIKELATTLAPRLIEIRRHIHS..HPELS.......
gi|113478073|ref|YP_724134.1|      ......................---------------------------..-----.......
gi|113476499|ref|YP_722560.1|      .......ingfinyhtfsgvil---------------------------..-----.......
gi|113474224|ref|YP_720285.1|      ......................---------------------------..-----.......
gi|113477463|ref|YP_723524.1|      ......................---------------------------..-----.......
gi|113476944|ref|YP_723005.1|      ......................---------------------------..-----.......
gi|113474394|ref|YP_720455.1|      ......................---------------------------..-----.......
HFg_gi|428224156|ref|YP_007108253.1| ......................---------------------------..-----.......
HFg_gi|428226397|ref|YP_007110494.1| ......................--------PEIQALQDSLVQWRRHLHQ..RPELG.......
HFg_gi|428224388|ref|YP_007108485.1| ......................------IKHLAQKLAPRLVEIRRHLHS..HPELS.......
HFg_gi|428223916|ref|YP_007108013.1| ......................---------------------------..-----.......
HFg_gi|428226743|ref|YP_007110840.1| ......................---------------------------..-----.......
HFg_gi|428224382|ref|YP_007108479.1| ......................---------------------------..-----.......
HFg_gi|428223590|ref|YP_007107687.1| ......................-------------------AIIEELVL..CHSPS.......
HFg_gi|428224655|ref|YP_007108752.1| ......................---------------------------..-----.......
HFg_gi|428226160|ref|YP_007110257.1| ......................---------------------------..-----.......
HFg_gi|428226051|ref|YP_007110148.1| ......................---------------------------..----V.......
HFg_gi|428224780|ref|YP_007108877.1| ......................---------------------------..-----.......
gi|257061661|ref|YP_003139549.1|   ......................---------------------------..-----.......
gi|257062162|ref|YP_003140050.1|   ......................------------TLQSKLVQWRRHFHQ..YPELG.......
gi|257059081|ref|YP_003136969.1|   ......................-----QIKDIAEKLSPRLIEIRRHIHA..HPELS.......
gi|257058278|ref|YP_003136166.1|   ......................---------------------------..-----.......
gi|257060857|ref|YP_003138745.1|   ....ingfisyhtygavilrpy---------------------------..-----.......
gi|257061491|ref|YP_003139379.1|   ......................---------------------------..-----.......
gi|257058498|ref|YP_003136386.1|   ......................---------------------------..-----.......
gi|257060846|ref|YP_003138734.1|   ......................---------------------------..-----.......
gi|257057955|ref|YP_003135843.1|   ......................-----RLRDYLHSRQGEMIELLGQLVQ..AESPS.......
5BT_gi|434391707|ref|YP_007126654.1| ......................---------------------------..-----.......
5BT_gi|434395368|ref|YP_007130315.1| ......................--------SDIQALQPQLVAWRRKLHQ..RPELG.......
5BT_gi|434393016|ref|YP_007127963.1| ......................------IKELATELAPRLIEIRRHIHI..HPELS.......
5BT_gi|434392062|ref|YP_007127009.1| ......................---------------------------..-----.......
5BT_gi|434395507|ref|YP_007130454.1| ......................------LLATIDKDRDRLINLFKDIHQ..NPELA.......
5BT_gi|434391636|ref|YP_007126583.1| ......................---------------------------..-----.......
5BT_gi|434395491|ref|YP_007130438.1| ......................---------------SRAIADVQALVK..LGPRV.......
5BT_gi|434391354|ref|YP_007126301.1| ......................---------------------------..-----.......
5BT_gi|434391607|ref|YP_007126554.1| ......................---------------------------..-----.......
5BT_gi|434395336|ref|YP_007130283.1| ......................-----------------IFNRIEELVM..HHSPS.......
5BT_gi|434391236|ref|YP_007126183.1| ......................---------------------------..-----.......
5BT_gi|434391792|ref|YP_007126739.1| ......................---------------------------..-----.......
5BT_gi|434395419|ref|YP_007130366.1| ......................---------------------------..-----.......
gi|284929626|ref|YP_003422148.1|   ......................---------------------------..-----.......
gi|284928900|ref|YP_003421422.1|   ......................------IKNLVEDFLPRFVEIRRNLHS..YPELS.......
gi|284929040|ref|YP_003421562.1|   ......................---------------------------..---N-.......
8V2_gi|428775164|ref|YP_007166951.1| ......................---------------------------..-----.......
8V2_gi|428777931|ref|YP_007169718.1| ......................------IRPEIQSLQSDLVQWRRGFHQ..RPELG.......
8V2_gi|428776138|ref|YP_007167925.1| ......................-------------------------I-..-----.......
8V2_gi|428777938|ref|YP_007169725.1| ......................---------------------------..-----.......
8V2_gi|428777493|ref|YP_007169280.1| ......................-------------------EHLQQIVR..DRHPY.......
8V2_gi|428778337|ref|YP_007170124.1| ......................--------------------TITELVL..CHSPS.......
8V2_gi|428777769|ref|YP_007169556.1| ......................---------------------------..----Y.......
8V2_gi|428775818|ref|YP_007167605.1| ......................---------------------------..-----.......
gi|166368941|ref|YP_001661214.1|   ......................---------------------------..-----.......
gi|166365183|ref|YP_001657456.1|   ......................-------------LQPQLVHWRRQIHQ..KPELG.......
gi|166366573|ref|YP_001658846.1|   ......................------IKNIAESLAPRLVEIRRHIHA..NPELS.......
gi|166362930|ref|YP_001655203.1|   ......................---------------------------..-----.......
gi|166364322|ref|YP_001656595.1|   ningfvtyhtysavmlrpysth---------------------------..-----.......
gi|166368299|ref|YP_001660572.1|   ......................---------------------------..-----.......
gi|166366765|ref|YP_001659038.1|   ......................----------------RLSQHLEQIVR..ERNPF.......
gi|166368835|ref|YP_001661108.1|   ......................---------------------------..-----.......
gi|166366493|ref|YP_001658766.1|   ......................-------------------DTIATLVL..HHSPS.......
gi|166363064|ref|YP_001655337.1|   ......................---------------------------..-----.......
gi|166366413|ref|YP_001658686.1|   ......................---------------------------..-----.......
gi|37522180|ref|NP_925557.1|       ......................---------------------------..-----.......
gi|37519943|ref|NP_923320.1|       ......................------------ALQPQLVQWRRHLHR..FPELG.......
gi|37522109|ref|NP_925486.1|       ......................------------RVLPRLVALRQHLHA..HPELS.......
gi|37520936|ref|NP_924313.1|       ......................-------------DKNNLQNWTRRLAA..RPHHV.......
gi|37523992|ref|NP_927369.1|       ......................------------------------LADdrLEGRN.......
gi|37520534|ref|NP_923911.1|       ......................---------------------------..-----.......
gi|37520091|ref|NP_923468.1|       ......................---------------------------..-----.......
gi|37522227|ref|NP_925604.1|       ......................-------------------ADVQALLA..GGPRV.......
gi|37522043|ref|NP_925420.1|       ......................---------------------------..-----.......
gi|37523548|ref|NP_926925.1|       ......................---------------------------..-----.......
gi|37523547|ref|NP_926924.1|       ......................---------------------------..-----.......
gi|37520329|ref|NP_923706.1|       ......................---------------------------..-----.......
gi|37520932|ref|NP_924309.1|       ......................---------------------------..-----.......
ADw_gi|427733727|ref|YP_007053271.1| ......................---------------------------..-----.......
ADw_gi|427739887|ref|YP_007059431.1| ......................-------------LHPRIIEWRRIIHQ..KPELA.......
ADw_gi|427738968|ref|YP_007058512.1| ......................------IKDLAAELAPRLIEIRRHIHS..HPELS.......
ADw_gi|427737605|ref|YP_007057149.1| ......................---------------------------..-----.......
ADw_gi|427737907|ref|YP_007057451.1| ......................---------------------------..-----.......
ADw_gi|427736327|ref|YP_007055871.1| ......................---------------------------..-----.......
ADw_gi|427735146|ref|YP_007054690.1| ......................---------------------------..-----.......
ADw_gi|427735148|ref|YP_007054692.1| ......................---------------------------..-----.......
ADw_gi|427734182|ref|YP_007053726.1| ......................---------------------------..-----.......
ADw_gi|427738036|ref|YP_007057580.1| ......................-------------------RLFADLEN..LSSQR.......
ADw_gi|427737291|ref|YP_007056835.1| ......................---------------------------..-----.......
ADw_gi|427733824|ref|YP_007053368.1| ......................-------------------QTIESLVM..HHSPS.......
ADw_gi|427734438|ref|YP_007053982.1| ......................---------------------------..-----.......
ADw_gi|427737664|ref|YP_007057208.1| ......................---------------------------..-----.......
ADw_gi|427735400|ref|YP_007054944.1| ......................---------------------------..-----.......
ADw_gi|427736713|ref|YP_007056257.1| ......................---------------------------..-----.......
ADw_gi|427735785|ref|YP_007055329.1| ......................----------------------F----..-----.......
ADw_gi|427733974|ref|YP_007053518.1| ......................---------------------------..-----.......
ADw_gi|427735097|ref|YP_007054641.1| ......................---------------------------..-----.......
ADw_gi|427734372|ref|YP_007053916.1| ......................---------------------------..-----.......
ADw_gi|427738248|ref|YP_007057792.1| ......................---------------------------..-----.......
rbN_gi|427718504|ref|YP_007066498.1| ......................---------------------------..-----.......
rbN_gi|427717245|ref|YP_007065239.1| ......................------------SLQPQLVEWRRRLHQ..QPELG.......
rbN_gi|427716398|ref|YP_007064392.1| ......................------IKDLATKLAPRLIEIRRHIHS..HPELS.......
rbN_gi|427716007|ref|YP_007064001.1| ......................---------------------------..-----.......
rbN_gi|427716207|ref|YP_007064201.1| ......................---------------------------..-----.......
rbN_gi|427716208|ref|YP_007064202.1| ......................---------------------------..-----.......
rbN_gi|427720501|ref|YP_007068495.1| ......................---------------------------..-----.......
rbN_gi|427720149|ref|YP_007068143.1| ......................----------------KLFTHIQKLN-..--FQR.......
rbN_gi|427717825|ref|YP_007065819.1| ......................----------------RLQTHLNEIAR..ERDPY.......
rbN_gi|427716163|ref|YP_007064157.1| ......................------------------FQIIEELVM..HHSPS.......
rbN_gi|427716185|ref|YP_007064179.1| ......................---------------------------..-----.......
rbN_gi|427715920|ref|YP_007063914.1| ......................---------------------------..-----.......
gi|75908939|ref|YP_323235.1|       ......................---------------------------..-----.......
gi|75908435|ref|YP_322731.1|       ......................-----------RSLQPQLVEWRRRLHQ..KPELA.......
gi|75907282|ref|YP_321578.1|       ......................-------KDLATKLAPRLIEIRRHIHS..HPELS.......
gi|75910294|ref|YP_324590.1|       ......................-------------VFPRMVELRRYLHS..HPELA.......
gi|75908006|ref|YP_322302.1|       ......................---------------------------..-----.......
gi|75907687|ref|YP_321983.1|       ......................---------------------------..-----.......
gi|75907688|ref|YP_321984.1|       ......................---------------------------..-----.......
gi|75908485|ref|YP_322781.1|       ......................---------------------------..-----.......
gi|75908181|ref|YP_322477.1|       ......................---------------------------..-----.......
gi|75907143|ref|YP_321439.1|       ......................-----------------LHNHLIQVAR..ERDPY.......
gi|75909389|ref|YP_323685.1|       ......................--------------YNQLFENIAELVM..HHSPS.......
gi|75910593|ref|YP_324889.1|       ......................---------------------------..-----.......
gi|75909995|ref|YP_324291.1|       ......................---------------------------..-----.......
gi|298491029|ref|YP_003721206.1|   ......................---------------------------..-----.......
gi|298492645|ref|YP_003722822.1|   ......................-----------RSLQPQLIEWRRGIHQ..KPELG.......
gi|298490648|ref|YP_003720825.1|   ......................------IKDLATNLAPRLLEIRRHIHS..HPELS.......
gi|298491800|ref|YP_003721977.1|   ......................---------------------------..-----.......
gi|298490223|ref|YP_003720400.1|   ......................---------------------------..-----.......
gi|298490222|ref|YP_003720399.1|   ......................---------------------------..-----.......
gi|298492458|ref|YP_003722635.1|   ......................---------------------------..-----.......
gi|298492145|ref|YP_003722322.1|   ......................---------------------------..----F.......
gi|298492188|ref|YP_003722365.1|   ......................---------------------------..-----.......
gi|298491532|ref|YP_003721709.1|   ......................-------------SADRLLAHIRKL-N..FQRYT.......


                                              40        50               60                         
                                               |         |                |                         
d1cg2a1                              GDAE...GIAAAGNFLEAELKNL..GF.....TVTRSKSA.......................
gi|269926470|ref|YP_003323093.1|   ----...----------------..--.....--------.......................
gi|269926320|ref|YP_003322943.1|   GREE...---RIRKYVIDQLSPL..VD.....EVSV----.......................
gi|269925335|ref|YP_003321958.1|   ALSDykaEVARCAQWLKEHMITI..GLq....KAEVIPT-.......................
gi|269925376|ref|YP_003321999.1|   GQEM...---QAAELIMSEMKAL..RYd....DVWQ----.......................
gi|269925438|ref|YP_003322061.1|   GSED...---QVSSFLVDLFRSE..GL.....EAYK----.......................
gi|269926083|ref|YP_003322706.1|   EYKE...GVDRVADMCIDKLASF..GC.....SIERIPSE.......................
gi|269838949|ref|YP_003323641.1|   PGTA...PHSRCRDFLLRELRATlgSA.....SPQAFSFQ.......................
gi|269926500|ref|YP_003323123.1|   RTEG...-ERSIPALIDELLDEI..GL.....GLLQHGIQ.......................
TLn_gi|427723016|ref|YP_007070293.1| ----...----------------..--.....--------.......................
TLn_gi|427722057|ref|YP_007069334.1| FREN...---LTAEFIAQKLTEL..GI.....DHQT----.......................
TLn_gi|427722694|ref|YP_007069971.1| GEEY...---QTAAYIAGVLSSS..GI.....HVTE----.......................
TLn_gi|427723545|ref|YP_007070822.1| ----...----------------..--.....--------.......................
TLn_gi|427726210|ref|YP_007073487.1| GMEG...---EIDTYLLDLFAEL..EL.....EYWQ----.......................
TLn_gi|427724197|ref|YP_007071474.1| FSAA...GHFYVKEYVRQTMEEH..GEp....ESFRFEAQ.......................
TLn_gi|427725916|ref|YP_007073193.1| ----...----------------..--.....--------.......................
TLn_gi|427723370|ref|YP_007070647.1| ----...----------------..--.....--------.......................
TLn_gi|427724429|ref|YP_007071706.1| ----...----------------..--.....--------.......................
Cy2_gi|428218721|ref|YP_007103186.1| ----...----------------..--.....--------.......................
Cy2_gi|428217331|ref|YP_007101796.1| FKEQ...---RTSTTIAQKLSAW..GI.....PHQT----.......................
Cy2_gi|428218965|ref|YP_007103430.1| ----...----------------..--.....--------.......................
Cy2_gi|428218329|ref|YP_007102794.1| ----...----------------..--.....--------.......................
Cy2_gi|428218498|ref|YP_007102963.1| LGSG...GHLYVRQYIHTQLAQW..GEv....QIHSFMVR.......................
Cy2_gi|428218676|ref|YP_007103141.1| GAEA...---EIDRYLLAQFANL..EL.....EHWQ----.......................
Cy2_gi|428218275|ref|YP_007102740.1| ----...----------------..--.....--------.......................
Cy2_gi|428217320|ref|YP_007101785.1| ----...----------------..--.....--------.......................
Cy2_gi|428217360|ref|YP_007101825.1| ----...EMIVTKDLIAKELRSR..GF.....RVAL----.......................
Cy2_gi|428217620|ref|YP_007102085.1| ---A...EMIATRDLVVAELRSR..GL.....SVEA----.......................
gi|158336127|ref|YP_001517301.1|   ----...----------------..--.....--------.......................
gi|158335082|ref|YP_001516254.1|   FKEH...---LTAEFVAQRLTEW..GI.....EHQT----.......................
gi|158334581|ref|YP_001515753.1|   GQEY...---QTSAYVAGILSSY..GL.....HVRE----.......................
gi|158339037|ref|YP_001520214.1|   ----...----------------..--.....--------.......................
gi|158335668|ref|YP_001516840.1|   ----...----------------..--.....--------.......................
gi|158335292|ref|YP_001516464.1|   ----...----------------..--.....--------.......................
gi|158338092|ref|YP_001519268.1|   LATA...GHFFVKEYIYQELSQW..GTv....R--RHSFR.......................
gi|158337208|ref|YP_001518383.1|   YTTA...ELKKTRAFMAQTLSAS..GW.....TVTEQPF-.......................
gi|158338413|ref|YP_001519590.1|   ----...-----SKLLQEELKKR..GT.....TVVMTREG.......................
gi|158336876|ref|YP_001518051.1|   ----...-P--------------..--.....--------.......................
gi|16330631|ref|NP_441359.1|       ----...----------------..--.....--------.......................
gi|16332230|ref|NP_442958.1|       FQEQ...---LTAAHIAETLTKL..EI.....PHTP----.......................
gi|16331842|ref|NP_442570.1|       GQEY...---QTAAYVAGVLSSC..GL.....HVEE----.......................
gi|16329830|ref|NP_440558.1|       ----...---------------L..--.....--------.......................
gi|16330558|ref|NP_441286.1|       ----...----------------..--.....--------.......................
gi|16330376|ref|NP_441104.1|       ----...----------------..--.....--------.......................
gi|16329723|ref|NP_440451.1|       ----...----------------..--.....--------.......................
gi|16330213|ref|NP_440941.1|       ----...------QRLANRLKSQ..GA.....NVHLTRTR.......................
toq_gi|571027785|ref|YP_008899903.1| ----...----------------..--.....--------.......................
toq_gi|571026933|ref|YP_008899051.1| FQEH...---LTAAFVSEKLRQW..GI.....QHRT----.......................
toq_gi|571028537|ref|YP_008900657.1| GQEH...---QTAAYVAGVLSSV..GL.....TVQQ----.......................
toq_gi|571027463|ref|YP_008899581.1| ----...----------------..--.....--------.......................
toq_gi|571027813|ref|YP_008899931.1| ----...----LAKKLAPELERL..GA.....TVILTRTE.......................
gi|22299288|ref|NP_682535.1|       ----...----------------..--.....--------.......................
gi|22299990|ref|NP_683237.1|       FQEH...---LTAAFVSEKLRQW..GI.....QHRT----.......................
gi|22297557|ref|NP_680804.1|       GQEH...---QTAAYVAGVLSSA..GL.....SVQQ----.......................
gi|22297795|ref|NP_681042.1|       ----...----------------..--.....--------.......................
gi|22299317|ref|NP_682564.1|       ----...----LAKKLAPELERL..GA.....TVILTRTE.......................
fN9_gi|428220463|ref|YP_007104633.1| ----...----------------..--.....--------.......................
fN9_gi|428222328|ref|YP_007106498.1| FKET...---RTANLIIDKLAAW..GI.....PYES----.......................
fN9_gi|428221241|ref|YP_007105411.1| AFSP...ADVKARDLVQQWMAET..GM.....QVRV----.......................
fN9_gi|428222603|ref|YP_007106773.1| ----...----------------..--.....--------.......................
fN9_gi|428221486|ref|YP_007105656.1| -NYA...NLKAAEDFLSNSWKSY..GF.....EVKKQIYE.......................
fN9_gi|428221848|ref|YP_007106018.1| ----...-----GKLLEQELLKK..GA.....KVTLTRRG.......................
fN9_gi|428221485|ref|YP_007105655.1| ----...----------------..--.....--------.......................
qVl_gi|427712524|ref|YP_007061148.1| ----...----------------..--.....--------.......................
qVl_gi|427712396|ref|YP_007061020.1| FKEQ...---LTASFVAEKLREW..GI.....PHQT----.......................
qVl_gi|427714252|ref|YP_007062876.1| GQET...---QTSAYVAGVLSSA..GV.....QLLP----.......................
qVl_gi|427711704|ref|YP_007060328.1| ----...----------------..--.....--------.......................
qVl_gi|427711553|ref|YP_007060177.1| ----...----------------..--.....--------.......................
qVl_gi|427714522|ref|YP_007063146.1| ----...-----AKLLETELQKR..GAm....VIQTRTTD.......................
qVl_gi|427713716|ref|YP_007062340.1| ---D...QVRKQADIIKAQLEAN..GA.....TVKIVENN.......................
gi|113954246|ref|YP_731406.1|      VTPS...---ALAESAAQMAHEH..GL.....DLKVLERS.......................
gi|113955421|ref|YP_729363.1|      GEEH...---QTAALISGELRQC..GW.....RVRE----.......................
gi|113954748|ref|YP_731585.1|      ----...----------------..--.....--------.......................
gi|113954650|ref|YP_730754.1|      ----...----------------..--.....--------.......................
gi|81299999|ref|YP_400207.1|       VTPV...---TMADTAQELAAEL..GL.....ELEILEAD.......................
gi|81299067|ref|YP_399275.1|       FQEQ...---ETAAFIAARLTEL..GV.....SFQA----.......................
gi|81300780|ref|YP_400988.1|       GHEH...---QTAAYVAGVLSSC..GL.....QVRE----.......................
gi|81300390|ref|YP_400598.1|       ----...----------------..--.....--------.......................
gi|81301169|ref|YP_401377.1|       ----...----------------..--.....--------.......................
gi|81300943|ref|YP_401151.1|       ----...----------------..--.....--------.......................
gi|81299525|ref|YP_399733.1|       ----...----VSNLLRDRLQQL..GA.....AVLM----.......................
gi|81301079|ref|YP_401287.1|       GWEG...---EIDTYLQQRFQAV..GC.....SPEQ----.......................
gi|81300779|ref|YP_400987.1|       ----...----------------..--.....--------.......................
gi|123966726|ref|YP_001011807.1|   ----...----------------..--.....--------.......................
gi|123967035|ref|YP_001012116.1|   GLEN...---QTAILISGYLKNI..GW.....RVTE----.......................
gi|123965487|ref|YP_001010568.1|   ----...----------------..--.....--------.......................
gi|123965916|ref|YP_001010997.1|   ----...----------------..--.....--------.......................
JuK_gi|428313309|ref|YP_007124286.1| ----...----------------..--.....--------.......................
JuK_gi|428311057|ref|YP_007122034.1| FKEQ...---LTAAFISQKLQEW..GF.....EQTLNSSV.......................
JuK_gi|428309062|ref|YP_007120039.1| GQEQ...---QTAAYVAGVLSSC..GI.....VVQE----.......................
JuK_gi|428312940|ref|YP_007123917.1| ----...----------------..--.....--------.......................
JuK_gi|428309925|ref|YP_007120902.1| ----...----------------..--.....--------.......................
JuK_gi|428310093|ref|YP_007121070.1| -NYK...SLTAAADFLKSSLATT..GY.....PVQQQGYT.......................
JuK_gi|428313512|ref|YP_007124489.1| ----...----------------..--.....--------.......................
JuK_gi|428309552|ref|YP_007120529.1| ----...----------------..--.....--------.......................
JuK_gi|428313083|ref|YP_007124060.1| ---A...VNLAVSKLLQQELVAR..GA.....TVYMTREE.......................
JuK_gi|428310554|ref|YP_007121531.1| GVEG...---EIDQLLMSRFQAL..GV.....QAWQ----.......................
JuK_gi|428310231|ref|YP_007121208.1| ----...----------------..--.....--------.......................
JuK_gi|428312499|ref|YP_007123476.1| ----...----------------..--.....--------.......................
JuK_gi|428313236|ref|YP_007124213.1| ----...EMILLRDLVVPELRSR..GF.....EVLSVPDD.......................
JuK_gi|428313477|ref|YP_007124454.1| ----...----------------..--.....--------.......................
JuK_gi|428311704|ref|YP_007122681.1| ----...----AANAARNVLVAA..GV.....NCTVIDTP.......................
gi|113473990|ref|YP_720051.1|      ----...----------------..--.....--------.......................
gi|113475511|ref|YP_721572.1|      FKEH...---LTAKFIAQKLQEW..GI.....EHQT----.......................
gi|113477163|ref|YP_723224.1|      GQEH...---QTAAYVAGVLSSC..GL.....HVRE----.......................
gi|113478073|ref|YP_724134.1|      ----...----------------..--.....--------.......................
gi|113476499|ref|YP_722560.1|      ----...----------------..--.....--------.......................
gi|113474224|ref|YP_720285.1|      ----...----------------..--.....--------.......................
gi|113477463|ref|YP_723524.1|      ----...----------------..--.....--------.......................
gi|113476944|ref|YP_723005.1|      ----...----------------..--.....--------.......................
gi|113474394|ref|YP_720455.1|      ----...----------------..--.....--------.......................
HFg_gi|428224156|ref|YP_007108253.1| ----...----------------..--.....--------.......................
HFg_gi|428226397|ref|YP_007110494.1| FREV...---QTAAFVVSKLQEW..GI.....AHQS----.......................
HFg_gi|428224388|ref|YP_007108485.1| GQEY...---QTAAYVAGVLSSS..GL.....QVQE----.......................
HFg_gi|428223916|ref|YP_007108013.1| ----...----------------..--.....--------.......................
HFg_gi|428226743|ref|YP_007110840.1| ----...----------------..--.....--------.......................
HFg_gi|428224382|ref|YP_007108479.1| ----...----------------..--.....--------.......................
HFg_gi|428223590|ref|YP_007107687.1| GVET...---EVDRWLENRFGQL..GL.....EAWQ----.......................
HFg_gi|428224655|ref|YP_007108752.1| ----...GHLYVETYVRQQLEQW..GTv....SAHRFRAN.......................
HFg_gi|428226160|ref|YP_007110257.1| ---D...VALRVSQQVRDRLEAR..GA.....KVVMTREG.......................
HFg_gi|428226051|ref|YP_007110148.1| ADRD...---RAQAYITQQLQAA..GW.....TVTPQPFD.......................
HFg_gi|428224780|ref|YP_007108877.1| ----...-----RDAVVTELRSR..NF.....EVLSVPDD.......................
gi|257061661|ref|YP_003139549.1|   ----...----------------..--.....--------.......................
gi|257062162|ref|YP_003140050.1|   FKEK...---ATAAFIAQTLTEI..GI.....PHQT----.......................
gi|257059081|ref|YP_003136969.1|   GQEY...---QTAAYVAGVLSSC..GI.....HVQE----.......................
gi|257058278|ref|YP_003136166.1|   ----...----------------..--.....--------.......................
gi|257060857|ref|YP_003138745.1|   ----...----------------..--.....--------.......................
gi|257061491|ref|YP_003139379.1|   ----...----------------..--.....-------N.......................
gi|257058498|ref|YP_003136386.1|   ----...----------------..--.....--------.......................
gi|257060846|ref|YP_003138734.1|   ----...-------LLKQELVKR..GA.....TVYMTRET.......................
gi|257057955|ref|YP_003135843.1|   TVPE...SQKNVLSLLKQSLEER..NY.....QVRYVKGN.......................
5BT_gi|434391707|ref|YP_007126654.1| ----...----------------..--.....--------.......................
5BT_gi|434395368|ref|YP_007130315.1| FQEH...---LTAEFVAEKLQQW..GI.....EYQTGIAK.......................
5BT_gi|434393016|ref|YP_007127963.1| GQEY...---QTAAFVAGVLSSC..GI.....HVQE----.......................
5BT_gi|434392062|ref|YP_007127009.1| AFTA...EDILARQLVQSWMIEA..GM.....TVQI----.......................
5BT_gi|434395507|ref|YP_007130454.1| FMET...---RTAAIVAKELKAL..GY.....EVKT----.......................
5BT_gi|434391636|ref|YP_007126583.1| ----...----------------..--.....--------.......................
5BT_gi|434395491|ref|YP_007130438.1| TGTP...VMEQARAYLIEQYTRA..GY.....ETRTQTFTypkfedlgssitingqirngral
5BT_gi|434391354|ref|YP_007126301.1| --TA...GHFFVQHYIYQELEKY..GSv....ESFEFTVR.......................
5BT_gi|434391607|ref|YP_007126554.1| ----...----------------..--.....--------.......................
5BT_gi|434395336|ref|YP_007130283.1| GAEA...---EINQLLLQKFAAS..-V.....EVWH----.......................
5BT_gi|434391236|ref|YP_007126183.1| ----...----------------..--.....--------.......................
5BT_gi|434391792|ref|YP_007126739.1| ----...----------------..--.....--------.......................
5BT_gi|434395419|ref|YP_007130366.1| ----...----------------..--.....-----V--.......................
gi|284929626|ref|YP_003422148.1|   ----...----------------..--.....--------.......................
gi|284928900|ref|YP_003421422.1|   GKEH...---QTAAYVANILSSY..DI.....PVEK----.......................
gi|284929040|ref|YP_003421562.1|   ----...----------------..--.....--------.......................
8V2_gi|428775164|ref|YP_007166951.1| ----...----------------..--.....--------.......................
8V2_gi|428777931|ref|YP_007169718.1| FQEK...---LTSEFVISKLQEW..GI.....PHET----.......................
8V2_gi|428776138|ref|YP_007167925.1| ----...----------------..--.....--------.......................
8V2_gi|428777938|ref|YP_007169725.1| ----...----------------..--.....--------.......................
8V2_gi|428777493|ref|YP_007169280.1| FSSG...GHFYVQQYIREQFQKW..GAl....ETHDFEFQ.......................
8V2_gi|428778337|ref|YP_007170124.1| GAEQ...---EIDRALLEKFNAI..GV.....ENWQ----.......................
8V2_gi|428777769|ref|YP_007169556.1| PEKA...VNLKVSQLLQAELEQR..GA.....TVYMTRET.......................
8V2_gi|428775818|ref|YP_007167605.1| ----...----------------..--.....--------.......................
gi|166368941|ref|YP_001661214.1|   ----...----------------..--.....--------.......................
gi|166365183|ref|YP_001657456.1|   FQEH...---LTASLISQTLTKY..GI.....EHQT----.......................
gi|166366573|ref|YP_001658846.1|   GQEY...---QTAAYIAGVLSSC..GL.....SVQE----.......................
gi|166362930|ref|YP_001655203.1|   ----...-------------T--..--.....--------.......................
gi|166364322|ref|YP_001656595.1|   ----...----------------..--.....--------.......................
gi|166368299|ref|YP_001660572.1|   ----...----------------..--.....--------.......................
gi|166366765|ref|YP_001659038.1|   FSSQ...GHFYVREYLRQELGNW..GKv....ESHFFSFQ.......................
gi|166368835|ref|YP_001661108.1|   ----...----MSKLIKRELEKL..GA.....TVYLTRET.......................
gi|166366493|ref|YP_001658766.1|   GMET...---EIDRFLLERFQEL..GL.....ETWQ----.......................
gi|166363064|ref|YP_001655337.1|   ----...----------------..--.....--------.......................
gi|166366413|ref|YP_001658686.1|   ----...----------------..--.....--------.......................
gi|37522180|ref|NP_925557.1|       ----...----------------..--.....--------.......................
gi|37519943|ref|NP_923320.1|       FQEQ...---ATSRFIAQKLASW..GI.....DVQT----.......................
gi|37522109|ref|NP_925486.1|       GEEY...---RTADCVAELLAEL..GL.....EVKS----.......................
gi|37520936|ref|NP_924313.1|       GSPV...-QKEHAEFLVAQYRSW..GY.....QAEIERFDvlfpvpvtrslelvapmkfkakl
gi|37523992|ref|NP_927369.1|       TGSE...SYLQAARYVAEQFKRA..GAlpagsEGYLQPVKfqsrvldegrssltlmrggtfea
gi|37520534|ref|NP_923911.1|       --S-...----------------..--.....--------.......................
gi|37520091|ref|NP_923468.1|       ----...----------------..--.....--------.......................
gi|37522227|ref|NP_925604.1|       AGSA...AAERASAYLGEQYRAA..GY.....EVEIQPFSfekfndlgssllvederlkgral
gi|37522043|ref|NP_925420.1|       ----...----------------..--.....--------.......................
gi|37523548|ref|NP_926925.1|       ----...----------------..--.....--------.......................
gi|37523547|ref|NP_926924.1|       ----...-----ASWVFEQVRHS..DC.....CVEL----.......................
gi|37520329|ref|NP_923706.1|       ----...----------------..--.....--------.......................
gi|37520932|ref|NP_924309.1|       ----...----------------..--.....--------.......................
ADw_gi|427733727|ref|YP_007053271.1| ----...----------------..--.....--------.......................
ADw_gi|427739887|ref|YP_007059431.1| FKEE...---LTSKFISQKLQEW..GI.....EHQT----.......................
ADw_gi|427738968|ref|YP_007058512.1| GEEF...---QTAAFVAGVLSSN..GI.....HVEE----.......................
ADw_gi|427737605|ref|YP_007057149.1| ----...----------------..--.....--------.......................
ADw_gi|427737907|ref|YP_007057451.1| ----...----------------..--.....--------.......................
ADw_gi|427736327|ref|YP_007055871.1| PNSD...---WHLDKLYDFLPNL..GI.....TVLQATHN.......................
ADw_gi|427735146|ref|YP_007054690.1| ----...----------------..--.....--------.......................
ADw_gi|427735148|ref|YP_007054692.1| ----...----------------..--.....--------.......................
ADw_gi|427734182|ref|YP_007053726.1| ---E...NINTAADFLKSSFQEA..GY.....QVNKQEYK.......................
ADw_gi|427738036|ref|YP_007057580.1| FTTS...ERRRTRNYIINELKKI..GW.....QSSLEQF-.......................
ADw_gi|427737291|ref|YP_007056835.1| ----...--LTVSKLLRQELEKK..GA.....TVVMTREV.......................
ADw_gi|427733824|ref|YP_007053368.1| GAET...---EINQYLMQRFQNL..GV.....EVWQ----.......................
ADw_gi|427734438|ref|YP_007053982.1| ---A...GHFFVQEYIRADFSQW..GSv....EIHTFEVG.......................
ADw_gi|427737664|ref|YP_007057208.1| ----...---DVGNRVIGKLKDL..GY.....QVIN----.......................
ADw_gi|427735400|ref|YP_007054944.1| ----...----------------..--.....--------.......................
ADw_gi|427736713|ref|YP_007056257.1| ----...-A--------------..--.....--------.......................
ADw_gi|427735785|ref|YP_007055329.1| ----...----------------..--.....--------.......................
ADw_gi|427733974|ref|YP_007053518.1| ----...----------------..--.....--------.......................
ADw_gi|427735097|ref|YP_007054641.1| ----...----------------..--.....--------.......................
ADw_gi|427734372|ref|YP_007053916.1| ----...EMIFLRDLILTELRAR..GF.....EVLSVPDS.......................
ADw_gi|427738248|ref|YP_007057792.1| ----...----------------..--.....--------.......................
rbN_gi|427718504|ref|YP_007066498.1| ----...----------------..--.....--------.......................
rbN_gi|427717245|ref|YP_007065239.1| FQEK...---LTAELISQKLQEW..GI.....EHQT----.......................
rbN_gi|427716398|ref|YP_007064392.1| GQEY...---QTAAFVAGVLSSS..GL.....HVLE----.......................
rbN_gi|427716007|ref|YP_007064001.1| ----...----------------..--.....--------.......................
rbN_gi|427716207|ref|YP_007064201.1| ----...----------------..--.....--------.......................
rbN_gi|427716208|ref|YP_007064202.1| ----...----------------..--.....--------.......................
rbN_gi|427720501|ref|YP_007068495.1| ----...--LVVSKLLRDELLKR..GA.....TVVMTRND.......................
rbN_gi|427720149|ref|YP_007068143.1| YTFE...GRSLTRTYIINELQKL..GW.....KPKLEDF-.......................
rbN_gi|427717825|ref|YP_007065819.1| MATA...GHFFVQEYIRQQFAQW..GSv....EIHTFLVN.......................
rbN_gi|427716163|ref|YP_007064157.1| GVET...---EINQFLLQRFASL..GV.....EVWQ----.......................
rbN_gi|427716185|ref|YP_007064179.1| ----...----------------..--.....-------T.......................
rbN_gi|427715920|ref|YP_007063914.1| ----...-MILLRDLIVTELRAR..SL.....EVLSVPDD.......................
gi|75908939|ref|YP_323235.1|       ----...----------------..--.....--------.......................
gi|75908435|ref|YP_322731.1|       FQEK...---ITAAFVSSKLQAW..GI.....EHQT----.......................
gi|75907282|ref|YP_321578.1|       GQEY...---QTAAFVAGVLSSS..GL.....RVQE----.......................
gi|75910294|ref|YP_324590.1|       FEEK...---KTASIVIDELKRL..GI.....PFWY----.......................
gi|75908006|ref|YP_322302.1|       ----...----------------..--.....--------.......................
gi|75907687|ref|YP_321983.1|       ----...----------------..--.....--------.......................
gi|75907688|ref|YP_321984.1|       ----...----------------..--.....--------.......................
gi|75908485|ref|YP_322781.1|       ----...--LAVSKLLRDELLKL..GA.....NVVMTRDD.......................
gi|75908181|ref|YP_322477.1|       ----...-----RTYIINELRKS..GW.....TPKLEKF-.......................
gi|75907143|ref|YP_321439.1|       LATA...GHFFVQEYIRQEFAQW..GSv....EIHTFQVG.......................
gi|75909389|ref|YP_323685.1|       GAEA...---EINQLLLQKFAAL..GV.....EVWS----.......................
gi|75910593|ref|YP_324889.1|       ----...----------------..--.....--------.......................
gi|75909995|ref|YP_324291.1|       ----...EMILLRDLIVTELRSR..SF.....EVLSVPDD.......................
gi|298491029|ref|YP_003721206.1|   ----...----------------..--.....--------.......................
gi|298492645|ref|YP_003722822.1|   FQEK...---LTAEFISQKLQAW..GV.....EHQT----.......................
gi|298490648|ref|YP_003720825.1|   GQEY...---QTAAFVAGVLSSS..GL.....HVVE----.......................
gi|298491800|ref|YP_003721977.1|   ----...----------------..--.....--------.......................
gi|298490223|ref|YP_003720400.1|   ----...----------------..--.....--------.......................
gi|298490222|ref|YP_003720399.1|   ----...----------------..--.....--------.......................
gi|298492458|ref|YP_003722635.1|   ----...----------------..--.....--------.......................
gi|298492145|ref|YP_003722322.1|   AQTD...AGRKIAQPVLNEIRKL..GF.....FSRG----.......................
gi|298492188|ref|YP_003722365.1|   ----...----------------..--.....--------.......................
gi|298491532|ref|YP_003721709.1|   PKER...--SHRARYITNELQKS..GW.....KPQIEKL-.......................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ngsipgkpsarlvavpnvgqrsdfatvdvkgaiavvrrgeipflqkaqnaanagavgvvivnn
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       aepplkedagtaqagqlpvynaysadgdvtgelvyvnfgvpkdyeelekrgidvkgkvviary
gi|37523992|ref|NP_927369.1|       laigddavigvrngiapnleaplvfagygltvpennyddlagldlqgkiavvlsggpaaipga
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       sgsiagnaataavvvpgvgesadfarvdvkgavaivrrgkipflekarqaaqagavglvvvns
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| epgelygtlggevqipvlalsgkagnsliesqpsqgtltvntrq...................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ggswrgikpkvaaergaigciiysdpkedgyfqgetypkgpwrneygaqrgsvadmpthpgdp
gi|37523992|ref|NP_927369.1|       lrshygsvaerwkflkqagavglitvqnprimdipwerskllrffpsmvlaesalqdapdlvl
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       qdgplmgtlggkaaipvlglsgkqgsallagkfpkpvqlevrtev..................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ltpgsgsvpgtkrlarkdaativkipvlpisyadalpllkamggplappewrgalpvpyrlga
gi|37523992|ref|NP_927369.1|       tvgmnpasmdkllagsgvtfaqilaaadtekplpkfaipavlkaqvsvks.............
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                        70                         8
                                                                         |                          
d1cg2a1                              .............G................LVVGDNIVGKIK.....GR..GG..........
gi|269926470|ref|YP_003323093.1|   .............-................------------.....--..--..........
gi|269926320|ref|YP_003322943.1|   .............-................-DAMGNVIGVK-.....HG..EE..........
gi|269925335|ref|YP_003321958.1|   .............-................-SGHPIVYGEWM.....GS..DSg.........
gi|269925376|ref|YP_003321999.1|   .............-................-DEVGNVIGLIK.....GD..RSg.........
gi|269925438|ref|YP_003322061.1|   .............-................-DEAGNFIGIV-.....GR..GQ..........
gi|269926083|ref|YP_003322706.1|   .............-................-VYGDAIIAKVE.....AS..SK..........
gi|269838949|ref|YP_003323641.1|   .............G................-VQMCNILSQYH.....GG..GE..........
gi|269926500|ref|YP_003323123.1|   .............Kiagd............PWERSFVWALLR.....GS..SN..........
TLn_gi|427723016|ref|YP_007070293.1| .............-................------------.....--..--..........
TLn_gi|427722057|ref|YP_007069334.1| .............-................GIAKTGIVAVIK.....GK..DEg.........
TLn_gi|427722694|ref|YP_007069971.1| .............-................SVGKTGVIGNLF.....SA..TDss........
TLn_gi|427723545|ref|YP_007070822.1| .............-................------------.....--..--..........
TLn_gi|427726210|ref|YP_007073487.1| .............-................-DRAGNIIVKIP.....GT..NLea........
TLn_gi|427724197|ref|YP_007071474.1| .............G................-KTHGNIILDLC.....AD..DAvqtk......
TLn_gi|427725916|ref|YP_007073193.1| .............-................------------.....--..--..........
TLn_gi|427723370|ref|YP_007070647.1| .............-................------------.....--..--..........
TLn_gi|427724429|ref|YP_007071706.1| .............-................------------.....--..--..........
Cy2_gi|428218721|ref|YP_007103186.1| .............-................------------.....--..--..........
Cy2_gi|428217331|ref|YP_007101796.1| .............-................NIAQTGIVATIA.....SS..KStag.......
Cy2_gi|428218965|ref|YP_007103430.1| .............-................------------.....--..--..........
Cy2_gi|428218329|ref|YP_007102794.1| .............-................------------.....--..--..........
Cy2_gi|428218498|ref|YP_007102963.1| .............Gqtyq............N--LSLDLLPIA.....PN..HRsk........
Cy2_gi|428218676|ref|YP_007103141.1| .............-................-DAAGNIVAKIP.....GP..KNnpasn.....
Cy2_gi|428218275|ref|YP_007102740.1| .............-................------------.....--..--..........
Cy2_gi|428217320|ref|YP_007101785.1| .............-................------------.....--..--..........
Cy2_gi|428217360|ref|YP_007101825.1| .............-................------------.....--..--..........
Cy2_gi|428217620|ref|YP_007102085.1| .............-................------------.....--..--..........
gi|158336127|ref|YP_001517301.1|   .............-................------------.....--..--..........
gi|158335082|ref|YP_001516254.1|   .............-................AIAETGIMATII.....GE..QPg.........
gi|158334581|ref|YP_001515753.1|   .............-................GVGKTGVIGELK.....GE..GDda........
gi|158339037|ref|YP_001520214.1|   .............-................------------.....--..--..........
gi|158335668|ref|YP_001516840.1|   .............-................------------.....--..--..........
gi|158335292|ref|YP_001516464.1|   .............-................------------.....--..--..........
gi|158338092|ref|YP_001519268.1|   .............Tlkkva...........KSIHENLILSLP.....GR..QSl.........
gi|158337208|ref|YP_001518383.1|   .............-................-ETGVNLVAERP.....GI..APna........
gi|158338413|ref|YP_001519590.1|   .............D................DDLYPKDRVDVI.....NQ..TE..........
gi|158336876|ref|YP_001518051.1|   .............-................------------.....--..--..........
gi|16330631|ref|NP_441359.1|       .............-................------------.....--..--..........
gi|16332230|ref|NP_442958.1|       .............-................GIAKTGIMATVD.....SG..KPg.........
gi|16331842|ref|NP_442570.1|       .............-................AIGKTGVVGQLS.....GK..GDdp........
gi|16329830|ref|NP_440558.1|       .............-................------------.....--..--..........
gi|16330558|ref|NP_441286.1|       .............-................------------.....--..--..........
gi|16330376|ref|NP_441104.1|       .............-................------------.....--..--..........
gi|16329723|ref|NP_440451.1|       .............-................------------.....--..--..........
gi|16330213|ref|NP_440941.1|       .............-................------------.....--..--..........
toq_gi|571027785|ref|YP_008899903.1| .............-................------------.....--..--..........
toq_gi|571026933|ref|YP_008899051.1| .............-................GIAETGIVAVLP.....GS..RPg.........
toq_gi|571028537|ref|YP_008900657.1| .............-................DVGKVGVIAELE.....GN..PQeq........
toq_gi|571027463|ref|YP_008899581.1| .............-................------------.....--..--..........
toq_gi|571027813|ref|YP_008899931.1| .............D................------------.....--..--..........
gi|22299288|ref|NP_682535.1|       .............-................------------.....--..--..........
gi|22299990|ref|NP_683237.1|       .............-................GIAETGIVAVIP.....GS..RPg.........
gi|22297557|ref|NP_680804.1|       .............-................DVGKVGVIAELE.....GN..SKeq........
gi|22297795|ref|NP_681042.1|       .............-................------------.....--..--..........
gi|22299317|ref|NP_682564.1|       .............D................------------.....--..--..........
fN9_gi|428220463|ref|YP_007104633.1| .............-................------------.....--..--..........
fN9_gi|428222328|ref|YP_007106498.1| .............-................EIAHTGVVAMIK.....GE..LGas........
fN9_gi|428221241|ref|YP_007105411.1| .............-................-DTAGNIIGRYS.....SK..NSngknpdl...
fN9_gi|428222603|ref|YP_007106773.1| .............-................------------.....--..--..........
fN9_gi|428221486|ref|YP_007105656.1| .............Vn...............GQAFTNLEIEIL.....GS..DRae........
fN9_gi|428221848|ref|YP_007106018.1| .............D................DDIYPQTRAEMI.....EK..QE..........
fN9_gi|428221485|ref|YP_007105655.1| .............-................------------.....--..--..........
qVl_gi|427712524|ref|YP_007061148.1| .............-................------------.....--..--..........
qVl_gi|427712396|ref|YP_007061020.1| .............-................GIAETGIVAILE.....GS..RPg.........
qVl_gi|427714252|ref|YP_007062876.1| .............-................GPAGVGVMGEIP.....GN..GQde........
qVl_gi|427711704|ref|YP_007060328.1| .............-................------------.....--..--..........
qVl_gi|427711553|ref|YP_007060177.1| .............-................------------.....--..--..........
qVl_gi|427714522|ref|YP_007063146.1| .............K................DLDLPERILAI-.....EN..SE..........
qVl_gi|427713716|ref|YP_007062340.1| .............T................------------.....--..--..........
gi|113954246|ref|YP_731406.1|      .............DceargmgsflsvcqgsDMDPKFIHLTYR.....PS..GPat........
gi|113955421|ref|YP_729363.1|      .............-................GVGRTGVMAELG.....PQ..SG..........
gi|113954748|ref|YP_731585.1|      .............-................------------.....--..--..........
gi|113954650|ref|YP_730754.1|      .............-................------------.....--..--..........
gi|81299999|ref|YP_400207.1|       .............Ece..............KRGMGAFLGVAK.....AS..--..........
gi|81299067|ref|YP_399275.1|       .............-................GVAGTGIVAEIA.....GQ..RSg.........
gi|81300780|ref|YP_400988.1|       .............-................GVGRTGVVGDLP.....GT..GRdr........
gi|81300390|ref|YP_400598.1|       .............-................------------.....--..--..........
gi|81301169|ref|YP_401377.1|       .............-................------------.....--..--..........
gi|81300943|ref|YP_401151.1|       .............-................------------.....--..--..........
gi|81299525|ref|YP_399733.1|       .............-................------------.....--..--..........
gi|81301079|ref|YP_401287.1|       .............-................-DEAGNLIVRIE.....GD..RP..........
gi|81300779|ref|YP_400987.1|       .............-................------------.....--..--..........
gi|123966726|ref|YP_001011807.1|   .............-................------------.....--..--..........
gi|123967035|ref|YP_001012116.1|   .............-................SVGRTGVVADFG.....PK..DK..........
gi|123965487|ref|YP_001010568.1|   .............-................------------.....--..--..........
gi|123965916|ref|YP_001010997.1|   .............-................------------.....--..--..........
JuK_gi|428313309|ref|YP_007124286.1| .............-................------------.....--..--..........
JuK_gi|428311057|ref|YP_007122034.1| .............Plryqt...........GIAKTGIVATIS.....SN..RPg.........
JuK_gi|428309062|ref|YP_007120039.1| .............-................AIGKTGVIGELV.....GG..TDd.........
JuK_gi|428312940|ref|YP_007123917.1| .............-................------------.....--..--..........
JuK_gi|428309925|ref|YP_007120902.1| .............-................------------.....--..--..........
JuK_gi|428310093|ref|YP_007121070.1| .............Vd...............NQTYYNLEVEIP.....GT..DRad........
JuK_gi|428313512|ref|YP_007124489.1| .............-................------------.....--..--..........
JuK_gi|428309552|ref|YP_007120529.1| .............-................------------.....--..--..........
JuK_gi|428313083|ref|YP_007124060.1| .............-................------------.....--..--..........
JuK_gi|428310554|ref|YP_007121531.1| .............-................-DRAGNAIAKIP.....GR..TSe.........
JuK_gi|428310231|ref|YP_007121208.1| .............-................------------.....--..--..........
JuK_gi|428312499|ref|YP_007123476.1| .............-................------------.....--..--..........
JuK_gi|428313236|ref|YP_007124213.1| .............-................-LSASQTIQWIN.....AR..SRp.........
JuK_gi|428313477|ref|YP_007124454.1| .............-................------------.....--..--..........
JuK_gi|428311704|ref|YP_007122681.1| .............-................------------.....--..--..........
gi|113473990|ref|YP_720051.1|      .............-................------------.....--..--..........
gi|113475511|ref|YP_721572.1|      .............-................GIANTGIVATIN.....SN..KPg.........
gi|113477163|ref|YP_723224.1|      .............-................AVGKTGIVGELK.....GS..TNnn........
gi|113478073|ref|YP_724134.1|      .............-................------------.....--..--..........
gi|113476499|ref|YP_722560.1|      .............-................------------.....--..--..........
gi|113474224|ref|YP_720285.1|      .............-................------------.....--..--..........
gi|113477463|ref|YP_723524.1|      .............-................------------.....--..--..........
gi|113476944|ref|YP_723005.1|      .............-................------------.....--..--..........
gi|113474394|ref|YP_720455.1|      .............-................------------.....--..--..........
HFg_gi|428224156|ref|YP_007108253.1| .............-................------------.....--..--..........
HFg_gi|428226397|ref|YP_007110494.1| .............-................GIAQTGVVAVIE.....GD..RPg.........
HFg_gi|428224388|ref|YP_007108485.1| .............-................MVGKTGVVAELH.....GQ..GEdp........
HFg_gi|428223916|ref|YP_007108013.1| .............-................------------.....--..--..........
HFg_gi|428226743|ref|YP_007110840.1| .............-................------------.....--..--..........
HFg_gi|428224382|ref|YP_007108479.1| .............-................------------.....--..--..........
HFg_gi|428223590|ref|YP_007107687.1| .............-................-DSAGNFVARIP.....GR..DRg.........
HFg_gi|428224655|ref|YP_007108752.1| .............G................-REHRNWVLDLP.....GR..DSgr........
HFg_gi|428226160|ref|YP_007110257.1| .............D................DDLYPQDRVDII.....NQ..QE..........
HFg_gi|428226051|ref|YP_007110148.1| .............D................-GAGVNLLAERP.....GA..APta........
HFg_gi|428224780|ref|YP_007108877.1| .............-................-LSLTQTIAWMN.....SR..--..........
gi|257061661|ref|YP_003139549.1|   .............-................------------.....--..--..........
gi|257062162|ref|YP_003140050.1|   .............-................GIAKTGIVATIT.....SP..HPg.........
gi|257059081|ref|YP_003136969.1|   .............-................NVGKTGVVGNLT.....GN..GTdq........
gi|257058278|ref|YP_003136166.1|   .............-................------------.....--..--..........
gi|257060857|ref|YP_003138745.1|   .............-................------------.....--..--..........
gi|257061491|ref|YP_003139379.1|   .............-................------------.....--..--..........
gi|257058498|ref|YP_003136386.1|   .............-................-------F----.....--..--..........
gi|257060846|ref|YP_003138734.1|   .............D................------------.....--..--..........
gi|257057955|ref|YP_003135843.1|   .............-................-QTGGHLLAIPR.....DR..PTtq........
5BT_gi|434391707|ref|YP_007126654.1| .............-................------------.....--..--..........
5BT_gi|434395368|ref|YP_007130315.1| .............TgivavirgeergarseEEAYTSVLPTVG.....DKirDSrl........
5BT_gi|434393016|ref|YP_007127963.1| .............-................GVGKTGVVGEVQ.....GG..GRdp........
5BT_gi|434392062|ref|YP_007127009.1| .............-................-DAAGNIIGTYA.....GR..QEna........
5BT_gi|434395507|ref|YP_007130454.1| .............-................GIAKTGVVGILR.....NG..DG..........
5BT_gi|434391636|ref|YP_007126583.1| .............-................------------.....--..--..........
5BT_gi|434395491|ref|YP_007130438.1| .............R................TVTGTNVIAHLP.....GV..TQ..........
5BT_gi|434391354|ref|YP_007126301.1| .............G................-KTHQNLILNLP.....GK..QQg.........
5BT_gi|434391607|ref|YP_007126554.1| .............-................------------.....--..--..........
5BT_gi|434395336|ref|YP_007130283.1| .............-................-DRADNVIAKIP.....GQ..DAs.........
5BT_gi|434391236|ref|YP_007126183.1| .............-................------------.....--..--..........
5BT_gi|434391792|ref|YP_007126739.1| .............-................------------.....--..--..........
5BT_gi|434395419|ref|YP_007130366.1| .............-................------------.....--..--..........
gi|284929626|ref|YP_003422148.1|   .............-................------------.....--..--..........
gi|284928900|ref|YP_003421422.1|   .............-................FIGKTGVVGHLI.....SD..SEek........
gi|284929040|ref|YP_003421562.1|   .............-................------------.....--..--..........
8V2_gi|428775164|ref|YP_007166951.1| .............-................------------.....--..--..........
8V2_gi|428777931|ref|YP_007169718.1| .............-................GVAQTGVVALIE.....GG..TSg.........
8V2_gi|428776138|ref|YP_007167925.1| .............-................------------.....--..--..........
8V2_gi|428777938|ref|YP_007169725.1| .............-................------------.....--..--..........
8V2_gi|428777493|ref|YP_007169280.1| .............G................-ETHHNYVLNLP.....AE..NGsek.......
8V2_gi|428778337|ref|YP_007170124.1| .............-................-DEAGNIIAKIP.....GQ..QSd.........
8V2_gi|428777769|ref|YP_007169556.1| .............-................-DKFVSLADRIA.....MI..NDln........
8V2_gi|428775818|ref|YP_007167605.1| .............-................------------.....--..--..........
gi|166368941|ref|YP_001661214.1|   .............-................------------.....--..--..........
gi|166365183|ref|YP_001657456.1|   .............-................GIAGTGIVATIE.....GS..QPg.........
gi|166366573|ref|YP_001658846.1|   .............-................AVGKTGVKGELA.....GK..GSdr........
gi|166362930|ref|YP_001655203.1|   .............-................------------.....--..--..........
gi|166364322|ref|YP_001656595.1|   .............-................------------.....--..--..........
gi|166368299|ref|YP_001660572.1|   .............-................------------.....--..--..........
gi|166366765|ref|YP_001659038.1|   .............G................-KVYENLILDLP.....NN..SQk.........
gi|166368835|ref|YP_001661108.1|   .............-................-DIDLSLPARVE.....MI..NNlq........
gi|166366493|ref|YP_001658766.1|   .............-................-DQAGNVIGKIR.....GR..DSt.........
gi|166363064|ref|YP_001655337.1|   .............-................------------.....--..--..........
gi|166366413|ref|YP_001658686.1|   .............-................------------.....--..--..........
gi|37522180|ref|NP_925557.1|       .............-................------------.....--..--..........
gi|37519943|ref|NP_923320.1|       .............-................GVAKTGVVATIA.....GR..GDg.........
gi|37522109|ref|NP_925486.1|       .............-................GVGRTGVVGLLT.....GN..GRde........
gi|37520936|ref|NP_924313.1|       gpakvrlklafdwQ................QVPAYNVIARLP.....GAelPD..........
gi|37523992|ref|NP_927369.1|       .............D................TLTSANVAAMLP.....GS..DPklkn......
gi|37520534|ref|NP_923911.1|       .............-................------------.....--..--..........
gi|37520091|ref|NP_923468.1|       .............-................------------.....--..--..........
gi|37522227|ref|NP_925604.1|       .............V................SLTGRNVIARLA.....GV..ST..........
gi|37522043|ref|NP_925420.1|       .............-................------------.....--..--..........
gi|37523548|ref|NP_926925.1|       .............-................------------.....--..--..........
gi|37523547|ref|NP_926924.1|       .............-................-HGPENHLAEW-.....--..--..........
gi|37520329|ref|NP_923706.1|       .............-................------------.....--..--..........
gi|37520932|ref|NP_924309.1|       .............-................------------.....--..--..........
ADw_gi|427733727|ref|YP_007053271.1| .............-................------------.....--..--..........
ADw_gi|427739887|ref|YP_007059431.1| .............-................GIAETGVVAIIK.....GS..KKgesn......
ADw_gi|427738968|ref|YP_007058512.1| .............-................NIGKTGAIGELE.....GN..GSdk........
ADw_gi|427737605|ref|YP_007057149.1| .............-................------------.....--..--..........
ADw_gi|427737907|ref|YP_007057451.1| .............-................------------.....--..--..........
ADw_gi|427736327|ref|YP_007055871.1| .............-................------------.....--..--..........
ADw_gi|427735146|ref|YP_007054690.1| .............-................------------.....--..--..........
ADw_gi|427735148|ref|YP_007054692.1| .............-................------------.....--..--..........
ADw_gi|427734182|ref|YP_007053726.1| .............Id...............NKTFTNLEVEIK.....GV..EKpd........
ADw_gi|427738036|ref|YP_007057580.1| .............-................-PRGINVFAEKP.....GT..DSka........
ADw_gi|427737291|ref|YP_007056835.1| .............Dkfvs............LGDRQKIIAR--.....--..EE..........
ADw_gi|427733824|ref|YP_007053368.1| .............-................-DRADNIIAKIP.....GK..KSd.........
ADw_gi|427734438|ref|YP_007053982.1| .............S................-KVCENLILNLPsdfktGK..DNl.........
ADw_gi|427737664|ref|YP_007057208.1| .............-................------------.....--..--..........
ADw_gi|427735400|ref|YP_007054944.1| .............-................------------.....--..--..........
ADw_gi|427736713|ref|YP_007056257.1| .............-................------------.....--..--..........
ADw_gi|427735785|ref|YP_007055329.1| .............-................------------.....--..--..........
ADw_gi|427733974|ref|YP_007053518.1| .............-................------------.....--..--..........
ADw_gi|427735097|ref|YP_007054641.1| .............-................------------.....--..--..........
ADw_gi|427734372|ref|YP_007053916.1| .............-................------------.....--..--..........
ADw_gi|427738248|ref|YP_007057792.1| .............-................------------.....--..--..........
rbN_gi|427718504|ref|YP_007066498.1| .............-................------------.....--..--..........
rbN_gi|427717245|ref|YP_007065239.1| .............-................GVAHTGIVAIIK.....GTrlSSe.........
rbN_gi|427716398|ref|YP_007064392.1| .............-................GVGKTGVIGELP.....TS..DRde........
rbN_gi|427716007|ref|YP_007064001.1| .............-................------------.....--..--..........
rbN_gi|427716207|ref|YP_007064201.1| .............-................------------.....--..--..........
rbN_gi|427716208|ref|YP_007064202.1| .............-................------------.....--..--..........
rbN_gi|427720501|ref|YP_007068495.1| .............D................------------.....--..--..........
rbN_gi|427720149|ref|YP_007068143.1| .............-................-SAGINIFAERT.....GT..DKka........
rbN_gi|427717825|ref|YP_007065819.1| .............G................-KTYQNLILNLS.....PQvqRRqkdl......
rbN_gi|427716163|ref|YP_007064157.1| .............-................-DRADNIIAKIP.....GK..NReramsndkpl
rbN_gi|427716185|ref|YP_007064179.1| .............-................------------.....--..--..........
rbN_gi|427715920|ref|YP_007063914.1| .............-................-LSAAQTIAWI-.....--..--..........
gi|75908939|ref|YP_323235.1|       .............-................------------.....--..--..........
gi|75908435|ref|YP_322731.1|       .............-................SIAQTGIVATIK.....GE..KPst........
gi|75907282|ref|YP_321578.1|       .............-................GVGKTGVVGELQ.....VT..EKnh........
gi|75910294|ref|YP_324590.1|       .............-................GGVGSGIIGKLI.....NA..GQra........
gi|75908006|ref|YP_322302.1|       .............-................------------.....--..--..........
gi|75907687|ref|YP_321983.1|       .............-................------------.....--..--..........
gi|75907688|ref|YP_321984.1|       .............-................------------.....--..--..........
gi|75908485|ref|YP_322781.1|       .............Dr...............DVSLPERQAII-.....NR..EE..........
gi|75908181|ref|YP_322477.1|       .............-................-SGGVNVFAERP.....GT..DNtg........
gi|75907143|ref|YP_321439.1|       .............N................-KSFNNLILNLP.....SQsiGKkqel......
gi|75909389|ref|YP_323685.1|       .............-................-DRADNIIAKIP.....GK..NSe.........
gi|75910593|ref|YP_324889.1|       .............-................------------.....--..--..........
gi|75909995|ref|YP_324291.1|       .............-................-LSAADTITWIN.....AR..GRr.........
gi|298491029|ref|YP_003721206.1|   .............-................------------.....--..--..........
gi|298492645|ref|YP_003722822.1|   .............-................GIAETGIVVIIK.....GE..KSqyg.......
gi|298490648|ref|YP_003720825.1|   .............-................GVGKTGVIGELQ.....GT..QHne........
gi|298491800|ref|YP_003721977.1|   .............-................------------.....--..--..........
gi|298490223|ref|YP_003720400.1|   .............-................------------.....--..--..........
gi|298490222|ref|YP_003720399.1|   .............-................------------.....--..--..........
gi|298492458|ref|YP_003722635.1|   .............-................------------.....--..--..........
gi|298492145|ref|YP_003722322.1|   .............-................-VKNGSHLYVIK.....NT..NM..........
gi|298492188|ref|YP_003722365.1|   .............-................------------.....--..--..........
gi|298491532|ref|YP_003721709.1|   .............-................-PTGVNIFAQKQ.....GK..DKga........


                                     0        90                                                    
                                     |         |                                                    
d1cg2a1                              KNLLLMSHMDT....................................................
gi|269926470|ref|YP_003323093.1|   -----------....................................................
gi|269926320|ref|YP_003322943.1|   PSVMLSAHMDTigflvshidddgfirfvsvggfdprtlvmqrvivhgkddyvglispsskpih
gi|269925335|ref|YP_003321958.1|   RTILVYGHYDV....................................................
gi|269925376|ref|YP_003321999.1|   KSVMLNTHMDH....................................................
gi|269925438|ref|YP_003322061.1|   PEIMLLGHIDT....................................................
gi|269926083|ref|YP_003322706.1|   RKVILIGHMDT....................................................
gi|269838949|ref|YP_003323641.1|   DHVLLCAHWDT....................................................
gi|269926500|ref|YP_003323123.1|   NAVVLISHFDT....................................................
TLn_gi|427723016|ref|YP_007070293.1| -----------....................................................
TLn_gi|427722057|ref|YP_007069334.1| KVLGIRADMDA....................................................
TLn_gi|427722694|ref|YP_007069971.1| KKLAIRVDMDA....................................................
TLn_gi|427723545|ref|YP_007070822.1| -----------....................................................
TLn_gi|427726210|ref|YP_007073487.1| GAIAITGHKDEigaivkdihpqtgqvkvralggsypwiygegvmdilgdhktiqgilsfgsrh
TLn_gi|427724197|ref|YP_007071474.1| PPILIGAHYDA....................................................
TLn_gi|427725916|ref|YP_007073193.1| -----------....................................................
TLn_gi|427723370|ref|YP_007070647.1| -----------....................................................
TLn_gi|427724429|ref|YP_007071706.1| -----------....................................................
Cy2_gi|428218721|ref|YP_007103186.1| -----------....................................................
Cy2_gi|428217331|ref|YP_007101796.1| PVLAIRADMDA....................................................
Cy2_gi|428218965|ref|YP_007103430.1| -----------....................................................
Cy2_gi|428218329|ref|YP_007102794.1| -----------....................................................
Cy2_gi|428218498|ref|YP_007102963.1| PPILVGAHYDA....................................................
Cy2_gi|428218676|ref|YP_007103141.1| SAIAITAHKDEigaivksinqygqieigkldgsfpwvygegivdllgdretisavlsfgsrhi
Cy2_gi|428218275|ref|YP_007102740.1| -----------....................................................
Cy2_gi|428217320|ref|YP_007101785.1| -----------....................................................
Cy2_gi|428217360|ref|YP_007101825.1| -----------....................................................
Cy2_gi|428217620|ref|YP_007102085.1| -----------....................................................
gi|158336127|ref|YP_001517301.1|   -----------....................................................
gi|158335082|ref|YP_001516254.1|   PVLAIRADMDA....................................................
gi|158334581|ref|YP_001515753.1|   RQLAIRTDMDA....................................................
gi|158339037|ref|YP_001520214.1|   -----------....................................................
gi|158335668|ref|YP_001516840.1|   -----------....................................................
gi|158335292|ref|YP_001516464.1|   -----------....................................................
gi|158338092|ref|YP_001519268.1|   PPILIGAHFDG....................................................
gi|158337208|ref|YP_001518383.1|   GVLLVGAHYDS....................................................
gi|158338413|ref|YP_001519590.1|   PTIAISVHYNA....................................................
gi|158336876|ref|YP_001518051.1|   -----------....................................................
gi|16330631|ref|NP_441359.1|       -----------....................................................
gi|16332230|ref|NP_442958.1|       PVLAIRADMDA....................................................
gi|16331842|ref|NP_442570.1|       RLLAIRTDMDA....................................................
gi|16329830|ref|NP_440558.1|       -----------....................................................
gi|16330558|ref|NP_441286.1|       -----------....................................................
gi|16330376|ref|NP_441104.1|       -----------....................................................
gi|16329723|ref|NP_440451.1|       -----------....................................................
gi|16330213|ref|NP_440941.1|       -----------....................................................
toq_gi|571027785|ref|YP_008899903.1| -----------....................................................
toq_gi|571026933|ref|YP_008899051.1| PVLAIRADMDA....................................................
toq_gi|571028537|ref|YP_008900657.1| RLLAIRTDMDA....................................................
toq_gi|571027463|ref|YP_008899581.1| -----------....................................................
toq_gi|571027813|ref|YP_008899931.1| -----------....................................................
gi|22299288|ref|NP_682535.1|       -----------....................................................
gi|22299990|ref|NP_683237.1|       PVLAIRADMDA....................................................
gi|22297557|ref|NP_680804.1|       RLLAIRTDMDA....................................................
gi|22297795|ref|NP_681042.1|       -----------....................................................
gi|22299317|ref|NP_682564.1|       -----------....................................................
fN9_gi|428220463|ref|YP_007104633.1| -----------....................................................
fN9_gi|428222328|ref|YP_007106498.1| PVLAIRADMDA....................................................
fN9_gi|428221241|ref|YP_007105411.1| PAIATGSHLDT....................................................
fN9_gi|428222603|ref|YP_007106773.1| -----------....................................................
fN9_gi|428221486|ref|YP_007105656.1| EIVVIGAHYDS....................................................
fN9_gi|428221848|ref|YP_007106018.1| PVIAISLHYNA....................................................
fN9_gi|428221485|ref|YP_007105655.1| -----------....................................................
qVl_gi|427712524|ref|YP_007061148.1| -----------....................................................
qVl_gi|427712396|ref|YP_007061020.1| PVLGIRADMDA....................................................
qVl_gi|427714252|ref|YP_007062876.1| RVLAIRTDLDA....................................................
qVl_gi|427711704|ref|YP_007060328.1| -----------....................................................
qVl_gi|427711553|ref|YP_007060177.1| -----------....................................................
qVl_gi|427714522|ref|YP_007063146.1| PTLAFSLHY--....................................................
qVl_gi|427713716|ref|YP_007062340.1| -----------....................................................
gi|113954246|ref|YP_731406.1|      KRVVLVG----....................................................
gi|113955421|ref|YP_729363.1|      PQLGLRVDMDA....................................................
gi|113954748|ref|YP_731585.1|      -----------....................................................
gi|113954650|ref|YP_730754.1|      -----------....................................................
gi|81299999|ref|YP_400207.1|       -----------....................................................
gi|81299067|ref|YP_399275.1|       PTLAIRADMDA....................................................
gi|81300780|ref|YP_400988.1|       RCLALRTDMDA....................................................
gi|81300390|ref|YP_400598.1|       -----------....................................................
gi|81301169|ref|YP_401377.1|       -----------....................................................
gi|81300943|ref|YP_401151.1|       -----------....................................................
gi|81299525|ref|YP_399733.1|       -----------....................................................
gi|81301079|ref|YP_401287.1|       EVIAVTAHKDEigmiveaiapegrvrvnrlggsypwiygegpvellgdgaivpgilsfgsrhi
gi|81300779|ref|YP_400987.1|       -----------....................................................
gi|123966726|ref|YP_001011807.1|   -----------....................................................
gi|123967035|ref|YP_001012116.1|   GFVGLRVDMDA....................................................
gi|123965487|ref|YP_001010568.1|   -----------....................................................
gi|123965916|ref|YP_001010997.1|   -----------....................................................
JuK_gi|428313309|ref|YP_007124286.1| -----------....................................................
JuK_gi|428311057|ref|YP_007122034.1| PVLGIRADMDA....................................................
JuK_gi|428309062|ref|YP_007120039.1| RLVAIRTDMDA....................................................
JuK_gi|428312940|ref|YP_007123917.1| -----------....................................................
JuK_gi|428309925|ref|YP_007120902.1| -----------....................................................
JuK_gi|428310093|ref|YP_007121070.1| EIVIVGGHYDS....................................................
JuK_gi|428313512|ref|YP_007124489.1| -----------....................................................
JuK_gi|428309552|ref|YP_007120529.1| -----------....................................................
JuK_gi|428313083|ref|YP_007124060.1| -----------....................................................
JuK_gi|428310554|ref|YP_007121531.1| RSIAITAHKDEigaivktvgdegrvevrklggafpwvygegvvdllgdkqtisgilsfgsrhv
JuK_gi|428310231|ref|YP_007121208.1| -----------....................................................
JuK_gi|428312499|ref|YP_007123476.1| -----------....................................................
JuK_gi|428313236|ref|YP_007124213.1| GDVALEIHADS....................................................
JuK_gi|428313477|ref|YP_007124454.1| -----------....................................................
JuK_gi|428311704|ref|YP_007122681.1| -----------....................................................
gi|113473990|ref|YP_720051.1|      -----------....................................................
gi|113475511|ref|YP_721572.1|      RVLAIRADLDA....................................................
gi|113477163|ref|YP_723224.1|      QWLAIRTDMDG....................................................
gi|113478073|ref|YP_724134.1|      -----------....................................................
gi|113476499|ref|YP_722560.1|      -----------....................................................
gi|113474224|ref|YP_720285.1|      -----------....................................................
gi|113477463|ref|YP_723524.1|      -----------....................................................
gi|113476944|ref|YP_723005.1|      -----------....................................................
gi|113474394|ref|YP_720455.1|      -----------....................................................
HFg_gi|428224156|ref|YP_007108253.1| -----------....................................................
HFg_gi|428226397|ref|YP_007110494.1| PVLGIRADMDA....................................................
HFg_gi|428224388|ref|YP_007108485.1| RRLAIRTDLDA....................................................
HFg_gi|428223916|ref|YP_007108013.1| -----------....................................................
HFg_gi|428226743|ref|YP_007110840.1| -----------....................................................
HFg_gi|428224382|ref|YP_007108479.1| -----------....................................................
HFg_gi|428223590|ref|YP_007107687.1| RAIAITAHKDEigmmvkavepngriavrrlggafpwvygegvvdllgdretvsgilsfgsrhi
HFg_gi|428224655|ref|YP_007108752.1| SPILVGAHYDG....................................................
HFg_gi|428226160|ref|YP_007110257.1| PTLALSLH---....................................................
HFg_gi|428226051|ref|YP_007110148.1| DTLLLGAHYDT....................................................
HFg_gi|428224780|ref|YP_007108877.1| -----------....................................................
gi|257061661|ref|YP_003139549.1|   -----------....................................................
gi|257062162|ref|YP_003140050.1|   PVLAIRADMDA....................................................
gi|257059081|ref|YP_003136969.1|   RTVAIRTDMDA....................................................
gi|257058278|ref|YP_003136166.1|   -----------....................................................
gi|257060857|ref|YP_003138745.1|   -----------....................................................
gi|257061491|ref|YP_003139379.1|   -----------....................................................
gi|257058498|ref|YP_003136386.1|   -----------....................................................
gi|257060846|ref|YP_003138734.1|   -----------....................................................
gi|257057955|ref|YP_003135843.1|   PQQLLLGHCDT....................................................
5BT_gi|434391707|ref|YP_007126654.1| -----------....................................................
5BT_gi|434395368|ref|YP_007130315.1| PVLAIRADMDA....................................................
5BT_gi|434393016|ref|YP_007127963.1| RLLAIRTDMDA....................................................
5BT_gi|434392062|ref|YP_007127009.1| GALATGSHIDT....................................................
5BT_gi|434395507|ref|YP_007130454.1| PKVMYRADLDA....................................................
5BT_gi|434391636|ref|YP_007126583.1| -----------....................................................
5BT_gi|434395491|ref|YP_007130438.1| PRVVVGAHYDS....................................................
5BT_gi|434391354|ref|YP_007126301.1| FPILVGAHYDA....................................................
5BT_gi|434391607|ref|YP_007126554.1| -----------....................................................
5BT_gi|434395336|ref|YP_007130283.1| RAIAITAHKDEigaivktvgdagqvevrrlggsypwiygegvvdllgdnetisgilsfgsrhv
5BT_gi|434391236|ref|YP_007126183.1| -----------....................................................
5BT_gi|434391792|ref|YP_007126739.1| -----------....................................................
5BT_gi|434395419|ref|YP_007130366.1| -----------....................................................
gi|284929626|ref|YP_003422148.1|   -----------....................................................
gi|284928900|ref|YP_003421422.1|   SVLAIRTDMDA....................................................
gi|284929040|ref|YP_003421562.1|   -----------....................................................
8V2_gi|428775164|ref|YP_007166951.1| -----------....................................................
8V2_gi|428777931|ref|YP_007169718.1| KVLGIRADMDA....................................................
8V2_gi|428776138|ref|YP_007167925.1| -----------....................................................
8V2_gi|428777938|ref|YP_007169725.1| -----------....................................................
8V2_gi|428777493|ref|YP_007169280.1| PPILVAAHYDS....................................................
8V2_gi|428778337|ref|YP_007170124.1| SPVAITAHKDEigtivkcvredgalevrrlggsfpwvygegvmdilgdratisgilsfgsrhv
8V2_gi|428777769|ref|YP_007169556.1| PAIALSIHY--....................................................
8V2_gi|428775818|ref|YP_007167605.1| -----------....................................................
gi|166368941|ref|YP_001661214.1|   -----------....................................................
gi|166365183|ref|YP_001657456.1|   PVLALRADMDA....................................................
gi|166366573|ref|YP_001658846.1|   RILAIRADMDA....................................................
gi|166362930|ref|YP_001655203.1|   -----------....................................................
gi|166364322|ref|YP_001656595.1|   -----------....................................................
gi|166368299|ref|YP_001660572.1|   -----------....................................................
gi|166366765|ref|YP_001659038.1|   PPILIGAHYDT....................................................
gi|166368835|ref|YP_001661108.1|   PTLAISVHYNA....................................................
gi|166366493|ref|YP_001658766.1|   KKMAITGHKDEigaiikvinpdgtlqirqlggafpwiygegvvdiigdretrsgilsfgsrhi
gi|166363064|ref|YP_001655337.1|   -----------....................................................
gi|166366413|ref|YP_001658686.1|   -----------....................................................
gi|37522180|ref|NP_925557.1|       -----------....................................................
gi|37519943|ref|NP_923320.1|       PVVAVRADMDA....................................................
gi|37522109|ref|NP_925486.1|       RTVGVRADMDG....................................................
gi|37520936|ref|NP_924313.1|       EWIIRGNHYDA....................................................
gi|37523992|ref|NP_927369.1|       EYIVLSAHLDH....................................................
gi|37520534|ref|NP_923911.1|       -----------....................................................
gi|37520091|ref|NP_923468.1|       -----------....................................................
gi|37522227|ref|NP_925604.1|       PQVLLGAHYDS....................................................
gi|37522043|ref|NP_925420.1|       -----------....................................................
gi|37523548|ref|NP_926925.1|       -----------....................................................
gi|37523547|ref|NP_926924.1|       -----------....................................................
gi|37520329|ref|NP_923706.1|       -----------....................................................
gi|37520932|ref|NP_924309.1|       -----------....................................................
ADw_gi|427733727|ref|YP_007053271.1| -----------....................................................
ADw_gi|427739887|ref|YP_007059431.1| RVLAIRADMDA....................................................
ADw_gi|427738968|ref|YP_007058512.1| RILAIRTDMDA....................................................
ADw_gi|427737605|ref|YP_007057149.1| -----------....................................................
ADw_gi|427737907|ref|YP_007057451.1| -----------....................................................
ADw_gi|427736327|ref|YP_007055871.1| -----------....................................................
ADw_gi|427735146|ref|YP_007054690.1| -----------....................................................
ADw_gi|427735148|ref|YP_007054692.1| -----------....................................................
ADw_gi|427734182|ref|YP_007053726.1| EIVIIGGHYDT....................................................
ADw_gi|427738036|ref|YP_007057580.1| GAILLAAHYDT....................................................
ADw_gi|427737291|ref|YP_007056835.1| PTLALSVHY--....................................................
ADw_gi|427733824|ref|YP_007053368.1| YPIAITAHKDEigaivktvgeagivevrklggafpwvygegvvdllgdketisgvlsfgsrhv
ADw_gi|427734438|ref|YP_007053982.1| SPILIAAHYDG....................................................
ADw_gi|427737664|ref|YP_007057208.1| -----------....................................................
ADw_gi|427735400|ref|YP_007054944.1| -----------....................................................
ADw_gi|427736713|ref|YP_007056257.1| -----------....................................................
ADw_gi|427735785|ref|YP_007055329.1| -----------....................................................
ADw_gi|427733974|ref|YP_007053518.1| -----------....................................................
ADw_gi|427735097|ref|YP_007054641.1| -----------....................................................
ADw_gi|427734372|ref|YP_007053916.1| -----------....................................................
ADw_gi|427738248|ref|YP_007057792.1| -----------....................................................
rbN_gi|427718504|ref|YP_007066498.1| -----------....................................................
rbN_gi|427717245|ref|YP_007065239.1| KVLAIRADMDA....................................................
rbN_gi|427716398|ref|YP_007064392.1| RLLAIRTDMDA....................................................
rbN_gi|427716007|ref|YP_007064001.1| -----------....................................................
rbN_gi|427716207|ref|YP_007064201.1| -----------....................................................
rbN_gi|427716208|ref|YP_007064202.1| -----------....................................................
rbN_gi|427720501|ref|YP_007068495.1| -----------....................................................
rbN_gi|427720149|ref|YP_007068143.1| GAILVAAHFDT....................................................
rbN_gi|427717825|ref|YP_007065819.1| PLILIGAHYDA....................................................
rbN_gi|427716163|ref|YP_007064157.1| RVYAITAHKDEigaivktigdagrvevrklggafpwvygegvvdllgdnatisgilsfgsrhv
rbN_gi|427716185|ref|YP_007064179.1| -----------....................................................
rbN_gi|427715920|ref|YP_007063914.1| -----------....................................................
gi|75908939|ref|YP_323235.1|       -----------....................................................
gi|75908435|ref|YP_322731.1|       QVLAIRADMDA....................................................
gi|75907282|ref|YP_321578.1|       SFLAIRTDMDA....................................................
gi|75910294|ref|YP_324590.1|       PTIALRADMDA....................................................
gi|75908006|ref|YP_322302.1|       -----------....................................................
gi|75907687|ref|YP_321983.1|       -----------....................................................
gi|75907688|ref|YP_321984.1|       -----------....................................................
gi|75908485|ref|YP_322781.1|       PAIALSVHYNS....................................................
gi|75908181|ref|YP_322477.1|       DAILVAAHYDT....................................................
gi|75907143|ref|YP_321439.1|       PPILIGAHYDG....................................................
gi|75909389|ref|YP_323685.1|       RAVAITAHKDEigaivknigdagkvevrklggaypwvygegvvdllgdnetisgilsfgsrhv
gi|75910593|ref|YP_324889.1|       -----------....................................................
gi|75909995|ref|YP_324291.1|       GDVSLEVHAD-....................................................
gi|298491029|ref|YP_003721206.1|   -----------....................................................
gi|298492645|ref|YP_003722822.1|   KVLGIRADMDA....................................................
gi|298490648|ref|YP_003720825.1|   KVLAIRTDMDA....................................................
gi|298491800|ref|YP_003721977.1|   -----------....................................................
gi|298490223|ref|YP_003720400.1|   -----------....................................................
gi|298490222|ref|YP_003720399.1|   -----------....................................................
gi|298492458|ref|YP_003722635.1|   -----------....................................................
gi|298492145|ref|YP_003722322.1|   PAIL-------....................................................
gi|298492188|ref|YP_003722365.1|   -----------....................................................
gi|298491532|ref|YP_003721709.1|   GAILIAAHYDT....................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...................................................VYLKG.....IL
gi|269926470|ref|YP_003323093.1|   ...................................................-----.....--
gi|269926320|ref|YP_003322943.1|   .....................lsrpedrdkavkieelfidlmmppdqvkanVQVGD.....PI
gi|269925335|ref|YP_003321958.1|   ...................................................QPPDPld...LW
gi|269925376|ref|YP_003321999.1|   ...................................................VDIGDrs...SW
gi|269925438|ref|YP_003322061.1|   ...................................................VPG--.....--
gi|269926083|ref|YP_003322706.1|   ...................................................VYPKG.....TA
gi|269838949|ref|YP_003323641.1|   ...................................................RPRADner..D-
gi|269926500|ref|YP_003323123.1|   ...................................................VDVSD.....YG
TLn_gi|427723016|ref|YP_007070293.1| ...................................................-----.....--
TLn_gi|427722057|ref|YP_007069334.1| ...................................................LPIQE.....EN
TLn_gi|427722694|ref|YP_007069971.1| ...................................................LPIQE.....CN
TLn_gi|427723545|ref|YP_007070822.1| ...................................................-----.....--
TLn_gi|427726210|ref|YP_007073487.1| ...............vshespqkklqtetpvqwqqawletkctaeelhkagVRPGSrvlvgRH
TLn_gi|427724197|ref|YP_007071474.1| ...................................................VIS--.....--
TLn_gi|427725916|ref|YP_007073193.1| ...................................................--D--.....--
TLn_gi|427723370|ref|YP_007070647.1| ...................................................-----.....--
TLn_gi|427724429|ref|YP_007071706.1| ...................................................-----.....--
Cy2_gi|428218721|ref|YP_007103186.1| ...................................................-----.....--
Cy2_gi|428217331|ref|YP_007101796.1| ...................................................LPVQE.....EN
Cy2_gi|428218965|ref|YP_007103430.1| ...................................................-----.....--
Cy2_gi|428218329|ref|YP_007102794.1| ...................................................-----.....--
Cy2_gi|428218498|ref|YP_007102963.1| ...................................................VPG--.....--
Cy2_gi|428218676|ref|YP_007103141.1| ...........shrspqkelqtskalswddawletkaspqklaaagirpgtRMVIS.....KH
Cy2_gi|428218275|ref|YP_007102740.1| ...................................................-----.....--
Cy2_gi|428217320|ref|YP_007101785.1| ...................................................-----.....--
Cy2_gi|428217360|ref|YP_007101825.1| ...................................................-----.....--
Cy2_gi|428217620|ref|YP_007102085.1| ...................................................-----.....--
gi|158336127|ref|YP_001517301.1|   ...................................................-----.....--
gi|158335082|ref|YP_001516254.1|   ...................................................LPIQE.....EN
gi|158334581|ref|YP_001515753.1|   ...................................................LPIQE.....MT
gi|158339037|ref|YP_001520214.1|   ...................................................-----.....--
gi|158335668|ref|YP_001516840.1|   ...................................................-----.....--
gi|158335292|ref|YP_001516464.1|   ...................................................-----.....--
gi|158338092|ref|YP_001519268.1|   ...................................................VPG--.....--
gi|158337208|ref|YP_001518383.1|   ...................................................VRG--.....--
gi|158338413|ref|YP_001519590.1|   ...................................................LPD--.....--
gi|158336876|ref|YP_001518051.1|   ...................................................-----.....--
gi|16330631|ref|NP_441359.1|       ...................................................-----.....--
gi|16332230|ref|NP_442958.1|       ...................................................LPVTE.....EN
gi|16331842|ref|NP_442570.1|       ...................................................LPIEE.....MV
gi|16329830|ref|NP_440558.1|       ...................................................-----.....--
gi|16330558|ref|NP_441286.1|       ...................................................-----.....--
gi|16330376|ref|NP_441104.1|       ...................................................-----.....--
gi|16329723|ref|NP_440451.1|       ...................................................-----.....--
gi|16330213|ref|NP_440941.1|       ...................................................-----.....--
toq_gi|571027785|ref|YP_008899903.1| ...................................................-----.....--
toq_gi|571026933|ref|YP_008899051.1| ...................................................LPIQE.....EN
toq_gi|571028537|ref|YP_008900657.1| ...................................................LPIQE.....RT
toq_gi|571027463|ref|YP_008899581.1| ...................................................-----.....--
toq_gi|571027813|ref|YP_008899931.1| ...................................................-----.....--
gi|22299288|ref|NP_682535.1|       ...................................................-----.....--
gi|22299990|ref|NP_683237.1|       ...................................................LPVQE.....EN
gi|22297557|ref|NP_680804.1|       ...................................................LPIQE.....RT
gi|22297795|ref|NP_681042.1|       ...................................................-----.....--
gi|22299317|ref|NP_682564.1|       ...................................................-----.....--
fN9_gi|428220463|ref|YP_007104633.1| ...................................................-----.....--
fN9_gi|428222328|ref|YP_007106498.1| ...................................................LPIQE.....EN
fN9_gi|428221241|ref|YP_007105411.1| ...................................................VPN--.....--
fN9_gi|428222603|ref|YP_007106773.1| ...................................................-----.....--
fN9_gi|428221486|ref|YP_007105656.1| ...................................................VAG--.....--
fN9_gi|428221848|ref|YP_007106018.1| ...................................................LPD--.....--
fN9_gi|428221485|ref|YP_007105655.1| ...................................................-----.....--
qVl_gi|427712524|ref|YP_007061148.1| ...................................................-----.....--
qVl_gi|427712396|ref|YP_007061020.1| ...................................................LPIQE.....EN
qVl_gi|427714252|ref|YP_007062876.1| ...................................................LPIHE.....RT
qVl_gi|427711704|ref|YP_007060328.1| ...................................................-----.....--
qVl_gi|427711553|ref|YP_007060177.1| ...................................................-----.....--
qVl_gi|427714522|ref|YP_007063146.1| ...................................................-----.....--
qVl_gi|427713716|ref|YP_007062340.1| ...................................................-----.....--
gi|113954246|ref|YP_731406.1|      ...................................................-----.....--
gi|113955421|ref|YP_729363.1|      ...................................................LPVEE.....RT
gi|113954748|ref|YP_731585.1|      ...................................................-----.....--
gi|113954650|ref|YP_730754.1|      ...................................................-----.....--
gi|81299999|ref|YP_400207.1|       ...................................................-----.....--
gi|81299067|ref|YP_399275.1|       ...................................................LPILE.....AN
gi|81300780|ref|YP_400988.1|       ...................................................LPIEE.....QT
gi|81300390|ref|YP_400598.1|       ...................................................-----.....--
gi|81301169|ref|YP_401377.1|       ...................................................-----.....--
gi|81300943|ref|YP_401151.1|       ...................................................-----.....--
gi|81299525|ref|YP_399733.1|       ...................................................-----.....--
gi|81301079|ref|YP_401287.1|       ................shaspqkalqvdkaltwpdtwietkqslealqaagVRPGTrv...VV
gi|81300779|ref|YP_400987.1|       ...................................................-----.....--
gi|123966726|ref|YP_001011807.1|   ...................................................-----.....--
gi|123967035|ref|YP_001012116.1|   ...................................................LPISE.....NT
gi|123965487|ref|YP_001010568.1|   ...................................................-----.....--
gi|123965916|ref|YP_001010997.1|   ...................................................-----.....--
JuK_gi|428313309|ref|YP_007124286.1| ...................................................-----.....--
JuK_gi|428311057|ref|YP_007122034.1| ...................................................LPIQE.....AN
JuK_gi|428309062|ref|YP_007120039.1| ...................................................LPITE.....RT
JuK_gi|428312940|ref|YP_007123917.1| ...................................................-----.....--
JuK_gi|428309925|ref|YP_007120902.1| ...................................................-----.....--
JuK_gi|428310093|ref|YP_007121070.1| ...................................................VFG--.....--
JuK_gi|428313512|ref|YP_007124489.1| ...................................................-----.....--
JuK_gi|428309552|ref|YP_007120529.1| ...................................................-----.....--
JuK_gi|428313083|ref|YP_007124060.1| ...................................................-----.....--
JuK_gi|428310554|ref|YP_007121531.1| ................shespqkaqqedkpvhwedvwvetkctpeeleaagV----.....--
JuK_gi|428310231|ref|YP_007121208.1| ...................................................-----.....--
JuK_gi|428312499|ref|YP_007123476.1| ...................................................-----.....--
JuK_gi|428313236|ref|YP_007124213.1| ...................................................FSNPD.....V-
JuK_gi|428313477|ref|YP_007124454.1| ...................................................-----.....--
JuK_gi|428311704|ref|YP_007122681.1| ...................................................-----.....--
gi|113473990|ref|YP_720051.1|      ...................................................-----.....--
gi|113475511|ref|YP_721572.1|      ...................................................LPIQE.....LN
gi|113477163|ref|YP_723224.1|      ...................................................LPIKE.....CT
gi|113478073|ref|YP_724134.1|      ...................................................-----.....--
gi|113476499|ref|YP_722560.1|      ...................................................-----.....--
gi|113474224|ref|YP_720285.1|      ...................................................-----.....--
gi|113477463|ref|YP_723524.1|      ...................................................-----.....--
gi|113476944|ref|YP_723005.1|      ...................................................-----.....--
gi|113474394|ref|YP_720455.1|      ...................................................-----.....--
HFg_gi|428224156|ref|YP_007108253.1| ...................................................-----.....--
HFg_gi|428226397|ref|YP_007110494.1| ...................................................LPIQE.....AN
HFg_gi|428224388|ref|YP_007108485.1| ...................................................LPIQE.....QT
HFg_gi|428223916|ref|YP_007108013.1| ...................................................-----.....--
HFg_gi|428226743|ref|YP_007110840.1| ...................................................-----.....--
HFg_gi|428224382|ref|YP_007108479.1| ...................................................-----.....--
HFg_gi|428223590|ref|YP_007107687.1| ...........shespqkaqqedkpvrwedawvetkrspedlaaagirpgtR----.....--
HFg_gi|428224655|ref|YP_007108752.1| ...................................................VPG--.....--
HFg_gi|428226160|ref|YP_007110257.1| ...................................................-----.....--
HFg_gi|428226051|ref|YP_007110148.1| ...................................................VAD--.....--
HFg_gi|428224780|ref|YP_007108877.1| ...................................................-----.....--
gi|257061661|ref|YP_003139549.1|   ...................................................-----.....--
gi|257062162|ref|YP_003140050.1|   ...................................................LPIQE.....EN
gi|257059081|ref|YP_003136969.1|   ...................................................LPIEE.....RT
gi|257058278|ref|YP_003136166.1|   ...................................................-----.....--
gi|257060857|ref|YP_003138745.1|   ...................................................-----.....--
gi|257061491|ref|YP_003139379.1|   ...................................................-----.....--
gi|257058498|ref|YP_003136386.1|   ...................................................-----.....--
gi|257060846|ref|YP_003138734.1|   ...................................................-----.....--
gi|257057955|ref|YP_003135843.1|   ...................................................VWPVG.....TL
5BT_gi|434391707|ref|YP_007126654.1| ...................................................-----.....--
5BT_gi|434395368|ref|YP_007130315.1| ...................................................LPIQE.....EN
5BT_gi|434393016|ref|YP_007127963.1| ...................................................LPIQE.....RT
5BT_gi|434392062|ref|YP_007127009.1| ...................................................VPV--.....--
5BT_gi|434395507|ref|YP_007130454.1| ...................................................LPVQE.....TT
5BT_gi|434391636|ref|YP_007126583.1| ...................................................-----.....--
5BT_gi|434395491|ref|YP_007130438.1| ...................................................VPG--.....--
5BT_gi|434391354|ref|YP_007126301.1| ...................................................VPG--.....--
5BT_gi|434391607|ref|YP_007126554.1| ...................................................-----.....--
5BT_gi|434395336|ref|YP_007130283.1| shespqkelqedtpvkwenawietkctpeelnavgirpgtrvvigkhrkrpV----.....--
5BT_gi|434391236|ref|YP_007126183.1| ...................................................-----.....--
5BT_gi|434391792|ref|YP_007126739.1| ...................................................-----.....--
5BT_gi|434395419|ref|YP_007130366.1| ...................................................-----.....--
gi|284929626|ref|YP_003422148.1|   ...................................................-----.....--
gi|284928900|ref|YP_003421422.1|   ...................................................LPMQE.....KT
gi|284929040|ref|YP_003421562.1|   ...................................................-----.....--
8V2_gi|428775164|ref|YP_007166951.1| ...................................................-----.....--
8V2_gi|428777931|ref|YP_007169718.1| ...................................................LPVQE.....AN
8V2_gi|428776138|ref|YP_007167925.1| ...................................................-----.....--
8V2_gi|428777938|ref|YP_007169725.1| ...................................................-----.....--
8V2_gi|428777493|ref|YP_007169280.1| ...................................................VPG--.....--
8V2_gi|428778337|ref|YP_007170124.1| ...........shespqkaqqedqplfwenawietkcsveeletagvrpgtRVVIG.....KH
8V2_gi|428777769|ref|YP_007169556.1| ...................................................-----.....--
8V2_gi|428775818|ref|YP_007167605.1| ...................................................-----.....--
gi|166368941|ref|YP_001661214.1|   ...................................................-----.....--
gi|166365183|ref|YP_001657456.1|   ...................................................LPIAE.....EN
gi|166366573|ref|YP_001658846.1|   ...................................................LPIQE.....RT
gi|166362930|ref|YP_001655203.1|   ...................................................-----.....--
gi|166364322|ref|YP_001656595.1|   ...................................................-----.....--
gi|166368299|ref|YP_001660572.1|   ...................................................-----.....--
gi|166366765|ref|YP_001659038.1|   ...................................................VPG--.....--
gi|166368835|ref|YP_001661108.1|   ...................................................LPD--.....--
gi|166366493|ref|YP_001658766.1|   ..shqspqkvqqentpvtwesawietkltpeeldacgvrvgsrvvvgkhrkQP---.....--
gi|166363064|ref|YP_001655337.1|   ...................................................-----.....--
gi|166366413|ref|YP_001658686.1|   ...................................................-----.....--
gi|37522180|ref|NP_925557.1|       ...................................................-----.....--
gi|37519943|ref|NP_923320.1|       ...................................................LPILE.....GN
gi|37522109|ref|NP_925486.1|       ...................................................LPIAE.....QT
gi|37520936|ref|NP_924313.1|       ...................................................WVL--.....--
gi|37523992|ref|NP_927369.1|       ...................................................LGIGE.....P-
gi|37520534|ref|NP_923911.1|       ...................................................-----.....--
gi|37520091|ref|NP_923468.1|       ...................................................-----.....--
gi|37522227|ref|NP_925604.1|       ...................................................VEG--.....--
gi|37522043|ref|NP_925420.1|       ...................................................-----.....--
gi|37523548|ref|NP_926925.1|       ...................................................-----.....--
gi|37523547|ref|NP_926924.1|       ...................................................-----.....--
gi|37520329|ref|NP_923706.1|       ...................................................-----.....--
gi|37520932|ref|NP_924309.1|       ...................................................-----.....--
ADw_gi|427733727|ref|YP_007053271.1| ...................................................-----.....--
ADw_gi|427739887|ref|YP_007059431.1| ...................................................LPVSE.....LN
ADw_gi|427738968|ref|YP_007058512.1| ...................................................LPIQE.....LA
ADw_gi|427737605|ref|YP_007057149.1| ...................................................-----.....--
ADw_gi|427737907|ref|YP_007057451.1| ...................................................-----.....--
ADw_gi|427736327|ref|YP_007055871.1| ...................................................-----.....--
ADw_gi|427735146|ref|YP_007054690.1| ...................................................-----.....--
ADw_gi|427735148|ref|YP_007054692.1| ...................................................-----.....--
ADw_gi|427734182|ref|YP_007053726.1| ...................................................AFT--.....--
ADw_gi|427738036|ref|YP_007057580.1| ...................................................VLN--.....--
ADw_gi|427737291|ref|YP_007056835.1| ...................................................-----.....--
ADw_gi|427733824|ref|YP_007053368.1| ..shespqkmfqqdvalkwedawietkcsalelenagirpgsrmviskhrkH----.....--
ADw_gi|427734438|ref|YP_007053982.1| ...................................................VPG--.....--
ADw_gi|427737664|ref|YP_007057208.1| ...................................................-----.....--
ADw_gi|427735400|ref|YP_007054944.1| ...................................................-----.....--
ADw_gi|427736713|ref|YP_007056257.1| ...................................................-----.....--
ADw_gi|427735785|ref|YP_007055329.1| ...................................................-----.....--
ADw_gi|427733974|ref|YP_007053518.1| ...................................................-----.....--
ADw_gi|427735097|ref|YP_007054641.1| ...................................................-----.....--
ADw_gi|427734372|ref|YP_007053916.1| ...................................................-----.....--
ADw_gi|427738248|ref|YP_007057792.1| ...................................................-----.....--
rbN_gi|427718504|ref|YP_007066498.1| ...................................................-----.....--
rbN_gi|427717245|ref|YP_007065239.1| ...................................................LPIQE.....LN
rbN_gi|427716398|ref|YP_007064392.1| ...................................................LPIQE.....RT
rbN_gi|427716007|ref|YP_007064001.1| ...................................................-----.....--
rbN_gi|427716207|ref|YP_007064201.1| ...................................................-----.....--
rbN_gi|427716208|ref|YP_007064202.1| ...................................................-----.....--
rbN_gi|427720501|ref|YP_007068495.1| ...................................................-----.....--
rbN_gi|427720149|ref|YP_007068143.1| ...................................................VAA--.....--
rbN_gi|427717825|ref|YP_007065819.1| ...................................................VPG--.....--
rbN_gi|427716163|ref|YP_007064157.1| ..shespqkvqqedttvkwenawietkltsaeletagirpgtrmvigkhrkR----.....--
rbN_gi|427716185|ref|YP_007064179.1| ...................................................-----.....--
rbN_gi|427715920|ref|YP_007063914.1| ...................................................-----.....--
gi|75908939|ref|YP_323235.1|       ...................................................-----.....--
gi|75908435|ref|YP_322731.1|       ...................................................LPIQE.....LN
gi|75907282|ref|YP_321578.1|       ...................................................LPIQE.....RT
gi|75910294|ref|YP_324590.1|       ...................................................LPGQE.....NT
gi|75908006|ref|YP_322302.1|       ...................................................-----.....--
gi|75907687|ref|YP_321983.1|       ...................................................-----.....--
gi|75907688|ref|YP_321984.1|       ...................................................-----.....--
gi|75908485|ref|YP_322781.1|       ...................................................LPD--.....--
gi|75908181|ref|YP_322477.1|       ...................................................VVG--.....--
gi|75907143|ref|YP_321439.1|       ...................................................VPG--.....--
gi|75909389|ref|YP_323685.1|       shespqkvqqedtavkwenawietkrtteeleiagirpgtrmvigkhrkhpVKL--.....--
gi|75910593|ref|YP_324889.1|       ...................................................-----.....--
gi|75909995|ref|YP_324291.1|       ...................................................-----.....--
gi|298491029|ref|YP_003721206.1|   ...................................................-----.....--
gi|298492645|ref|YP_003722822.1|   ...................................................LPVQE.....EN
gi|298490648|ref|YP_003720825.1|   ...................................................LPIQE.....RS
gi|298491800|ref|YP_003721977.1|   ...................................................-----.....--
gi|298490223|ref|YP_003720400.1|   ...................................................-----.....--
gi|298490222|ref|YP_003720399.1|   ...................................................-----.....--
gi|298492458|ref|YP_003722635.1|   ...................................................----G.....--
gi|298492145|ref|YP_003722322.1|   ...................................................-----.....--
gi|298492188|ref|YP_003722365.1|   ...................................................-----.....--
gi|298491532|ref|YP_003721709.1|   ...................................................VDL--.....--


                                     100                                   110             120      
                                       |                                     |               |      
d1cg2a1                              AKAPF..RVE..........................GDKAYGPGI......ADDKGGNAVILH
gi|269926470|ref|YP_003323093.1|   -----..---..........................---------......----SGAAAVLG
gi|269926320|ref|YP_003322943.1|   SLCRE..VVV..........................NEWSFASAY......LDDRIGVYIMLE
gi|269925335|ref|YP_003321958.1|   QTPPFepSVR..........................EGRIYARGA......VDDKGQVMMHLK
gi|269925376|ref|YP_003321999.1|   DYDPYsgEIR..........................DGYVCGRGA......VDIKGPTSSQVY
gi|269925438|ref|YP_003322061.1|   -KIPV..REE..........................DGKLYGRGA......VDAKGPMAAFVC
gi|269926083|ref|YP_003322706.1|   ELRPF..TIK..........................GEYAYGPGV......ADMKSGLLLGIY
gi|269838949|ref|YP_003323641.1|   -----..-PD..........................RRRLPIPGA......NDGASGVAVLLE
gi|269926500|ref|YP_003323123.1|   DLGSY..ACDpgalrerllsrreqlddivyehlraeSDWLFGRGT......VDMKAGIAAHLW
TLn_gi|427723016|ref|YP_007070293.1| -----..---..........................---------......----GGAAATFG
TLn_gi|427722057|ref|YP_007069334.1| EVDYC..SQH..........................DGVMHACG-......HD--GHVAIALG
TLn_gi|427722694|ref|YP_007069971.1| EMEFA..SGT..........................PGVMHACG-......HD--VHTTVGLG
TLn_gi|427723545|ref|YP_007070822.1| -----..---..........................---------......------------
TLn_gi|427726210|ref|YP_007073487.1| RKAPF..RL-..........................KDYI-GSYT......LDNKASVVILIE
TLn_gi|427724197|ref|YP_007071474.1| -----..---..........................-----CPGA......DDNGTGLAVLLE
TLn_gi|427725916|ref|YP_007073193.1| -----..---..........................---------......------------
TLn_gi|427723370|ref|YP_007070647.1| -----..---..........................---------......------------
TLn_gi|427724429|ref|YP_007071706.1| -----..---..........................---------......------------
Cy2_gi|428218721|ref|YP_007103186.1| -----..---..........................---------......----GGAGATLG
Cy2_gi|428217331|ref|YP_007101796.1| IVAYR..SQI..........................DGLMHACG-......HD--GHTAIALG
Cy2_gi|428218965|ref|YP_007103430.1| -----..---..........................---------......------------
Cy2_gi|428218329|ref|YP_007102794.1| -----..---..........................---------......------------
Cy2_gi|428218498|ref|YP_007102963.1| -----..---..........................-----SPGA......DDNATGVAVLLE
Cy2_gi|428218676|ref|YP_007103141.1| RKQPF..RLS..........................EDYVAS-YT......LDNKASLAILLT
Cy2_gi|428218275|ref|YP_007102740.1| -----..---..........................---------......------------
Cy2_gi|428217320|ref|YP_007101785.1| -----..---..........................---------......------------
Cy2_gi|428217360|ref|YP_007101825.1| -----..---..........................---------......------------
Cy2_gi|428217620|ref|YP_007102085.1| -----..---..........................---------......------------
gi|158336127|ref|YP_001517301.1|   -----..---..........................---------......-DM-AGSGATLG
gi|158335082|ref|YP_001516254.1|   TVSYR..SRH..........................DGVMHACG-......HD--GHTAIALG
gi|158334581|ref|YP_001515753.1|   QLEFA..SRK..........................QGVMHACG-......HD--IHTTIGLG
gi|158339037|ref|YP_001520214.1|   -----..---..........................---------......------------
gi|158335668|ref|YP_001516840.1|   -----..---..........................---------......------------
gi|158335292|ref|YP_001516464.1|   -----..---..........................---------......------------
gi|158338092|ref|YP_001519268.1|   -----..---..........................-----SPGA......DDNATGVAVLLE
gi|158337208|ref|YP_001518383.1|   -----..---..........................-----SPGS......DDNATGVVVALE
gi|158338413|ref|YP_001519590.1|   -----..---..........................---------......------------
gi|158336876|ref|YP_001518051.1|   -----..---..........................---------......------------
gi|16330631|ref|NP_441359.1|       -----..---..........................---------......MDMGGGGA-TLG
gi|16332230|ref|NP_442958.1|       EVDYR..SLH..........................PGKMHACG-......HD--GHTAIALG
gi|16331842|ref|NP_442570.1|       SLPFA..SRH..........................PGVMHACG-......HD--IHTTLGLG
gi|16329830|ref|NP_440558.1|       -----..---..........................---------......------------
gi|16330558|ref|NP_441286.1|       -----..---..........................---------......------------
gi|16330376|ref|NP_441104.1|       -----..---..........................---------......------------
gi|16329723|ref|NP_440451.1|       -----..---..........................---------......------------
gi|16330213|ref|NP_440941.1|       -----..---..........................---------......------------
toq_gi|571027785|ref|YP_008899903.1| -----..---..........................---------......----GGAAAVLG
toq_gi|571026933|ref|YP_008899051.1| DKPYR..SLH..........................EGKMHACG-......HD--GHTAIALG
toq_gi|571028537|ref|YP_008900657.1| GLEFS..SKH..........................TGVMHACG-......HD--VHTTVGLG
toq_gi|571027463|ref|YP_008899581.1| -----..---..........................---------......------------
toq_gi|571027813|ref|YP_008899931.1| -----..---..........................---------......------------
gi|22299288|ref|NP_682535.1|       -----..---..........................---------......----GGAAAVLG
gi|22299990|ref|NP_683237.1|       NKPYR..SLH..........................EGKMHACG-......HD--GHTAIALG
gi|22297557|ref|NP_680804.1|       GLEFS..SKH..........................AGVMHACG-......HD--VHTTVGLG
gi|22297795|ref|NP_681042.1|       -----..---..........................---------......------------
gi|22299317|ref|NP_682564.1|       -----..---..........................---------......------------
fN9_gi|428220463|ref|YP_007104633.1| -----..---..........................---------......----GGAAAMLG
fN9_gi|428222328|ref|YP_007106498.1| IISYR..SQI..........................DGLMHACG-......HD--GHVAIALG
fN9_gi|428221241|ref|YP_007105411.1| -----..---..........................-----G-GL......YDGAYGVLAAIE
fN9_gi|428222603|ref|YP_007106773.1| -----..---..........................---------......----VVLAIALK
fN9_gi|428221486|ref|YP_007105656.1| -----..---..........................-----CPGA......NDNGSGAVGVLE
fN9_gi|428221848|ref|YP_007106018.1| -----..---..........................---------......------------
fN9_gi|428221485|ref|YP_007105655.1| -----..---..........................---------......------------
qVl_gi|427712524|ref|YP_007061148.1| -----..---..........................---------......----AGSAAVLG
qVl_gi|427712396|ref|YP_007061020.1| QVPYR..SSH..........................DGVMHACG-......HD--GHTTIALG
qVl_gi|427714252|ref|YP_007062876.1| NLDFA..SQR..........................PGVMHACG-......HD--VHTTVGLG
qVl_gi|427711704|ref|YP_007060328.1| -----..---..........................---------......------------
qVl_gi|427711553|ref|YP_007060177.1| -----..---..........................---------......------------
qVl_gi|427714522|ref|YP_007063146.1| -----..---..........................---------......------------
qVl_gi|427713716|ref|YP_007062340.1| -----..---..........................---------......------------
gi|113954246|ref|YP_731406.1|      -----..---..........................---------......------------
gi|113955421|ref|YP_729363.1|      GLPYA..SLR..........................QGVMHACG-......HD--LHSCIGLG
gi|113954748|ref|YP_731585.1|      -----..---..........................---------......------------
gi|113954650|ref|YP_730754.1|      -----..---..........................---------......------------
gi|81299999|ref|YP_400207.1|       -----..---..........................---------......------------
gi|81299067|ref|YP_399275.1|       EIPYR..SEI..........................DGRMHACG-......HD--GHVAIALG
gi|81300780|ref|YP_400988.1|       GLPFA..SRQ..........................QGIMHACG-......HD--LHTTLGLG
gi|81300390|ref|YP_400598.1|       -----..---..........................---------......------------
gi|81301169|ref|YP_401377.1|       -----..---..........................---------......------------
gi|81300943|ref|YP_401151.1|       -----..---..........................---------......------------
gi|81299525|ref|YP_399733.1|       -----..---..........................---------......------------
gi|81301079|ref|YP_401287.1|       SRDRKrpQRL..........................GQHIAGYA-......LDNKASLAILLD
gi|81300779|ref|YP_400987.1|       -----..---..........................---------......------------
gi|123966726|ref|YP_001011807.1|   -----..---..........................---------......----GGSASVLG
gi|123967035|ref|YP_001012116.1|   NLSFS..SKI..........................DGVMHACG-......HD--IHTCIGLG
gi|123965487|ref|YP_001010568.1|   -----..---..........................---------......------------
gi|123965916|ref|YP_001010997.1|   -----..---..........................---------......------------
JuK_gi|428313309|ref|YP_007124286.1| -----..---..........................---------......----GGAAATLG
JuK_gi|428311057|ref|YP_007122034.1| DVPYR..SQH..........................DGIMHACG-......HD--GHTAIALG
JuK_gi|428309062|ref|YP_007120039.1| CLEFA..SRK..........................PGIMHACG-......HD--VHTTVGLG
JuK_gi|428312940|ref|YP_007123917.1| -----..---..........................---------......------------
JuK_gi|428309925|ref|YP_007120902.1| -----..---..........................---------......------------
JuK_gi|428310093|ref|YP_007121070.1| -----..---..........................-----SPGA......NDNGTGAVATLE
JuK_gi|428313512|ref|YP_007124489.1| -----..---..........................---------......------------
JuK_gi|428309552|ref|YP_007120529.1| -----..---..........................---------......------------
JuK_gi|428313083|ref|YP_007124060.1| -----..---..........................---------......------------
JuK_gi|428310554|ref|YP_007121531.1| -----..--Rvgtrmvigkhrkrpirl.........KDYMAS-YT......LDNKASVAILLA
JuK_gi|428310231|ref|YP_007121208.1| -----..---..........................---------......------------
JuK_gi|428312499|ref|YP_007123476.1| -----..---..........................---------......------------
JuK_gi|428313236|ref|YP_007124213.1| -----..---..........................---------......------------
JuK_gi|428313477|ref|YP_007124454.1| -----..---..........................---------......------------
JuK_gi|428311704|ref|YP_007122681.1| -----..---..........................---------......------------
gi|113473990|ref|YP_720051.1|      -----..---..........................---------......----G-------
gi|113475511|ref|YP_721572.1|      DVPYR..SIH..........................NGVMHACG-......HD--GHTAIALG
gi|113477163|ref|YP_723224.1|      NLDFA..SRN..........................TGVMHACG-......HD--IHTTVGLG
gi|113478073|ref|YP_724134.1|      -----..---..........................---------......------------
gi|113476499|ref|YP_722560.1|      -----..---..........................---------......------------
gi|113474224|ref|YP_720285.1|      -----..---..........................---------......------------
gi|113477463|ref|YP_723524.1|      -----..---..........................---------......------------
gi|113476944|ref|YP_723005.1|      -----..---..........................---------......------------
gi|113474394|ref|YP_720455.1|      -----..---..........................---------......------------
HFg_gi|428224156|ref|YP_007108253.1| -----..---..........................---------......-DM-GGAAATLG
HFg_gi|428226397|ref|YP_007110494.1| EVPYR..SQH..........................DGVMHACG-......HD--GHTAIALG
HFg_gi|428224388|ref|YP_007108485.1| NLEFA..SRK..........................PGIMHACG-......HD--IHTTVGLG
HFg_gi|428223916|ref|YP_007108013.1| -----..---..........................---------......------------
HFg_gi|428226743|ref|YP_007110840.1| -----..---..........................---------......------------
HFg_gi|428224382|ref|YP_007108479.1| -----..---..........................---------......------------
HFg_gi|428223590|ref|YP_007107687.1| -----..--Avigkhrkrpfrl..............QDYIAS-YT......LDNKASIAILLA
HFg_gi|428224655|ref|YP_007108752.1| -----..---..........................-----SPAA......DDNATGVAALLE
HFg_gi|428226160|ref|YP_007110257.1| -----..---..........................---------......------------
HFg_gi|428226051|ref|YP_007110148.1| -----..---..........................-----SPGS......DDNATGLAVLLE
HFg_gi|428224780|ref|YP_007108877.1| -----..---..........................---------......------------
gi|257061661|ref|YP_003139549.1|   -----..---..........................---------......-DMG-GGAATLG
gi|257062162|ref|YP_003140050.1|   EVPYC..SRH..........................DGIMHACG-......HD--GHTAIALG
gi|257059081|ref|YP_003136969.1|   NLDFA..SCK..........................PGIMHACG-......HD--VHTTVGLG
gi|257058278|ref|YP_003136166.1|   -----..---..........................---------......------------
gi|257060857|ref|YP_003138745.1|   -----..---..........................---------......------------
gi|257061491|ref|YP_003139379.1|   -----..---..........................---------......------------
gi|257058498|ref|YP_003136386.1|   -----..---..........................---------......------------
gi|257060846|ref|YP_003138734.1|   -----..---..........................---------......------------
gi|257057955|ref|YP_003135843.1|   ETMPL..VRH..........................QDKLYGPGV......YDMKGGLVQGIF
5BT_gi|434391707|ref|YP_007126654.1| -----..---..........................---------......-----GAGATLG
5BT_gi|434395368|ref|YP_007130315.1| DVPYR..SQH..........................DGVMHACG-......HD--GHTAIALG
5BT_gi|434393016|ref|YP_007127963.1| GLEYA..SRT..........................PGIMHACG-......HD--VHTTVGLG
5BT_gi|434392062|ref|YP_007127009.1| -----..---..........................-----A-GK......FDGVLGVLAGIE
5BT_gi|434395507|ref|YP_007130454.1| GLPYAs.TKRaempdgse..................RPVMHACG-......HD--AHTVWMLG
5BT_gi|434391636|ref|YP_007126583.1| -----..---..........................---------......------------
5BT_gi|434395491|ref|YP_007130438.1| -----..---..........................-----SPGA......NDNASGTAVVLD
5BT_gi|434391354|ref|YP_007126301.1| -----..---..........................-----TPGA......DDNATGVAVLLE
5BT_gi|434391607|ref|YP_007126554.1| -----..---..........................---------......------------
5BT_gi|434395336|ref|YP_007130283.1| -----..-RI..........................KDHI-ASYT......LDNKASVAILLA
5BT_gi|434391236|ref|YP_007126183.1| -----..---..........................---------......------------
5BT_gi|434391792|ref|YP_007126739.1| -----..---..........................---------......------------
5BT_gi|434395419|ref|YP_007130366.1| -----..---..........................---------......------------
gi|284929626|ref|YP_003422148.1|   -----..---..........................---------......-DMG-GGAATLG
gi|284928900|ref|YP_003421422.1|   KLNFS..SYN..........................SGVMHACG-......HD--VHTTVGIG
gi|284929040|ref|YP_003421562.1|   -----..---..........................---------......------------
8V2_gi|428775164|ref|YP_007166951.1| -----..---..........................---------......------------
8V2_gi|428777931|ref|YP_007169718.1| DVPYR..SQH..........................DGIMHACG-......HD--GHTAIALG
8V2_gi|428776138|ref|YP_007167925.1| -----..---..........................---------......------------
8V2_gi|428777938|ref|YP_007169725.1| -----..---..........................---------......------------
8V2_gi|428777493|ref|YP_007169280.1| -----..---..........................-----TPGA......DDNGTGVAVLLE
8V2_gi|428778337|ref|YP_007170124.1| RKQPF..RLN..........................EDYIAS-YT......LDNKASLAILLD
8V2_gi|428777769|ref|YP_007169556.1| -----..---..........................---------......------------
8V2_gi|428775818|ref|YP_007167605.1| -----..---..........................---------......------------
gi|166368941|ref|YP_001661214.1|   -----..---..........................---------......MDMGGG-AATLG
gi|166365183|ref|YP_001657456.1|   QVPYR..SQH..........................PGQMHACG-......HD--GHTAIALG
gi|166366573|ref|YP_001658846.1|   DLDFA..SRK..........................PGIMHACG-......HD--VHATVGLG
gi|166362930|ref|YP_001655203.1|   -----..---..........................---------......------------
gi|166364322|ref|YP_001656595.1|   -----..---..........................---------......------------
gi|166368299|ref|YP_001660572.1|   -----..---..........................---------......------------
gi|166366765|ref|YP_001659038.1|   -----..---..........................-----SPGA......DDNATGLAVLLE
gi|166368835|ref|YP_001661108.1|   -----..---..........................---------......------------
gi|166366493|ref|YP_001658766.1|   -----..LRL..........................KDYIAS-YT......LDNKASVAILLA
gi|166363064|ref|YP_001655337.1|   -----..---..........................---------......------------
gi|166366413|ref|YP_001658686.1|   -----..---..........................---------......------------
gi|37522180|ref|NP_925557.1|       -----..---..........................---------......----GGAAAALG
gi|37519943|ref|NP_923320.1|       RVEYA..SEN..........................TGIMHACG-......HD--GHVAIALG
gi|37522109|ref|NP_925486.1|       ELPYR..SQV..........................RGVMHACG-......HD--LHTAIGLG
gi|37520936|ref|NP_924313.1|       -----..---..........................-------GA......HDPISGTVALME
gi|37523992|ref|NP_927369.1|       -----..-IG..........................GDRIY-NGA......MDNAAGVATLID
gi|37520534|ref|NP_923911.1|       -----..---..........................---------......------------
gi|37520091|ref|NP_923468.1|       -----..---..........................---------......------------
gi|37522227|ref|NP_925604.1|       -----..---..........................-----APGA......NDNASGSAVLLE
gi|37522043|ref|NP_925420.1|       -----..---..........................---------......------------
gi|37523548|ref|NP_926925.1|       -----..---..........................---------......------------
gi|37523547|ref|NP_926924.1|       -----..---..........................---------......------------
gi|37520329|ref|NP_923706.1|       -----..---..........................---------......------------
gi|37520932|ref|NP_924309.1|       -----..---..........................---------......------------
ADw_gi|427733727|ref|YP_007053271.1| -----..---..........................---------......-DM-GGAAATLG
ADw_gi|427739887|ref|YP_007059431.1| EVSYK..SQH..........................DGIMHACG-......HD--GHTAIALG
ADw_gi|427738968|ref|YP_007058512.1| PLDYA..SRN..........................QGIMHACG-......HD--VHTTVGLG
ADw_gi|427737605|ref|YP_007057149.1| -----..---..........................---------......------------
ADw_gi|427737907|ref|YP_007057451.1| -----..---..........................---------......------------
ADw_gi|427736327|ref|YP_007055871.1| -----..---..........................---------......------------
ADw_gi|427735146|ref|YP_007054690.1| -----..---..........................---------......------------
ADw_gi|427735148|ref|YP_007054692.1| -----..---..........................---------......------------
ADw_gi|427734182|ref|YP_007053726.1| -----..---..........................-----SPGA......NDNGSGVAAVLE
ADw_gi|427738036|ref|YP_007057580.1| -----..---..........................-----SPGA......DDNATGVAVLLE
ADw_gi|427737291|ref|YP_007056835.1| -----..---..........................---------......------------
ADw_gi|427733824|ref|YP_007053368.1| ---PI..-RL..........................KDHIA-SYT......LDNKASVAILLA
ADw_gi|427734438|ref|YP_007053982.1| -----..---..........................-----TPAA......DDNASGVAVLLE
ADw_gi|427737664|ref|YP_007057208.1| -----..---..........................---------......------------
ADw_gi|427735400|ref|YP_007054944.1| -----..---..........................---------......------------
ADw_gi|427736713|ref|YP_007056257.1| -----..---..........................---------......------------
ADw_gi|427735785|ref|YP_007055329.1| -----..---..........................---------......------------
ADw_gi|427733974|ref|YP_007053518.1| -----..---..........................--------AchpslcNDNLSGISIAVF
ADw_gi|427735097|ref|YP_007054641.1| -----..---..........................---------......------------
ADw_gi|427734372|ref|YP_007053916.1| -----..---..........................---------......------------
ADw_gi|427738248|ref|YP_007057792.1| -----..---..........................---------......------------
rbN_gi|427718504|ref|YP_007066498.1| -----..---..........................---------......--M-GGAAATLG
rbN_gi|427717245|ref|YP_007065239.1| EVEYR..SQR..........................DGLMHACG-......HD--GHTAIALG
rbN_gi|427716398|ref|YP_007064392.1| GLEYA..SRA..........................KGVMHACG-......HD--VHTTVGLG
rbN_gi|427716007|ref|YP_007064001.1| -----..---..........................---------......------------
rbN_gi|427716207|ref|YP_007064201.1| -----..---..........................---------......------------
rbN_gi|427716208|ref|YP_007064202.1| -----..---..........................---------......------------
rbN_gi|427720501|ref|YP_007068495.1| -----..---..........................---------......------------
rbN_gi|427720149|ref|YP_007068143.1| -----..---..........................-----SPGA......DDNASGVAVVLE
rbN_gi|427717825|ref|YP_007065819.1| -----..---..........................-----TPGA......DDNATGVAVLLE
rbN_gi|427716163|ref|YP_007064157.1| ---PI..RL-..........................KDHIA-SYT......LDNKASVAILLA
rbN_gi|427716185|ref|YP_007064179.1| -----..---..........................---------......------------
rbN_gi|427715920|ref|YP_007063914.1| -----..---..........................---------......------------
gi|75908939|ref|YP_323235.1|       -----..---..........................---------......--M-GGAAATLG
gi|75908435|ref|YP_322731.1|       EVPYC..SQH..........................NGVMHACG-......HD--GHTAIALG
gi|75907282|ref|YP_321578.1|       GLEYA..SRA..........................DGVMHACG-......HD--IHTTVGLG
gi|75910294|ref|YP_324590.1|       GLPFA..SLH..........................PGKMHACG-......HD--GHMAMVLG
gi|75908006|ref|YP_322302.1|       -----..---..........................---------......------------
gi|75907687|ref|YP_321983.1|       -----..---..........................---------......------------
gi|75907688|ref|YP_321984.1|       -----..---..........................---------......------------
gi|75908485|ref|YP_322781.1|       -----..---..........................---------......------------
gi|75908181|ref|YP_322477.1|       -----..---..........................-----SPGA......DDNASGVAVILE
gi|75907143|ref|YP_321439.1|       -----..---..........................-----TSGA......DDNATGVVVLLE
gi|75909389|ref|YP_323685.1|       -----..---..........................QDHI-ASYT......LDNKASVAILLA
gi|75910593|ref|YP_324889.1|       -----..---..........................---------......------------
gi|75909995|ref|YP_324291.1|       -----..---..........................---------......------------
gi|298491029|ref|YP_003721206.1|   -----..---..........................---------......----GGAAATLG
gi|298492645|ref|YP_003722822.1|   EVSYC..SQH..........................DGVMHACG-......HD--GHTAIAMG
gi|298490648|ref|YP_003720825.1|   GLEYA..SRN..........................MGVMHACG-......HD--AHTTIGLG
gi|298491800|ref|YP_003721977.1|   -----..---..........................---------......------------
gi|298490223|ref|YP_003720400.1|   -----..---..........................---------......------------
gi|298490222|ref|YP_003720399.1|   -----..---..........................---------......------------
gi|298492458|ref|YP_003722635.1|   -----..---..........................---------......------------
gi|298492145|ref|YP_003722322.1|   -----..---..........................---------......------------
gi|298492188|ref|YP_003722365.1|   -----..---..........................---------......------------
gi|298491532|ref|YP_003721709.1|   -----..---..........................-----SPG-......------------


                                      130          140       150                      160           
                                        |            |         |                        |           
d1cg2a1                              TLKLLKEY...GVRDYGTITVLFNTDEEK.....G.....S.....FGSRDLIQEE.......
gi|269926470|ref|YP_003323093.1|   AMIAISKI...K--PKVNVVGVLCLAENM.....P.....S.....GSAMRPGDVIkag....
gi|269926320|ref|YP_003322943.1|   AL---KRA...S--PNVKVYAVASVQEEV.....G.....L.....RGARTSAYGInpsi...
gi|269925335|ref|YP_003321958.1|   AVQSLLEE...YGKLPVNLKFIIEGEEEI.....G.....S.....PSLDEFLVQNkd.....
gi|269925376|ref|YP_003321999.1|   APFLAREA...GLPIYGDVYVVGVVQEEV.....G.....G.....LGSIELGKS-.......
gi|269925438|ref|YP_003322061.1|   AAIQAKRQ...DG-VNATLKVVGAVGEEG.....D.....S.....RGARYLVKN-.......
gi|269926083|ref|YP_003322706.1|   TLRLCKHI...VKKLDREVVMVLNSDEEV.....G.....S.....PFSAEIIRNE.......
gi|269838949|ref|YP_003323641.1|   IAHALQVL...R--PPIRVSFALFDGEDW.....GpdeasMy....LGSRHYASTLp......
gi|269926500|ref|YP_003323123.1|   ALSEFCKEklqGKELPGSIIFLSVPDEEA.....E.....S.....IGIMGAVEWLstlaeke
TLn_gi|427723016|ref|YP_007070293.1| AAKAIAQL...K--PDVEVHFISAATENMisgs.G.....L.....RPGDILTAS-.......
TLn_gi|427722057|ref|YP_007069334.1| TAKYLSEN...RDSFNGTVKIIFQPAEES.....P.....-.....GGAKPMIEEGvlk....
TLn_gi|427722694|ref|YP_007069971.1| TAMVLSEL...QEAIASNIRFLFQPAEEI.....A.....-.....LGARWMVEAGa......
TLn_gi|427723545|ref|YP_007070822.1| --------...------------------.....-.....-.....----------.......
TLn_gi|427726210|ref|YP_007073487.1| LAKRLQQK...N--PPQDVYLVASAKEEV.....G.....A.....LGALYFSQN-.......
TLn_gi|427724197|ref|YP_007071474.1| MANFFSQN...P--ARYPIRLVAFDLEEF.....G.....L.....CGSLEYAAHLkkn....
TLn_gi|427725916|ref|YP_007073193.1| --------...------------------.....-.....-.....----------.......
TLn_gi|427723370|ref|YP_007070647.1| --------...------------------.....-.....-.....-------G--.......
TLn_gi|427724429|ref|YP_007071706.1| --------...------------------.....-.....-.....----------.......
Cy2_gi|428218721|ref|YP_007103186.1| AAKAIAQI...KP-QDIEIHFIVAACE--.....-.....-.....----------.......
Cy2_gi|428217331|ref|YP_007101796.1| TAYYLWQH...RDCFVGTVKIIFQPAEES.....P.....-.....GGAKPMIEAGvle....
Cy2_gi|428218965|ref|YP_007103430.1| --------...------------------.....-.....-.....----------.......
Cy2_gi|428218329|ref|YP_007102794.1| --------...------------------.....-.....-.....----------.......
Cy2_gi|428218498|ref|YP_007102963.1| LARSLNFN...P--AHRPVRLVAFDMEEY.....A.....L.....AGSRAYAAELaqq....
Cy2_gi|428218676|ref|YP_007103141.1| LAEVIGQT...NGQPKTDVYLLASANEEV.....G.....A.....IGAMYFSNQ-.......
Cy2_gi|428218275|ref|YP_007102740.1| --------...---QGATVYLTRNGDEDL.....F.....P.....ADRVAMIEQLepai...
Cy2_gi|428217320|ref|YP_007101785.1| --------...------------------.....-.....-.....----------.......
Cy2_gi|428217360|ref|YP_007101825.1| --------...------------------.....-.....-.....----------.......
Cy2_gi|428217620|ref|YP_007102085.1| --------...------------------.....-.....-.....----------.......
gi|158336127|ref|YP_001517301.1|   AAKAIGQL...K--PDVEVHFIVAAAENM.....I.....S.....GHALHPGDILtas....
gi|158335082|ref|YP_001516254.1|   TARYLSQH...RQDFAGTVKIIFQPAEES.....P.....-.....GGAKPMIEAGvlq....
gi|158334581|ref|YP_001515753.1|   TAMVLSAM...QDEIPGKLRFLFQPAEEI.....A.....-.....QGAGWMVADGa......
gi|158339037|ref|YP_001520214.1|   --------...--------Y---------.....-.....-.....----------.......
gi|158335668|ref|YP_001516840.1|   --------...------------------.....-.....-.....----------.......
gi|158335292|ref|YP_001516464.1|   --------...------------------.....-.....-.....----------.......
gi|158338092|ref|YP_001519268.1|   LAQHFHHH...P--ARHPIHIIGFDLEEY.....G.....R.....LGSQAYAQELrqt....
gi|158337208|ref|YP_001518383.1|   VARLLGDR...K--TIRPLRIVLFDQEEA.....G.....L.....VGSYAYAQRPen.....
gi|158338413|ref|YP_001519590.1|   --------...------------------.....-.....-.....----------.......
gi|158336876|ref|YP_001518051.1|   --------...------------------.....-.....-.....----------.......
gi|16330631|ref|NP_441359.1|       AAKAIAQL...K--PNVEIHFICAATE--.....-.....-.....----------.......
gi|16332230|ref|NP_442958.1|       TAQYLAAH...RDSFRGQVKFFFQPAEEG.....P.....-.....GGAKPMIEAGvle....
gi|16331842|ref|NP_442570.1|       TAMVLSQM...GHRLPGDVRFLFQPAEEI.....A.....-.....QGASWMIQDGa......
gi|16329830|ref|NP_440558.1|       --------...------------------.....-.....-.....----------.......
gi|16330558|ref|NP_441286.1|       --------...------------------.....-.....-.....----------.......
gi|16330376|ref|NP_441104.1|       --------...------------------.....-.....-.....----------.......
gi|16329723|ref|NP_440451.1|       --------...------------------.....-.....-.....----------.......
gi|16330213|ref|NP_440941.1|       --------...------------------.....-.....-.....----------.......
toq_gi|571027785|ref|YP_008899903.1| TAKVIGQL...KP-AGIEVHFIIAATENM.....I.....S.....GRALHPGDILtas....
toq_gi|571026933|ref|YP_008899051.1| TAKYLATH...RD-FAGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvld....
toq_gi|571028537|ref|YP_008900657.1| TAMVLAAL...KEEFPGRVRFIFQPAEEI.....A.....-.....QGASWMIADGa......
toq_gi|571027463|ref|YP_008899581.1| --------...------------------.....-.....-.....----------.......
toq_gi|571027813|ref|YP_008899931.1| --------...------------------.....-.....-.....----------.......
gi|22299288|ref|NP_682535.1|       TAKVLGQL...KP-PGIEVHFIIAATENM.....I.....S.....GRALHPGDILtas....
gi|22299990|ref|NP_683237.1|       TAKYLATH...RD-FAGMVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvld....
gi|22297557|ref|NP_680804.1|       TAMVLAAL...KEEFPGRVRFIFQPAEEI.....A.....-.....QGASWMIADGa......
gi|22297795|ref|NP_681042.1|       --------...------------------.....-.....-.....----------.......
gi|22299317|ref|NP_682564.1|       --------...------------------.....-.....-.....----------.......
fN9_gi|428220463|ref|YP_007104633.1| AAKAIAQI...QP-DGIEVHFISAVCE--.....-.....-.....----------.......
fN9_gi|428222328|ref|YP_007106498.1| TAYYLWQH...RSKLKGTVKIIFQPAEEG.....P.....-.....GGAMPMIEAGv......
fN9_gi|428221241|ref|YP_007105411.1| VVRSLQES...SVQLNHPLEVIVFTDEEG.....S.....M.....IGCKAMAGSL.......
fN9_gi|428222603|ref|YP_007106773.1| LGRILQEM...GY----TVIYTRTDNTE-.....-.....-.....----------.......
fN9_gi|428221486|ref|YP_007105656.1| LARLFSKKlisGSSPKKTLRFVQFVNEEPpfyhtE.....M.....MGSLVYAKACkqr....
fN9_gi|428221848|ref|YP_007106018.1| --------...------------------.....-.....-.....----------.......
fN9_gi|428221485|ref|YP_007105655.1| --------...------------------.....-.....-.....----------.......
qVl_gi|427712524|ref|YP_007061148.1| AAQVIAQL...K--PSAEVHFIVAATENM.....-.....-.....----------.......
qVl_gi|427712396|ref|YP_007061020.1| TARYLSQH...PD-FAGTVKIIFQPAEEG.....P.....-.....GGAKPMIQAGvle....
qVl_gi|427714252|ref|YP_007062876.1| TAMVLAQL...QDHLPGKLRFIFQPAEEI.....A.....-.....QGAAWMIGAGa......
qVl_gi|427711704|ref|YP_007060328.1| --------...------------------.....-.....-.....----------.......
qVl_gi|427711553|ref|YP_007060177.1| --------...------------------.....-.....-.....----------.......
qVl_gi|427714522|ref|YP_007063146.1| --------...------------------.....-.....-.....----------.......
qVl_gi|427713716|ref|YP_007062340.1| --------...------------------.....-.....-.....----------.......
gi|113954246|ref|YP_731406.1|      --------...------------------.....-.....-.....----------.......
gi|113955421|ref|YP_729363.1|      VARLLAQE...AS-LPVGMRLLFQPAEEL.....A.....-.....QGARWMRADGa......
gi|113954748|ref|YP_731585.1|      --------...------------------.....-.....-.....-G--------.......
gi|113954650|ref|YP_730754.1|      --------...------------------.....-.....-.....----------.......
gi|81299999|ref|YP_400207.1|       --------...------------------.....-.....-.....----------.......
gi|81299067|ref|YP_399275.1|       TAACLQAN...SD-FAGRVKIIFQPAEEG.....P.....-.....GGAAPMIAEGvle....
gi|81300780|ref|YP_400988.1|       AAMVLSEL...GEPLPGDVRWLFQPAEEI.....A.....-.....QGARWMVAAEa......
gi|81300390|ref|YP_400598.1|       --------...------------------.....-.....-.....----------.......
gi|81301169|ref|YP_401377.1|       --------...------------------.....-.....-.....----------.......
gi|81300943|ref|YP_401151.1|       --------...------------------.....-.....-.....----------.......
gi|81299525|ref|YP_399733.1|       --------...------------------.....-.....-.....----------.......
gi|81301079|ref|YP_401287.1|       LAAQLKR-...---PRYTVHLIASAKEEV.....G.....A.....VGALFHSQR-.......
gi|81300779|ref|YP_400987.1|       --------...------------------.....-.....-.....----------.......
gi|123966726|ref|YP_001011807.1|   AAKALGAI...KP-DGLEIHFI-------.....-.....-.....----------.......
gi|123967035|ref|YP_001012116.1|   VAKIIKDL...K--LKFGIRLIFQPAEEI.....A.....-.....SGARWMIEDGv......
gi|123965487|ref|YP_001010568.1|   --------...------------------.....-.....-.....----------.......
gi|123965916|ref|YP_001010997.1|   --------...------------------.....-.....-.....----------.......
JuK_gi|428313309|ref|YP_007124286.1| AAKAIGHL...K--PDVEVHFISAATEN-.....-.....-.....----------.......
JuK_gi|428311057|ref|YP_007122034.1| TAYYLAHH...REDFTGTVKIIFQPAEEG.....P.....-.....GGAKPMIEEGvlk....
JuK_gi|428309062|ref|YP_007120039.1| TAMVLSQL...GEMLPGNTRFLFQPAEEI.....A.....-.....QGANWMVQDGa......
JuK_gi|428312940|ref|YP_007123917.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428309925|ref|YP_007120902.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428310093|ref|YP_007121070.1| LARLFADK...K--PSRTLRFVEFVNEEP.....P.....FfwtenMGSFVYAKRCkdr....
JuK_gi|428313512|ref|YP_007124489.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428309552|ref|YP_007120529.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428313083|ref|YP_007124060.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428310554|ref|YP_007121531.1| LAQQLKT-...---PSVDTYLVASAKEEV.....G.....A.....IGALYFTQN-.......
JuK_gi|428310231|ref|YP_007121208.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428312499|ref|YP_007123476.1| --------...------------------.....-.....-.....---NYLIDIHsss....
JuK_gi|428313236|ref|YP_007124213.1| --------...------------------.....-.....-.....----------.......
JuK_gi|428313477|ref|YP_007124454.1| --------...------------TAAEEM.....I.....-.....LTRNALVKELq......
JuK_gi|428311704|ref|YP_007122681.1| --------...------------------.....-.....-.....----------.......
gi|113473990|ref|YP_720051.1|      --------...------------------.....-.....-.....----------.......
gi|113475511|ref|YP_721572.1|      TAHYLATH...PENFSGIVKIIFQPAEEG.....P.....-.....GGSKPMIEAGvlk....
gi|113477163|ref|YP_723224.1|      TAMVLSEL...GELLPGDVRFLFQPAEEI.....S.....-.....QGANWMIKDGv......
gi|113478073|ref|YP_724134.1|      --------...------------------.....-.....-.....---------Lgpkg...
gi|113476499|ref|YP_722560.1|      --------...------------------.....-.....-.....----------.......
gi|113474224|ref|YP_720285.1|      --------...------------------.....-.....-.....----------.......
gi|113477463|ref|YP_723524.1|      --------...------------------.....-.....-.....----------.......
gi|113476944|ref|YP_723005.1|      --------...------------------.....-.....-.....----------.......
gi|113474394|ref|YP_720455.1|      --RRVNAS...N--VDLNRNFLFSSDEYT.....G.....S.....PDIYSKINS-.......
HFg_gi|428224156|ref|YP_007108253.1| AAKAVGQL...K--PDTEVHFIVAATE--.....-.....-.....----------.......
HFg_gi|428226397|ref|YP_007110494.1| LAHYLTHH...RDRFQGTVKLIFQPAEEG.....P.....-.....GGAKPMIEAGalq....
HFg_gi|428224388|ref|YP_007108485.1| TAMILAQI...ADDLPGSHRFLFQPAEET.....A.....-.....QGARWMIEDNv......
HFg_gi|428223916|ref|YP_007108013.1| --------...------------------.....-.....-.....----------.......
HFg_gi|428226743|ref|YP_007110840.1| --------...------------------.....-.....-.....----------.......
HFg_gi|428224382|ref|YP_007108479.1| --------...------------------.....-.....-.....----------.......
HFg_gi|428223590|ref|YP_007107687.1| LAEILET-...---PAVDLYLVASAKEEV.....G.....A.....LGALFFSQR-.......
HFg_gi|428224655|ref|YP_007108752.1| IGRAIAHH...P--ARHPVRCVAFDLEEM.....G.....L.....VGSEQYATALrad....
HFg_gi|428226160|ref|YP_007110257.1| --------...------------------.....-.....-.....----------.......
HFg_gi|428226051|ref|YP_007110148.1| AARLLGDR...P--TVRGLKLAFFDLEEA.....G.....L.....RGSLAMAAEDgl.....
HFg_gi|428224780|ref|YP_007108877.1| --------...------------------.....-.....-.....----------.......
gi|257061661|ref|YP_003139549.1|   AAKVIGQL...K--PDVEVHFICAATE--.....-.....-.....----------.......
gi|257062162|ref|YP_003140050.1|   TADYLWRH...REAFRGTVKIIFQPAEES.....P.....-.....GGAKPMIEEGvlk....
gi|257059081|ref|YP_003136969.1|   TAMILAEL...AEHLPGNVRFLFQPAEEI.....A.....-.....QGASWMVQDGa......
gi|257058278|ref|YP_003136166.1|   --------...------------------.....-.....-.....----------.......
gi|257060857|ref|YP_003138745.1|   --------...------------------.....-.....-.....----------.......
gi|257061491|ref|YP_003139379.1|   --------...------------------.....-.....-.....----------.......
gi|257058498|ref|YP_003136386.1|   --------...------------------.....-.....-.....----------.......
gi|257060846|ref|YP_003138734.1|   --------...------------------.....-.....-.....----------.......
gi|257057955|ref|YP_003135843.1|   ALEALQAQ...DLTSSITPIFLINSDEEI.....G.....S.....QESTPHIQAL.......
5BT_gi|434391707|ref|YP_007126654.1| AAKAIAQL...K--PDVEVHFISAATENM.....I.....S.....GRAMHPGDILkas....
5BT_gi|434395368|ref|YP_007130315.1| TAYYLSQH...RDTFSGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
5BT_gi|434393016|ref|YP_007127963.1| TAMVLSRL...AEELPGNIRFLFQPAEEI.....A.....-.....QGANWMVADGv......
5BT_gi|434392062|ref|YP_007127009.1| VVHVLQEN...NIRLRHPIEVIVFTDEEN.....S.....V.....LGCKAMAGTA.......
5BT_gi|434395507|ref|YP_007130454.1| LAKAMVDL...KSNWKGTLILVGQPAEEG.....V.....-.....AGARAMVEDGlytrys.
5BT_gi|434391636|ref|YP_007126583.1| --------...------------------.....-.....-.....----------.......
5BT_gi|434395491|ref|YP_007130438.1| IARNVAQT...P--LAREAWFVVFDGEED.....G.....L.....HGSRAFVSQAqpdw...
5BT_gi|434391354|ref|YP_007126301.1| LARIFASN...P--AKHPLRLVAFDLEEY.....G.....Llgg..SGASEYAVHLrqq....
5BT_gi|434391607|ref|YP_007126554.1| --------...------------------.....-.....-.....----------.......
5BT_gi|434395336|ref|YP_007130283.1| LAEQVKQ-...---PVVDIYLVASAKEEV.....G.....A.....IGALYFSQR-.......
5BT_gi|434391236|ref|YP_007126183.1| --------...------------------.....-.....-.....----------.......
5BT_gi|434391792|ref|YP_007126739.1| TLQALLNL...N--HQRDLEGHFTTDTYL.....E.....C.....VAIRQWIER-.......
5BT_gi|434395419|ref|YP_007130366.1| --------...------------------.....-.....-.....----------.......
gi|284929626|ref|YP_003422148.1|   VAKAIAQL...K--PNIEVHFICAVTE--.....-.....-.....----------.......
gi|284928900|ref|YP_003421422.1|   TAVILSML...RKQLGGNIRFLFQPAEEI.....A.....-.....QGAKWMLQDGv......
gi|284929040|ref|YP_003421562.1|   --------...------------------.....-.....-.....----------.......
8V2_gi|428775164|ref|YP_007166951.1| --------...-------V----------.....-.....-.....----------.......
8V2_gi|428777931|ref|YP_007169718.1| TAYHLWQH...RQDITGTVKIIFQPAEES.....P.....-.....GGAKPMIEAGvlk....
8V2_gi|428776138|ref|YP_007167925.1| --------...------------------.....-.....-.....----------.......
8V2_gi|428777938|ref|YP_007169725.1| --------...------------------.....-.....-.....----------.......
8V2_gi|428777493|ref|YP_007169280.1| LMRVFSEN...P--LPIPLRFIAFDLEEY.....G.....M.....VGSEVYAQQLken....
8V2_gi|428778337|ref|YP_007170124.1| LAQQIQN-...---PPQDVYLIASAKEEI.....G.....A.....IGALYFTQN-.......
8V2_gi|428777769|ref|YP_007169556.1| --------...------------------.....-.....-.....----------.......
8V2_gi|428775818|ref|YP_007167605.1| --------...------------------.....-.....-.....----------.......
gi|166368941|ref|YP_001661214.1|   AAKAIAQL...Q--PEVEVHFICPATE--.....-.....-.....----------.......
gi|166365183|ref|YP_001657456.1|   TAVYIAQN...RHDVKGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
gi|166366573|ref|YP_001658846.1|   VAMVLSRL...SEPLQGKIRFLFQPAEEI.....A.....-.....QGANWMIREGv......
gi|166362930|ref|YP_001655203.1|   --------...------------------.....-.....-.....----------.......
gi|166364322|ref|YP_001656595.1|   --------...------------------.....-.....-.....----------.......
gi|166368299|ref|YP_001660572.1|   --------...------------------.....-.....-.....----------.......
gi|166366765|ref|YP_001659038.1|   LARFFGEN...Q--ANYPIRLIAFDLEEY.....G.....L.....LGSIAYAEKLkqt....
gi|166368835|ref|YP_001661108.1|   --------...------------------.....-.....-.....----------.......
gi|166366493|ref|YP_001658766.1|   LAARVIN-...---PAVDIYLVASAKEEV.....G.....A.....LGALFFTAN-.......
gi|166363064|ref|YP_001655337.1|   --------...------------------.....-.....-.....----------.......
gi|166366413|ref|YP_001658686.1|   --------...------------------.....-.....-.....----------.......
gi|37522180|ref|NP_925557.1|       AAKVLGQL...K--PDIEVHFIVAATEN-.....-.....-.....----------.......
gi|37519943|ref|NP_923320.1|       TARWLAEH...RDALPATVKILFQPAEEG.....P.....-.....GGAKPMIEAGala....
gi|37522109|ref|NP_925486.1|       TAMVLASL...RESLPGRVKFLFQPAEET.....A.....-.....QGARWMVDDGale....
gi|37520936|ref|NP_924313.1|       EARAIAALtksGWKPKRTIVYAHWDGEEP.....G.....L.....LGSTEWVETHadel...
gi|37523992|ref|NP_927369.1|       VAAGMRAQ...NLKLKRSVVFLAVCGEEK.....G.....L.....LGSKFFANRPt......
gi|37520534|ref|NP_923911.1|       --------...------------------.....-.....-.....----------.......
gi|37520091|ref|NP_923468.1|       --------...------------------.....-.....-.....----------.......
gi|37522227|ref|NP_925604.1|       SARRLAGT...P--LARRAWFVHFDAEEE.....G.....L.....VGSRHFVRSAsapl...
gi|37522043|ref|NP_925420.1|       --------...------------------.....-.....-.....------L---.......
gi|37523548|ref|NP_926925.1|       --------...------------------.....-.....-.....----------.......
gi|37523547|ref|NP_926924.1|       --------...------------------.....-.....-.....----------.......
gi|37520329|ref|NP_923706.1|       --------...------------------.....-.....-.....----------.......
gi|37520932|ref|NP_924309.1|       --------...------------------.....-.....-.....------A---.......
ADw_gi|427733727|ref|YP_007053271.1| AAKAIGQL...K--PDVEVHFISAATE--.....-.....-.....----------.......
ADw_gi|427739887|ref|YP_007059431.1| TAYYLQQH...RDIFTGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
ADw_gi|427738968|ref|YP_007058512.1| TAIILSKL...SQEIPGKVRFIFQPAEEI.....A.....-.....QGASWMVADGa......
ADw_gi|427737605|ref|YP_007057149.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427737907|ref|YP_007057451.1| --------...------------------.....-.....-.....-------RQIe......
ADw_gi|427736327|ref|YP_007055871.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427735146|ref|YP_007054690.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427735148|ref|YP_007054692.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427734182|ref|YP_007053726.1| LARRFADK...K--PNKTLRFVEFTNEEP.....P.....YfwtenMGSLVYAKGCker....
ADw_gi|427738036|ref|YP_007057580.1| IARLFNSA...A--TPRTLQLAFFDKEEA.....G.....L.....LGSRAFVKNQar.....
ADw_gi|427737291|ref|YP_007056835.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427733824|ref|YP_007053368.1| LAEKVKQ-...---PAVDVYLVASAKEEV.....G.....A.....IGALYFSQN-.......
ADw_gi|427734438|ref|YP_007053982.1| LARIFATQ...P--TKYPIRLVAFDMEEA.....G.....L.....LGSKDYVNELvkk....
ADw_gi|427737664|ref|YP_007057208.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427735400|ref|YP_007054944.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427736713|ref|YP_007056257.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427735785|ref|YP_007055329.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427733974|ref|YP_007053518.1| LAEYLTCF...Q--PHYSYRFIFIP----.....G.....T.....IGSIAWLAINeenvsri
ADw_gi|427735097|ref|YP_007054641.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427734372|ref|YP_007053916.1| --------...------------------.....-.....-.....----------.......
ADw_gi|427738248|ref|YP_007057792.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427718504|ref|YP_007066498.1| AAKAIAQI...K--PDAEVHFISAATE--.....-.....-.....----------.......
rbN_gi|427717245|ref|YP_007065239.1| TAYYLQQH...RQDFGGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
rbN_gi|427716398|ref|YP_007064392.1| TAMILSQV...AEELDGRVRFLFQPAEEI.....A.....-.....QGASWMVQDGa......
rbN_gi|427716007|ref|YP_007064001.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427716207|ref|YP_007064201.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427716208|ref|YP_007064202.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427720501|ref|YP_007068495.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427720149|ref|YP_007068143.1| VARLLNSY...S--TPRTLQLAFFDQEET.....G.....L.....LGSKAFISKKtr.....
rbN_gi|427717825|ref|YP_007065819.1| LARKFTAE...P--ARYPLRLVAFDMEEY.....G.....L.....LGSADYAALLrqq....
rbN_gi|427716163|ref|YP_007064157.1| LAEVVKQ-...---PEADVYLVASAKEEV.....G.....A.....IGALFFTQN-.......
rbN_gi|427716185|ref|YP_007064179.1| --------...------------------.....-.....-.....----------.......
rbN_gi|427715920|ref|YP_007063914.1| --------...------------------.....-.....-.....----------.......
gi|75908939|ref|YP_323235.1|       AAKAIAQI...K--PNVEVHFISAVTE--.....-.....-.....----------.......
gi|75908435|ref|YP_322731.1|       TAYYLQQH...RQNFAGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
gi|75907282|ref|YP_321578.1|       AAMVLSQM...TEELGGNVRFLFQPAEEI.....A.....-.....QGASWMVADGa......
gi|75910294|ref|YP_324590.1|       AAALLKEN...P--PPGNVVFIFQPAEEK.....G.....-.....AGAKVMIQSGa......
gi|75908006|ref|YP_322302.1|       --------...------------------.....-.....-.....----------.......
gi|75907687|ref|YP_321983.1|       --------...------------------.....-.....-.....----------.......
gi|75907688|ref|YP_321984.1|       --------...------------------.....-.....-.....----------.......
gi|75908485|ref|YP_322781.1|       --------...------------------.....-.....-.....----------.......
gi|75908181|ref|YP_322477.1|       IARLFASH...P--TPRTLQLAFFDLEEA.....G.....L.....VGSKAFVTNTqr.....
gi|75907143|ref|YP_321439.1|       LARKFAAA...P--AKYPLRLVAFDMEEY.....G.....L.....LGSTDYAGLLrqq....
gi|75909389|ref|YP_323685.1|       LAQQLKQ-...---PAMDVYLVASAKEEV.....G.....A.....IGALFFTQN-.......
gi|75910593|ref|YP_324889.1|       --------...------------------.....-.....-.....----------.......
gi|75909995|ref|YP_324291.1|       --------...------------------.....-.....-.....----------.......
gi|298491029|ref|YP_003721206.1|   AAKAIGQL...K--PDVEVHFISAVTE--.....-.....-.....----------.......
gi|298492645|ref|YP_003722822.1|   TAYYLQQH...RQDFAGTVKIIFQPAEEG.....P.....-.....GGAKPMIEAGvlk....
gi|298490648|ref|YP_003720825.1|   TAMVLSQI...AEELGGKIRFLFQPAEEI.....A.....-.....QGASWMVKDGv......
gi|298491800|ref|YP_003721977.1|   --------...------------------.....-.....-.....----------.......
gi|298490223|ref|YP_003720400.1|   --------...------------------.....-.....-.....----------.......
gi|298490222|ref|YP_003720399.1|   --------...------------------.....-.....-.....----------.......
gi|298492458|ref|YP_003722635.1|   --------...------------------.....-.....-.....----------.......
gi|298492145|ref|YP_003722322.1|   --------...------------------.....-.....-.....----------.......
gi|298492188|ref|YP_003722365.1|   --------...------------------.....-.....-.....----------.......
gi|298491532|ref|YP_003721709.1|   --------...------------------.....-.....-.....----------.......


                                        170       180                                       190     
                                          |         |                                         |     
d1cg2a1                              AKLADYVLSFEPTSAGdekl..........S.........LGTXFNA.........GEGGK--
gi|269926470|ref|YP_003323093.1|   SGKTIEVLNTDAEGRLvla...........D.........GIVQAKK.........EGATHLV
gi|269926320|ref|YP_003322943.1|   GVAIDVTIAGDIPGMDkt............Q.........QVTSLGK.........GAAISIM
gi|269925335|ref|YP_003321958.1|   RLSSEAVVISDTGWIApgv...........P.........SITYALR.........GLSYIQV
gi|269925376|ref|YP_003321999.1|   -LRVDCAIVGEPSSNT..............-.........-LRRGNR.........GRIEIIA
gi|269925438|ref|YP_003322061.1|   -HLPEYLIIGEPSGWD..............-.........SIVLGYK.........GSMHVHY
gi|269926083|ref|YP_003322706.1|   AKGATAAFVLEPGRPR..............S.........SVVVARK.........GVYNYEL
gi|269838949|ref|YP_003323641.1|   QGRPSWGVLLDMVGDR..............-.........-ALRIPR.........EGFSEEM
gi|269926500|ref|YP_003323123.1|   GLRLIGAINTDYSTPSsreemd........S.........TMHVGTI.........GKLLPSI
TLn_gi|427723016|ref|YP_007070293.1| NGKTIEVNNTDAEGRLtla...........D.........ALVYAEK.........LEVDAIV
TLn_gi|427722057|ref|YP_007069334.1| NPDVDAIIGLHIWNNL..............P.........LGTVGVRp........GALMAAA
TLn_gi|427722694|ref|YP_007069971.1| LEDIDDILSLHVFPTI..............Paqsv.....GIRYGAL.........TAAADDL
TLn_gi|427723545|ref|YP_007070822.1| -------VMIDPGHGGk.............D.........PGAVGIG.........GLQEKRV
TLn_gi|427726210|ref|YP_007073487.1| -TNVDALIALEICPLAre............Y.........----AIA.........SGDRPVL
TLn_gi|427724197|ref|YP_007071474.1| QQPLRLMLSLEMLGYCshapnsqtyp....S.........FLKYFYP.........STGDFIA
TLn_gi|427725916|ref|YP_007073193.1| ----------------..............-.........-------.........-------
TLn_gi|427723370|ref|YP_007070647.1| ----------------..............-.........-------.........-------
TLn_gi|427724429|ref|YP_007071706.1| ----------------..............-.........-------.........-------
Cy2_gi|428218721|ref|YP_007103186.1| ----------------..............-.........-------.........-------
Cy2_gi|428217331|ref|YP_007101796.1| NPNVDAIIGLHLWNNL..............P.........LGAVGVR.........GGALMAA
Cy2_gi|428218965|ref|YP_007103430.1| ----------------..............-.........---Y---.........-------
Cy2_gi|428218329|ref|YP_007102794.1| --------VIDPGHGG..............R.........DPGAVGN.........GINEKII
Cy2_gi|428218498|ref|YP_007102963.1| GQKLRLMISLEMLGYTdrnpgsqh......Ypt.......GLKYFYP.........DRGDFIA
Cy2_gi|428218676|ref|YP_007103141.1| -RSLDALIALEIIPLSceypiedn......Dapv......LLSQDAY.........GVYDE--
Cy2_gi|428218275|ref|YP_007102740.1| AVSLHYNALPDNG---..............D.........AINTMGI.........GSF----
Cy2_gi|428217320|ref|YP_007101785.1| ----------------..............-.........-------.........-------
Cy2_gi|428217360|ref|YP_007101825.1| ----------------..............-.........-------.........-------
Cy2_gi|428217620|ref|YP_007102085.1| ----------------..............-.........-------.........-------
gi|158336127|ref|YP_001517301.1|   NGKTIEINNTDAEGRLtla...........D.........ALVFAEK.........QGVDAIV
gi|158335082|ref|YP_001516254.1|   NPQVDAIIGLHLWNNL..............P.........LGTVGIKs........GPLMAAV
gi|158334581|ref|YP_001515753.1|   MDEVDAILSVHVLPSI..............P.........AGSVAVRygalta...AADNLEI
gi|158339037|ref|YP_001520214.1|   ----------------..............-.........-------.........-------
gi|158335668|ref|YP_001516840.1|   ---------IDPGHGGa.............D.........PGAVGIG.........GLQEKRV
gi|158335292|ref|YP_001516464.1|   -------IVIDPGHGG..............Pd........PGAIGIG.........GLRETNV
gi|158338092|ref|YP_001519268.1|   NTRITTMISLEMLGYIdarkhtqryp....P.........GLKYLYP.........STGNFIA
gi|158337208|ref|YP_001518383.1|   LKNLDGVVILEMLGYS..............-.........CSTPGC-.........QQVPGEF
gi|158338413|ref|YP_001519590.1|   ----------------..............-.........-------.........-------
gi|158336876|ref|YP_001518051.1|   ----------------..............-.........-------.........-------
gi|16330631|ref|NP_441359.1|       ----------------..............-.........-------.........-------
gi|16332230|ref|NP_442958.1|       NPAVDAIVGLHLWNDL..............P.........VGTVGIKp........GPVMAAV
gi|16331842|ref|NP_442570.1|       MKGVSHILGVHVFPSI..............Paqqv.....GIRYGAL.........TAAADDL
gi|16329830|ref|NP_440558.1|       ----------------..............-.........-------.........-------
gi|16330558|ref|NP_441286.1|       ----------------..............-.........-------.........-------
gi|16330376|ref|NP_441104.1|       --------VVDPGHGGk.............D.........PGAIGIR.........GVQEKDV
gi|16329723|ref|NP_440451.1|       ----------DAGHGGq.............D.........PGAIGQR.........GIREKDV
gi|16330213|ref|NP_440941.1|       ----------------..............-.........-------.........-------
toq_gi|571027785|ref|YP_008899903.1| NGKTIEVNNTDAEGRLtla...........D.........ALVYAEK.........LGVDAIV
toq_gi|571026933|ref|YP_008899051.1| TPKVDGIIGLHLWNFL..............P.........VGTVGVRs........GPLMAAA
toq_gi|571028537|ref|YP_008900657.1| MKEVSAILSLHVFPSI..............Pagdv.....AVRYGALta.......AADDIE-
toq_gi|571027463|ref|YP_008899581.1| ----------------..............-.........-----E-.........-------
toq_gi|571027813|ref|YP_008899931.1| ----------------..............-.........-------.........-------
gi|22299288|ref|NP_682535.1|       NGKTIEVNNTDAEGRLtla...........D.........ALVYAEK.........LGVDAIV
gi|22299990|ref|NP_683237.1|       APKVDGIIGLHLWNFL..............P.........VGTVGVRs........GPLMAAA
gi|22297557|ref|NP_680804.1|       MEAVSAILSLHVFPSI..............Pagdv.....AVRYGALta.......AADDIE-
gi|22297795|ref|NP_681042.1|       ----------------..............-.........-------.........-------
gi|22299317|ref|NP_682564.1|       ----------------..............-.........-------.........-------
fN9_gi|428220463|ref|YP_007104633.1| ----------------..............-.........-------.........-------
fN9_gi|428222328|ref|YP_007106498.1| LEQVDAIIGLHVWNNL..............P.........LGSVGVR.........GGALMAA
fN9_gi|428221241|ref|YP_007105411.1| IPDLQNYGGLDI----..............-.........QSCLSRI.........GGNWEQI
fN9_gi|428222603|ref|YP_007106773.1| ----------------..............-.........-------.........-------
fN9_gi|428221486|ref|YP_007105656.1| KEKIVGMLSIETIGYYtnelgsqkfp....F.........PLGAFYP.........STGNYIA
fN9_gi|428221848|ref|YP_007106018.1| ----------------..............-.........-------.........-------
fN9_gi|428221485|ref|YP_007105655.1| ----------------..............-.........-------.........-------
qVl_gi|427712524|ref|YP_007061148.1| ----------------..............-.........-------.........-------
qVl_gi|427712396|ref|YP_007061020.1| NPHVDAIIGLHVWNVL..............P.........VGTVGVRs........GPFMAAA
qVl_gi|427714252|ref|YP_007062876.1| MQQVSSILSLHVFPSI..............Pagei.....AVRYGAL.........TAAADDL
qVl_gi|427711704|ref|YP_007060328.1| ----------------..............-.........R------.........-------
qVl_gi|427711553|ref|YP_007060177.1| ------VIAVDPGHGGg.............D.........PGAVGIN.........GLQEKVV
qVl_gi|427714522|ref|YP_007063146.1| ----------------..............-.........-------.........-------
qVl_gi|427713716|ref|YP_007062340.1| ----------------..............-.........-------.........-------
gi|113954246|ref|YP_731406.1|      ----------------..............-.........-------.........-------
gi|113955421|ref|YP_729363.1|      TDGLNALFGVHVFPTL..............P.........VGTIGLR.........SGSLTAA
gi|113954748|ref|YP_731585.1|      ----------------..............-.........-------.........-------
gi|113954650|ref|YP_730754.1|      --------VIDPGHGGp.............D.........PGAVGIR.........GIRESEI
gi|81299999|ref|YP_400207.1|       ----------------..............-.........-------.........-------
gi|81299067|ref|YP_399275.1|       NPAVDAIIGLHLWNYL..............P.........LGKVGVRs........GPLMAAV
gi|81300780|ref|YP_400988.1|       LEGVDAILGVHVFPSI..............P.........AGVVGIR.........Y------
gi|81300390|ref|YP_400598.1|       ----------------..............-.........-------.........-------
gi|81301169|ref|YP_401377.1|       -------VVIDPGHGGp.............D.........PGAIGIN.........GLQEAEL
gi|81300943|ref|YP_401151.1|       ------VIVIDPGHGGr.............D.........PGAIGIG.........GIRETDI
gi|81299525|ref|YP_399733.1|       ----------------..............-.........-------.........-------
gi|81301079|ref|YP_401287.1|       -QRLAALIALEIIPVApe............Y.........PIAASEApvllsqdayGLYDE--
gi|81300779|ref|YP_400987.1|       ----------------..............-.........-------.........-------
gi|123966726|ref|YP_001011807.1|   ----------------..............-.........-------.........-------
gi|123967035|ref|YP_001012116.1|   TDGLKQILGVHV---F..............P.........ELLVGTV.........GIKEGSL
gi|123965487|ref|YP_001010568.1|   ----------------..............-.........------R.........-------
gi|123965916|ref|YP_001010997.1|   ------YVVLDPGHGGp.............D.........PGAIGIG.........GVKEADV
JuK_gi|428313309|ref|YP_007124286.1| ----------------..............-.........-------.........-------
JuK_gi|428311057|ref|YP_007122034.1| NPDVQAMIGLHLWNNL..............P.........LGTVGVRs........GALMAAV
JuK_gi|428309062|ref|YP_007120039.1| MNDVSAIFSVHVFPSI..............Pggsl.....GIRYGAL.........TAAADDL
JuK_gi|428312940|ref|YP_007123917.1| ----------------..............-.........-------.........-------
JuK_gi|428309925|ref|YP_007120902.1| -------VMVDPGHGGk.............D.........PGAIGIG.........GLREKDV
JuK_gi|428310093|ref|YP_007121070.1| KEKVVAMLSLETMGYYsdkigsqnypaplsA.........-------.........-------
JuK_gi|428313512|ref|YP_007124489.1| --------MIDPGHGGk.............D.........PGAIGIG.........GLREKDV
JuK_gi|428309552|ref|YP_007120529.1| -------VMIDPGHGGk.............D.........SGAVGLG.........GLQEKDV
JuK_gi|428313083|ref|YP_007124060.1| ----------------..............-.........-------.........-------
JuK_gi|428310554|ref|YP_007121531.1| -QGLDALIALEICPLSse............Y.........PIEAGEApvllsqd..GYGIY--
JuK_gi|428310231|ref|YP_007121208.1| ----------------..............-.........-------.........-------
JuK_gi|428312499|ref|YP_007123476.1| NQAIDYLYCFD-----..............-.........-------.........-------
JuK_gi|428313236|ref|YP_007124213.1| ----------------..............-.........-------.........-------
JuK_gi|428313477|ref|YP_007124454.1| SRGVEFFVVPDSLDLK..............G.........TI-----.........-------
JuK_gi|428311704|ref|YP_007122681.1| ----------------..............-.........-------.........-------
gi|113473990|ref|YP_720051.1|      ----------------..............-.........-------.........-------
gi|113475511|ref|YP_721572.1|      NPDVDAIIGLHLWNNL..............P.........LGTLGVR.........SGALMAA
gi|113477163|ref|YP_723224.1|      LENVEAILGVHV---Y..............P.........SILAGSV.........GIRHGAL
gi|113478073|ref|YP_724134.1|      NPKFDFILDLHTTTAN..............M.........GLTIILV.........NYHPFNL
gi|113476499|ref|YP_722560.1|      ----------------..............-.........-------.........-------
gi|113474224|ref|YP_720285.1|      ----------------..............-.........-------.........-------
gi|113477463|ref|YP_723524.1|      ----------------..............-.........-------.........-------
gi|113476944|ref|YP_723005.1|      -----YVIDLHS----..............-.........-------.........-------
gi|113474394|ref|YP_720455.1|      LINPDSPPAFDLFFLR..............-.........-------.........-------
HFg_gi|428224156|ref|YP_007108253.1| ----------------..............-.........-------.........-------
HFg_gi|428226397|ref|YP_007110494.1| NPSLDAIIGLHIWNNL..............P.........LGTVGVRs........GPLMAAV
HFg_gi|428224388|ref|YP_007108485.1| MTDVSAILSVHA---F..............P.........SIMAGNI.........GIRHGVL
HFg_gi|428223916|ref|YP_007108013.1| ----------------..............-.........-------.........-------
HFg_gi|428226743|ref|YP_007110840.1| ----------------..............-.........-------.........-------
HFg_gi|428224382|ref|YP_007108479.1| ------VVVIDPGHGGp.............D.........PGAVGIN.........GLNEVDI
HFg_gi|428223590|ref|YP_007107687.1| -QRLDALIALEIIPLA..............PeytieggsvPVVLA--.........-------
HFg_gi|428224655|ref|YP_007108752.1| KVSLRLMISLEMLGYCdrapgsqr......Y.........-------.........PSILDRF
HFg_gi|428226160|ref|YP_007110257.1| ----------------..............-.........-------.........-------
HFg_gi|428226051|ref|YP_007110148.1| IADLAGAVVLDMVGYAcrepdcqty.....P.........-------.........-------
HFg_gi|428224780|ref|YP_007108877.1| ----------------..............-.........-------.........-------
gi|257061661|ref|YP_003139549.1|   ----------------..............-.........-------.........-------
gi|257062162|ref|YP_003140050.1|   NPDVDAIIGLHLWNNL..............P.........LGTVGVRs........GPLMAAV
gi|257059081|ref|YP_003136969.1|   MREVKAIFGVHVFPSI..............Parsv.....GIRYGAL.........TAAADDL
gi|257058278|ref|YP_003136166.1|   ----------------..............-.........-------.........-------
gi|257060857|ref|YP_003138745.1|   ----------------..............-.........-------.........-------
gi|257061491|ref|YP_003139379.1|   ----------------..............-.........-------.........-------
gi|257058498|ref|YP_003136386.1|   ----------------..............-.........-------.........-------
gi|257060846|ref|YP_003138734.1|   ----------------..............-.........-------.........-------
gi|257057955|ref|YP_003135843.1|   AQQCDRVFVLEPSLGAt.............G.........RLKTQRK.........GVGRFTI
5BT_gi|434391707|ref|YP_007126654.1| NGKTIEVNNTDAEGRLtla...........D.........ALVFAEK.........LGVDAIV
5BT_gi|434395368|ref|YP_007130315.1| NPDVDAIIGLHLWNNL..............P.........LGTVGVRs........GALMAAV
5BT_gi|434393016|ref|YP_007127963.1| MENVSAIFSLHVFPSI..............P.........A---GSV.........GIRYGAL
5BT_gi|434392062|ref|YP_007127009.1| VLDPGCYRRNDGTPIE..............-.........-ACLARI.........GGDWSQL
5BT_gi|434395507|ref|YP_007130454.1| VPVPDFLLGMHSAPGPtgiia.........S.........VPGIRTA.........GSDPIDI
5BT_gi|434391636|ref|YP_007126583.1| ------VVVIDPGHGGk.............D.........PGAIGIG.........GAQEKQV
5BT_gi|434395491|ref|YP_007130438.1| LQGLDAMFNFDMVGVN..............D.........QLLVGGS.........QSLTK--
5BT_gi|434391354|ref|YP_007126301.1| NQPLRLMISLEMLGYC..............-.........---DSTP.........GSQQYPI
5BT_gi|434391607|ref|YP_007126554.1| ----------D-----..............-.........-------.........-------
5BT_gi|434395336|ref|YP_007130283.1| -QHLDALIALEICPLApe............Ypiksgea..PVILSQD.........GYGIY--
5BT_gi|434391236|ref|YP_007126183.1| -----Y----------..............-.........-------.........-------
5BT_gi|434391792|ref|YP_007126739.1| FNRVDAYFSLHS----..............-.........-------.........-------
5BT_gi|434395419|ref|YP_007130366.1| ----------------..............-.........-------.........-------
gi|284929626|ref|YP_003422148.1|   ----------------..............-.........-------.........-------
gi|284928900|ref|YP_003421422.1|   MNNVDAIFGVHVFPSL..............P.........AGSIGIKy........G----TL
gi|284929040|ref|YP_003421562.1|   ----------------..............-.........-------.........-------
8V2_gi|428775164|ref|YP_007166951.1| ----------------..............-.........-------.........-------
8V2_gi|428777931|ref|YP_007169718.1| NPDVDAMIGLHLWNNL..............P.........LGTLGVRd........GTLMAAV
8V2_gi|428776138|ref|YP_007167925.1| ----------------..............-.........-------.........-------
8V2_gi|428777938|ref|YP_007169725.1| -------VVLDPGHGGk.............D.........PGAVGIG.........GLQEKNV
8V2_gi|428777493|ref|YP_007169280.1| NEKIRLMFSLEMLGYCcqepdsqdyp....P.........LIDRFYP.........HTGNFIA
8V2_gi|428778337|ref|YP_007170124.1| -QRLGALIALEIIPLA..............-.........-PEYSFT.........GGEAPVL
8V2_gi|428777769|ref|YP_007169556.1| ----------------..............-.........-------.........-------
8V2_gi|428775818|ref|YP_007167605.1| -----K----------..............-.........-------.........-------
gi|166368941|ref|YP_001661214.1|   ----------------..............-.........-------.........-------
gi|166365183|ref|YP_001657456.1|   NPDVDGIIGLHLWNNL..............P.........LGTVGVKn........GPLMAAV
gi|166366573|ref|YP_001658846.1|   MRDVSAVLGLHVFPSI..............P.........ARSIGVRygal.....TAAADDL
gi|166362930|ref|YP_001655203.1|   ----------------..............-.........-------.........-------
gi|166364322|ref|YP_001656595.1|   ----------------..............-.........-------.........-------
gi|166368299|ref|YP_001660572.1|   ----------DPGHGGk.............D.........PGAIGIG.........GLQEKNV
gi|166366765|ref|YP_001659038.1|   KQDLRLMLSLEMLGYCdknphsqk......Ypa.......FLEYFYP.........NTGDFIA
gi|166368835|ref|YP_001661108.1|   ----------------..............-.........-------.........-------
gi|166366493|ref|YP_001658766.1|   -NRLDALIALEICPLA..............-.........-PEYPIK.........DGSTPVL
gi|166363064|ref|YP_001655337.1|   ----------------..............-.........-------.........-------
gi|166366413|ref|YP_001658686.1|   ----------------..............-.........-------.........-------
gi|37522180|ref|NP_925557.1|       ----------------..............-.........-------.........-------
gi|37519943|ref|NP_923320.1|       SPDVAAIVGLHLWNNM..............P.........LGQVGVK.........GGPSFAN
gi|37522109|ref|NP_925486.1|       DPRVSALFALHCFPSLpvgvigvr......P.........GVFTAAA.........DSLVIEV
gi|37520936|ref|NP_924313.1|       RKKAAIYINTDSNGRG..............-.........--FLEMG.........GSHTLER
gi|37523992|ref|NP_927369.1|       MRPLVANFNMDMFLPIh.............P.........LTRLTAL.........GLEES--
gi|37520534|ref|NP_923911.1|       ----------------..............-.........-------.........-------
gi|37520091|ref|NP_923468.1|       ----------------..............-.........-------.........-------
gi|37522227|ref|NP_925604.1|       IKALRGMLNFDMVGVN..............E.........KLLVGGT.........P------
gi|37522043|ref|NP_925420.1|       ----------------..............-.........-------.........-------
gi|37523548|ref|NP_926925.1|       ----------------..............-.........-------.........-------
gi|37523547|ref|NP_926924.1|       ----------------..............-.........-------.........-------
gi|37520329|ref|NP_923706.1|       ----------------..............-.........-------.........-------
gi|37520932|ref|NP_924309.1|       ----------------..............-.........-------.........-------
ADw_gi|427733727|ref|YP_007053271.1| ----------------..............-.........-------.........-------
ADw_gi|427739887|ref|YP_007059431.1| NPDVDAIIGLHLWNNL..............P.........LGTIGVRs........GALMAAV
ADw_gi|427738968|ref|YP_007058512.1| MENVESILGVHVFPSI..............P.........AGSVGIR.........---YGAL
ADw_gi|427737605|ref|YP_007057149.1| QEKIDLIIDLHSTTAN..............M.........GLTIILS.........SN-----
ADw_gi|427737907|ref|YP_007057451.1| QEEIDLIIDLHSTTAN..............M.........GLTIILC.........GRNPYLL
ADw_gi|427736327|ref|YP_007055871.1| ----------------..............-.........-------.........-------
ADw_gi|427735146|ref|YP_007054690.1| --------MIDPGHGGk.............D.........PGAIGIG.........GLREKDV
ADw_gi|427735148|ref|YP_007054692.1| ----------------..............-.........-V-----.........-------
ADw_gi|427734182|ref|YP_007053726.1| NENVVAMLSLETMGYFseeegsqkyp....F.........PLNLIYP.........SQGNFIA
ADw_gi|427738036|ref|YP_007057580.1| LQNLRGVIVMDMVGYA..............C.........YTVGCQK.........TPSGFPI
ADw_gi|427737291|ref|YP_007056835.1| ----------------..............-.........-------.........-------
ADw_gi|427733824|ref|YP_007053368.1| -QRLDAIIALEICPLSse............Y.........PIEDGESpvilsqdsyGIYDE--
ADw_gi|427734438|ref|YP_007053982.1| KQKLRLMMSLEMLGYCdrnpgtqeypa...P.........VLKSFYP.........DTGDFIA
ADw_gi|427737664|ref|YP_007057208.1| ----------------..............-.........-------.........-------
ADw_gi|427735400|ref|YP_007054944.1| ----------------..............-.........-------.........-------
ADw_gi|427736713|ref|YP_007056257.1| ----------------..............-.........-------.........-------
ADw_gi|427735785|ref|YP_007055329.1| ----------------..............-.........-------.........-------
ADw_gi|427733974|ref|YP_007053518.1| KHGLVLTCLGDSGS--..............F.........TYKKSRR.........GNTEID-
ADw_gi|427735097|ref|YP_007054641.1| -----------S----..............-.........-------.........-------
ADw_gi|427734372|ref|YP_007053916.1| ----------------..............-.........-------.........-------
ADw_gi|427738248|ref|YP_007057792.1| ----------------..............-.........-------.........-------
rbN_gi|427718504|ref|YP_007066498.1| ----------------..............-.........-------.........-------
rbN_gi|427717245|ref|YP_007065239.1| NPDVDAIIGLHLWNNL..............P.........LGTVGVRs........GALMAAV
rbN_gi|427716398|ref|YP_007064392.1| MTNVSAVLGVHVFPSI..............P.........AGSIGVR.........---YGAL
rbN_gi|427716007|ref|YP_007064001.1| --PADFILDLHSTTAN..............M.........GLTIILV.........NSHPFNL
rbN_gi|427716207|ref|YP_007064201.1| --------MIDPGHGGk.............D.........PGAIGIG.........GVREKDI
rbN_gi|427716208|ref|YP_007064202.1| ----------------..............-.........-------.........-------
rbN_gi|427720501|ref|YP_007068495.1| ----------------..............-.........-------.........-------
rbN_gi|427720149|ref|YP_007068143.1| LKNLRGVIVMDMVGYA..............-.........CYTAGCQ.........QYPKALP
rbN_gi|427717825|ref|YP_007065819.1| KQRLRLMMSLEMLGYQnsqpnsqnyp....P.........PLERFYP.........NQGDFIA
rbN_gi|427716163|ref|YP_007064157.1| -QTLDALIALEICPLAseypied.......Ges.......PVILSQD.........GYGIY--
rbN_gi|427716185|ref|YP_007064179.1| ----------------..............-.........-------.........-------
rbN_gi|427715920|ref|YP_007063914.1| ----------------..............-.........-------.........-------
gi|75908939|ref|YP_323235.1|       ----------------..............-.........-------.........-------
gi|75908435|ref|YP_322731.1|       NPDVDAIIGLHLWNNL..............P.........LGTVGVRs........GPLMAAV
gi|75907282|ref|YP_321578.1|       IKDVSAILGIHVFPSI..............P.........AGSIGVR.........---YGAL
gi|75910294|ref|YP_324590.1|       LEGVNAIFGGHVTRHYqvgeimva......K.........GVITAQS.........DGFTIRV
gi|75908006|ref|YP_322302.1|       QPKVDVVIDLHSTTANmg............L.........SIILGNQ.........DPFLLKL
gi|75907687|ref|YP_321983.1|       -------VLIDPGHGGk.............D.........PGAIGIG.........GVREKDI
gi|75907688|ref|YP_321984.1|       ----------------..............-.........----A--.........-------
gi|75908485|ref|YP_322781.1|       ----------------..............-.........-------.........-------
gi|75908181|ref|YP_322477.1|       LEKLRGVIVMDMVGYAcytagcqqypp...G.........LPV----.........-------
gi|75907143|ref|YP_321439.1|       QQPLRLMMSLEMLGYRdctpgsqr......Ypa.......PLEKFYP.........NTGDFIA
gi|75909389|ref|YP_323685.1|       -QQLDALIALEICPLS..............-.........-EEYPVK.........DSENPVL
gi|75910593|ref|YP_324889.1|       ---------I------..............-.........-------.........-------
gi|75909995|ref|YP_324291.1|       ----------------..............-.........-------.........-------
gi|298491029|ref|YP_003721206.1|   ----------------..............-.........-------.........-------
gi|298492645|ref|YP_003722822.1|   NPDVDAMIGLHLWNDL..............P.........VGTVGVRp........GPLLAAV
gi|298490648|ref|YP_003720825.1|   MNHVSAILGVHVFPSI..............P.........AGYVGIR.........---YGAL
gi|298491800|ref|YP_003721977.1|   ----------------..............-.........-------.........----L--
gi|298490223|ref|YP_003720400.1|   --------VIDPGHGGk.............D.........PGAIGIS.........GLEEKDI
gi|298490222|ref|YP_003720399.1|   ----------------..............-.........SGAPGIG.........GLLEKDV
gi|298492458|ref|YP_003722635.1|   ----------------..............-.........-------.........-------
gi|298492145|ref|YP_003722322.1|   ----------------..............-.........-------.........-------
gi|298492188|ref|YP_003722365.1|   ----------------..............-.........---V---.........-------
gi|298491532|ref|YP_003721709.1|   ----------------..............-.........-------.........-------


                                                                                                    
                                                                                                    
d1cg2a1                              --.............................................................
gi|269926470|ref|YP_003323093.1|   DVatltgacvvalgtittgvfgshq......................................
gi|269926320|ref|YP_003322943.1|   DAdsisdp.......................................................
gi|269925335|ref|YP_003321958.1|   DVygpksdlhsgsyggavmnpaeaiaciiaslkddkgrikvdgfydkvveltsqereefsklp
gi|269925376|ref|YP_003321999.1|   IFrgrschasmpdkginphysmanfvaalrhldrvedpflgsetftptlvyadqtssnvvpse
gi|269925438|ref|YP_003322061.1|   VLnksmshsagpersaaeealdfwnhvvefcrelnqekrvfdqlspslrsintysdgfistve
gi|269926083|ref|YP_003322706.1|   IAkgrsahaganprdgrnaivalakaiteiaqwdkypkgvtinagtisggtkpnvvpdfasay
gi|269838949|ref|YP_003323641.1|   AR.............................................................
gi|269926500|ref|YP_003323123.1|   YVrgveshagepskgidanlllarivskismnpdladtdndvrsvapvtlkmcdfkdsydvri
TLn_gi|427723016|ref|YP_007070293.1| DIatltgacvialgeeicglwgdd.......................................
TLn_gi|427722057|ref|YP_007069334.1| ETfhvrvqgkgghgalphqtkdaivigsqivtafqtvvarsvnpidsavvtvgefhagdahnv
TLn_gi|427722694|ref|YP_007069971.1| EIfiygeaghgarphqakdaiwiasqvitalqqsisrtqnplrpivltigkiqggrapniiad
TLn_gi|427723545|ref|YP_007070822.1| IL.............................................................
TLn_gi|427726210|ref|YP_007073487.1| LHqdgygiydd....................................................
TLn_gi|427724197|ref|YP_007071474.1| LIgdiqtipemwgmgrslkksvpc.......................................
TLn_gi|427725916|ref|YP_007073193.1| --.............................................................
TLn_gi|427723370|ref|YP_007070647.1| --.............................................................
TLn_gi|427724429|ref|YP_007071706.1| --.............................................................
Cy2_gi|428218721|ref|YP_007103186.1| --.............................................................
Cy2_gi|428217331|ref|YP_007101796.1| SEkfhcliqgrgghgampeqtvdsilvaahivtalqtivarntspiesavvtvgmlhagtamn
Cy2_gi|428218965|ref|YP_007103430.1| --.............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ML.............................................................
Cy2_gi|428218498|ref|YP_007102963.1| LIgnlftiaemiglqrnikksgtpc......................................
Cy2_gi|428218676|ref|YP_007103141.1| --.............................................................
Cy2_gi|428218275|ref|YP_007102740.1| --.............................................................
Cy2_gi|428217320|ref|YP_007101785.1| --.............................................................
Cy2_gi|428217360|ref|YP_007101825.1| --.............................................................
Cy2_gi|428217620|ref|YP_007102085.1| --.............................................................
gi|158336127|ref|YP_001517301.1|   --.............................................................
gi|158335082|ref|YP_001516254.1|   DLfeckiqgkgghgamphqttdavvisaqivnalqaivarhvnplnsavvtigqlhagtasnv
gi|158334581|ref|YP_001515753.1|   TImgeaghgarpheavdaiwiaaqvittlqqaisrtqnplrpvvltigqmkggrapnviadqv
gi|158339037|ref|YP_001520214.1|   --.............................................................
gi|158335668|ref|YP_001516840.1|   VL.............................................................
gi|158335292|ref|YP_001516464.1|   VLdislevsrilqrqgvvvyltrtrevdvdlpprvrlaervrat...................
gi|158338092|ref|YP_001519268.1|   LLgnlrsiptmfkms................................................
gi|158337208|ref|YP_001518383.1|   KVklpsdkgdflaiagdtehl..........................................
gi|158338413|ref|YP_001519590.1|   --.............................................................
gi|158336876|ref|YP_001518051.1|   --.............................................................
gi|16330631|ref|NP_441359.1|       --.............................................................
gi|16332230|ref|NP_442958.1|       EHfecqlfgqgghgamphqtvdtlvisaqivmalqgivarnlnplqsavvtvgqlqsgtafnv
gi|16331842|ref|NP_442570.1|       EIfiqgesghgarpheaidaiwiaaqvitalqqaisrtqnplrpmvlslgqisggrapnviad
gi|16329830|ref|NP_440558.1|       --.............................................................
gi|16330558|ref|NP_441286.1|       --.............................................................
gi|16330376|ref|NP_441104.1|       VL.............................................................
gi|16329723|ref|NP_440451.1|       VL.............................................................
gi|16330213|ref|NP_440941.1|       --.............................................................
toq_gi|571027785|ref|YP_008899903.1| DLatltgacivalgdniaglwsnna......................................
toq_gi|571026933|ref|YP_008899051.1| EFfecevhgkgghaalpqftvdtvlvvaqiitalhtivsrnvdpletavisvgavhagtaknv
toq_gi|571028537|ref|YP_008900657.1| -Ltilgesghgarpheavdaiwiaaqvisalqqaisrtqnplrpvvltfgkiqggraanviad
toq_gi|571027463|ref|YP_008899581.1| --.............................................................
toq_gi|571027813|ref|YP_008899931.1| --.............................................................
gi|22299288|ref|NP_682535.1|       DLatltgacivalgdniaglwsnna......................................
gi|22299990|ref|NP_683237.1|       EFfecevqgkgghaalphftvdtvlvvaqiitalhtivsrnvdpletavisvgavhagtaknv
gi|22297557|ref|NP_680804.1|       -Ltilgesghgarpheavdaiwiaaqvisalqqaisrtqnplrpvvltfgkiqggraanviad
gi|22297795|ref|NP_681042.1|       -I.............................................................
gi|22299317|ref|NP_682564.1|       --.............................................................
fN9_gi|428220463|ref|YP_007104633.1| --.............................................................
fN9_gi|428222328|ref|YP_007106498.1| VEffhcqilgrgghgamphqtvdallvgaqvvnalqtivarnvdpldaavvtvgefhagtatn
fN9_gi|428221241|ref|YP_007105411.1| MQakrhrselaafvelhieqgpvlesaevqigvvegivgqrrfkiivkgsashagttpmsmrq
fN9_gi|428222603|ref|YP_007106773.1| --.............................................................
fN9_gi|428221486|ref|YP_007105656.1| FIgnaask.......................................................
fN9_gi|428221848|ref|YP_007106018.1| --.............................................................
fN9_gi|428221485|ref|YP_007105655.1| --.............................................................
qVl_gi|427712524|ref|YP_007061148.1| --.............................................................
qVl_gi|427712396|ref|YP_007061020.1| EFfhcqifgkgghgaipqqtidavlvasqivttlqtivarninpldtavisvgsfhagtakni
qVl_gi|427714252|ref|YP_007062876.1| EIqimgesghgarpheaidaiwiaaqvitnlqqaisrtqnplrpvvltigqisggrapnviad
qVl_gi|427711704|ref|YP_007060328.1| --.............................................................
qVl_gi|427711553|ref|YP_007060177.1| TL.............................................................
qVl_gi|427714522|ref|YP_007063146.1| --.............................................................
qVl_gi|427713716|ref|YP_007062340.1| --.............................................................
gi|113954246|ref|YP_731406.1|      --.............................................................
gi|113955421|ref|YP_729363.1|      AGeleievigegghgarphqaldaiwiaarvvtglqeaisrrldalnpvvvsfgkieggkafn
gi|113954748|ref|YP_731585.1|      --.............................................................
gi|113954650|ref|YP_730754.1|      VL.............................................................
gi|81299999|ref|YP_400207.1|       --.............................................................
gi|81299067|ref|YP_399275.1|       ELfdltiqgrgghaaipqncidavlvasqivtllqsivsrnvdplhsavvtigslhagttynv
gi|81300780|ref|YP_400988.1|       --.............................................................
gi|81300390|ref|YP_400598.1|       --.............................................................
gi|81301169|ref|YP_401377.1|       VL.............................................................
gi|81300943|ref|YP_401151.1|       VLdistqvtrllqaqgaqvvmtrqddrevdla...............................
gi|81299525|ref|YP_399733.1|       --.............................................................
gi|81301079|ref|YP_401287.1|       --.............................................................
gi|81300779|ref|YP_400987.1|       --.............................................................
gi|123966726|ref|YP_001011807.1|   --.............................................................
gi|123967035|ref|YP_001012116.1|   TAaagelsieiigksghgarphegvdaiwaaskvisgiqeaitrkldpldpvvitfgkinggn
gi|123965487|ref|YP_001010568.1|   --.............................................................
gi|123965916|ref|YP_001010997.1|   VL.............................................................
JuK_gi|428313309|ref|YP_007124286.1| --.............................................................
JuK_gi|428311057|ref|YP_007122034.1| EGfdctifgkgghgamphqtvdsivvsaqivnalqtivarnvdpidsavvtvgtlhsgtarnv
JuK_gi|428309062|ref|YP_007120039.1| EIfimgesghgarpheavdaiwiasqvittlqqaisrtqnplrpivltigqisggrapnviad
JuK_gi|428312940|ref|YP_007123917.1| -Aylssinplvrvyng...............................................
JuK_gi|428309925|ref|YP_007120902.1| IL.............................................................
JuK_gi|428310093|ref|YP_007121070.1| -Fyplqgnfiafignaasg............................................
JuK_gi|428313512|ref|YP_007124489.1| IL.............................................................
JuK_gi|428309552|ref|YP_007120529.1| IL.............................................................
JuK_gi|428313083|ref|YP_007124060.1| --.............................................................
JuK_gi|428310554|ref|YP_007121531.1| --.............................................................
JuK_gi|428310231|ref|YP_007121208.1| --.............................................................
JuK_gi|428312499|ref|YP_007123476.1| --.............................................................
JuK_gi|428313236|ref|YP_007124213.1| --.............................................................
JuK_gi|428313477|ref|YP_007124454.1| --.............................................................
JuK_gi|428311704|ref|YP_007122681.1| --.............................................................
gi|113473990|ref|YP_720051.1|      --.............................................................
gi|113475511|ref|YP_721572.1|      SErfnctilgkgghgamphqtidsivvaaqvinalqtivsrnispidsavvtigqlnagrafn
gi|113477163|ref|YP_723224.1|      TAaaddleltiigesghgarpheatdaiwissqiitnlqqaisrthnplrpvvltigkisggr
gi|113478073|ref|YP_724134.1|      KIatylssvepnlkiytcfnpeventfinsicergfaievgpiaqgilqadlfykte......
gi|113476499|ref|YP_722560.1|      --.............................................................
gi|113474224|ref|YP_720285.1|      --.............................................................
gi|113477463|ref|YP_723524.1|      --.............................................................
gi|113476944|ref|YP_723005.1|      --.............................................................
gi|113474394|ref|YP_720455.1|      --.............................................................
HFg_gi|428224156|ref|YP_007108253.1| --.............................................................
HFg_gi|428226397|ref|YP_007110494.1| ELfrctilgkgghgalphqtvdsivvsaqivnalqtivarnvnpiesavvtvgefhagtamnv
HFg_gi|428224388|ref|YP_007108485.1| TAaaddleiiilgesghgarpheaidavwiaaqvittlqqaisrtqnplrpvvltigqihggr
HFg_gi|428223916|ref|YP_007108013.1| --.............................................................
HFg_gi|428226743|ref|YP_007110840.1| --.............................................................
HFg_gi|428224382|ref|YP_007108479.1| VD.............................................................
HFg_gi|428223590|ref|YP_007107687.1| -Qdgygiyde.....................................................
HFg_gi|428224655|ref|YP_007108752.1| -Ypsqgdfiglignvatlgdll.........................................
HFg_gi|428226160|ref|YP_007110257.1| --.............................................................
HFg_gi|428226051|ref|YP_007110148.1| -Enlpiqppsntgdfvavvgdiehp......................................
HFg_gi|428224780|ref|YP_007108877.1| --.............................................................
gi|257061661|ref|YP_003139549.1|   --.............................................................
gi|257062162|ref|YP_003140050.1|   ECfdldifgkgghgamphqtvdsvvvsaqivnalqtivarninpidsavvtvgelhagtalnv
gi|257059081|ref|YP_003136969.1|   EIfiqgesghgarpheaidaiwiasqvittlqqaisrtqnplrpivltigqinggraanviad
gi|257058278|ref|YP_003136166.1|   --.............................................................
gi|257060857|ref|YP_003138745.1|   -Snhsddelplsdl.................................................
gi|257061491|ref|YP_003139379.1|   --.............................................................
gi|257058498|ref|YP_003136386.1|   --.............................................................
gi|257060846|ref|YP_003138734.1|   --.............................................................
gi|257057955|ref|YP_003135843.1|   RVvgkaahagldpekgasailelsfviqqlfalnnpergitvnvgmidggirsnvvapeseav
5BT_gi|434391707|ref|YP_007126654.1| DLatltgaciialgdeiaglfspdd......................................
5BT_gi|434395368|ref|YP_007130315.1| ETfhctilgkgghgamphqtvdsivvaaqivnglqtivarnidpiesavvtvgklhagtalnv
5BT_gi|434393016|ref|YP_007127963.1| TAaadeleimiigesghgarpheaidaiwiaaqvittlqqaisrtqnplhpivltvgqiqggr
5BT_gi|434392062|ref|YP_007127009.1| ATakrqpgeiaafvelhveqggvlestgddvgvvigivgqyrhhvtvtgrpnhagttpmnmrk
5BT_gi|434395507|ref|YP_007130454.1| VFkgvgghgssphlakdpilmaahaitqyqsivarainpqeaavitvgavqageannvipgea
5BT_gi|434391636|ref|YP_007126583.1| IL.............................................................
5BT_gi|434395491|ref|YP_007130438.1| --.............................................................
5BT_gi|434391354|ref|YP_007126301.1| RLlerlypncgnfiglignlptildlv....................................
5BT_gi|434391607|ref|YP_007126554.1| --.............................................................
5BT_gi|434395336|ref|YP_007130283.1| --.............................................................
5BT_gi|434391236|ref|YP_007126183.1| --.............................................................
5BT_gi|434391792|ref|YP_007126739.1| --.............................................................
5BT_gi|434395419|ref|YP_007130366.1| --.............................................................
gi|284929626|ref|YP_003422148.1|   --.............................................................
gi|284928900|ref|YP_003421422.1|   TAsvdniqvfikgesghgarpheavdaiwiasqiitvlqqaisrtqnplhplvltigkitggh
gi|284929040|ref|YP_003421562.1|   --.............................................................
8V2_gi|428775164|ref|YP_007166951.1| --.............................................................
8V2_gi|428777931|ref|YP_007169718.1| ELfkceiqakgghgamphqtidavvvsaqivnalqtivarnidptdsavvtvgelkagsamnv
8V2_gi|428776138|ref|YP_007167925.1| --.............................................................
8V2_gi|428777938|ref|YP_007169725.1| VL.............................................................
8V2_gi|428777493|ref|YP_007169280.1| FVgnlatt.......................................................
8V2_gi|428778337|ref|YP_007170124.1| LSqdgygfyde....................................................
8V2_gi|428777769|ref|YP_007169556.1| --.............................................................
8V2_gi|428775818|ref|YP_007167605.1| --.............................................................
gi|166368941|ref|YP_001661214.1|   --.............................................................
gi|166365183|ref|YP_001657456.1|   ECfdlqiqgrgghgaiphqtvdsllvaaqivnalqtivarnlnpldaavvtvgklaagtarnv
gi|166366573|ref|YP_001658846.1|   EIfiqgesghgarpheaidaiwiasqvittlqqaisrtqnplrpivltigqisggrapnviad
gi|166362930|ref|YP_001655203.1|   --.............................................................
gi|166364322|ref|YP_001656595.1|   --.............................................................
gi|166368299|ref|YP_001660572.1|   IL.............................................................
gi|166366765|ref|YP_001659038.1|   LIgnlktr.......................................................
gi|166368835|ref|YP_001661108.1|   --.............................................................
gi|166366493|ref|YP_001658766.1|   LSqdgygiyde....................................................
gi|166363064|ref|YP_001655337.1|   --.............................................................
gi|166366413|ref|YP_001658686.1|   --.............................................................
gi|37522180|ref|NP_925557.1|       --.............................................................
gi|37519943|ref|NP_923320.1|       AAkfkatilgrgghgaipqqtvdavvvgaqvvnalqtivarnvdpfepavvtvgkfqsgtnfn
gi|37522109|ref|NP_925486.1|       FGrsghgarpheavdaiwvaanvvtalqqgisrmhnplrpvvlsigqmqggrapniicdhvvl
gi|37520936|ref|NP_924313.1|       YFnevtrdvidpqkqipvkervrag......................................
gi|37523992|ref|NP_927369.1|       --.............................................................
gi|37520534|ref|NP_923911.1|       --.............................................................
gi|37520091|ref|NP_923468.1|       --.............................................................
gi|37522227|ref|NP_925604.1|       --.............................................................
gi|37522043|ref|NP_925420.1|       --.............................................................
gi|37523548|ref|NP_926925.1|       --.............................................................
gi|37523547|ref|NP_926924.1|       --.............................................................
gi|37520329|ref|NP_923706.1|       --.............................................................
gi|37520932|ref|NP_924309.1|       --.............................................................
ADw_gi|427733727|ref|YP_007053271.1| --.............................................................
ADw_gi|427739887|ref|YP_007059431.1| ESfrctilgkgghgamphqtvdsvvvaaqvvnalqtivsrnvspidsavvtvgelhagtkgni
ADw_gi|427738968|ref|YP_007058512.1| TAaaddleititgesghgarphqaidaiwiaaqvittlqqaisrtqnplhpvvlsigkitggr
ADw_gi|427737605|ref|YP_007057149.1| --.............................................................
ADw_gi|427737907|ref|YP_007057451.1| RLaayltkinpevkillytl...........................................
ADw_gi|427736327|ref|YP_007055871.1| --.............................................................
ADw_gi|427735146|ref|YP_007054690.1| IL.............................................................
ADw_gi|427735148|ref|YP_007054692.1| --.............................................................
ADw_gi|427734182|ref|YP_007053726.1| FVgdinss.......................................................
ADw_gi|427738036|ref|YP_007057580.1| TPtsdkgdflavvgdtehl............................................
ADw_gi|427737291|ref|YP_007056835.1| --.............................................................
ADw_gi|427733824|ref|YP_007053368.1| --.............................................................
ADw_gi|427734438|ref|YP_007053982.1| LIgnlktlpdlf...................................................
ADw_gi|427737664|ref|YP_007057208.1| --.............................................................
ADw_gi|427735400|ref|YP_007054944.1| --.............................................................
ADw_gi|427736713|ref|YP_007056257.1| --.............................................................
ADw_gi|427735785|ref|YP_007055329.1| --.............................................................
ADw_gi|427733974|ref|YP_007053518.1| --.............................................................
ADw_gi|427735097|ref|YP_007054641.1| --.............................................................
ADw_gi|427734372|ref|YP_007053916.1| --.............................................................
ADw_gi|427738248|ref|YP_007057792.1| --.............................................................
rbN_gi|427718504|ref|YP_007066498.1| --.............................................................
rbN_gi|427717245|ref|YP_007065239.1| ESfnckilgkgghgamphqtidavvvaaqvvtalqsivarnvnpidsavvtvgelhagskrnv
rbN_gi|427716398|ref|YP_007064392.1| TAaaddleiiimgesghgarpheaidaiwiaaqvvtalqqaisrtqnplrpvvlsigkinggr
rbN_gi|427716007|ref|YP_007064001.1| KLaaylsqin.....................................................
rbN_gi|427716207|ref|YP_007064201.1| IL.............................................................
rbN_gi|427716208|ref|YP_007064202.1| --.............................................................
rbN_gi|427720501|ref|YP_007068495.1| --.............................................................
rbN_gi|427720149|ref|YP_007068143.1| -Vkpptdkgdflavvgdtehl..........................................
rbN_gi|427717825|ref|YP_007065819.1| LIgnlrtl.......................................................
rbN_gi|427716163|ref|YP_007064157.1| --.............................................................
rbN_gi|427716185|ref|YP_007064179.1| --.............................................................
rbN_gi|427715920|ref|YP_007063914.1| --.............................................................
gi|75908939|ref|YP_323235.1|       --.............................................................
gi|75908435|ref|YP_322731.1|       ELfdctifgkgghgaiphqtvdsvvvaaqivtalqtivarnvnpidsavvtvgalhggtthnv
gi|75907282|ref|YP_321578.1|       TAaaddleiviigesghgarpheaidaiwiasqvitslqqaisrtqnplrpvvltigkitggr
gi|75910294|ref|YP_324590.1|       KGrgghgarpheavdavvvagllimavqtlvsreinpaypsvvtigkveagsagnviaeeail
gi|75908006|ref|YP_322302.1|       CAylseinplvkvcytipekgsnflrslnklgfvievgavaqgvlna................
gi|75907687|ref|YP_321983.1|       IL.............................................................
gi|75907688|ref|YP_321984.1|       --.............................................................
gi|75908485|ref|YP_322781.1|       --.............................................................
gi|75908181|ref|YP_322477.1|       -Tppsdkgdflvavgdienlsllk.......................................
gi|75907143|ref|YP_321439.1|       LIgnlrtipdli...................................................
gi|75909389|ref|YP_323685.1|       LIqdaygiyde....................................................
gi|75910593|ref|YP_324889.1|       --.............................................................
gi|75909995|ref|YP_324291.1|       --.............................................................
gi|298491029|ref|YP_003721206.1|   --.............................................................
gi|298492645|ref|YP_003722822.1|   DFfnctilgkgghgalphqtidsivvaaqivnalqtivarnvnpldsavvtigelhagtkmnv
gi|298490648|ref|YP_003720825.1|   TAaaddleimiigesghgarpheaidaiwiacqvitslqqaisrtqnplrpvvlsigkihggr
gi|298491800|ref|YP_003721977.1|   --.............................................................
gi|298490223|ref|YP_003720400.1|   IL.............................................................
gi|298490222|ref|YP_003720399.1|   IL.............................................................
gi|298492458|ref|YP_003722635.1|   --.............................................................
gi|298492145|ref|YP_003722322.1|   --.............................................................
gi|298492188|ref|YP_003722365.1|   --.............................................................
gi|298491532|ref|YP_003721709.1|   --.............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   fdeesfrqalgvdqlygeegystlerlwarptldvngiwggftgegsktvipaeahakiscrl
gi|269925376|ref|YP_003321999.1|   lrlhidwrtvpqrspdeikemlasllekslvdgawgeikvkditlttytgatrnvpahfppfl
gi|269925438|ref|YP_003322061.1|   mdinfrlplayspddlgqrlrdfagkgkisilygdpafkadknt...................
gi|269926083|ref|YP_003322706.1|   ldvrvrrtadleaveehfaqiserlskdgvnvqfhrvgscfppmepsegnr............
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   pfesfcyinylvlrkspknvideiaalvnaaiveslgdidinipgvtpkvvtydelveaavsi
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| iadfaelsgtvryfnpelrdlrdrleaiingvchsygatyeldyirmypptind.........
TLn_gi|427722694|ref|YP_007069971.1| qvqmtgtvrslhpetrtdlpgwienivasicqtygakykvnyqrgipsvqndf..........
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| viadtakfagtvryfqpaigemipkrmeqiiagicqahgasfefdyqriypavinnp......
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   iadssfmsgtvryfdpelahlieprmqdiltgicqswgatydlnywrlyppvinda.......
gi|158334581|ref|YP_001515753.1|   qmqgtvrslhpetraqlpqwieeivasvcrpygaryhvdyqagvpsvhnta............
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ipdsayfrgtvryfdpsfagyfaqrieeiikgicqshganyqftyeniyppvvndr.......
gi|16331842|ref|NP_442570.1|       qvrmagtvrslhpethaqlpqwiegivanvcqtygakyevnyrrgvpsvqnda..........
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| iadtatfrgtvryfkpelgdwlpqrieqviagicqshgatyrfhyermypptvnda.......
toq_gi|571028537|ref|YP_008900657.1| qvtlqgtvrslhpetratlptwieqivanvchaygaryqlhyrrgvpgvent...........
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       iadtatfrgtvryfkpelgdwlpqrieqviagicqsqgatyrfhyermypptvnda.......
gi|22297557|ref|NP_680804.1|       qvtlqgtvrslhpetratlptwieqivanvchaygaryqlhyrrgvpgvent...........
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| iiadtarisgtvryfnpslgkmlpqrieqviagvcqslgakyelcyhklyppvindq......
fN9_gi|428221241|ref|YP_007105411.1| dalvaaaqvvlsinhlanlpgqqvatvgrvivkpnapntipdfvemsldirdlsdrhldhlle
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| iadtaslsgtvryfnpeladklpqrieeiiagvcachgakyelnyqrmypatindptma....
qVl_gi|427714252|ref|YP_007062876.1| qvmlqgtvrslhpetsqalpawieqivahtcqaygatyqldyhrrvpsvcnap..........
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      viadrvtllgtvrclcadlherlpawieetvqgicgsfgatarvryrciappvrndp......
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       iadraqlkgtvryfddryqgflqerieqivagvcnshgatyelnyrklypavinds.......
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   aynilcekvnltgtirctnlqlfremgdwlnfnissianscgaevkvkfreivppvnndl...
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| iadtakmsgtvryfnpklegyfsqrieqviagicqsqgalyefnyvqlyppvindv.......
JuK_gi|428309062|ref|YP_007120039.1| qvrlagtvrslhpdthadlpqwvekivanvcnmygaryeinyrrgvpsvqndl..........
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      viantarmagtvryfnldyqnyfskqmeqiisgicasyganyelnyqplypplinnpkvt...
gi|113477163|ref|YP_723224.1|      apnviadqvkmsgtvrslhpdthktlpawienivanicnsygakyelnyrqgvpsvqnn....
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| iadtarlsgtvryfspqydgffkdrieqtvagicqgfgaqydldywklyppvvndpaia....
HFg_gi|428224388|ref|YP_007108485.1| apnviadqvrlqgtvrslhpdthaelpawiekivasvcqsygaryemnyrrgvpsvvnnp...
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   iadqakmrgtvryfnpqfkgyfgqrieeivagicqsfgatyelnywwlyppvindekma....
gi|257059081|ref|YP_003136969.1|   qvrmagtvrslhpethanlpqwvedivanvcstynakyeinyrrrvpsvqndm..........
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   vdvrvlhqedvqaietaifalkpttpgtelriegrigrtpmektpase...............
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| iadtanmsgtvryfnpkfegylaqrieqiiagicqshgatyelnysqlyppvindpgma....
5BT_gi|434393016|ref|YP_007127963.1| apnviadqvkllgtvrslhpetraklpnwisqmvanvcqsygarcevkyslgvpgvnndl...
5BT_gi|434392062|ref|YP_007127009.1| dalvaasqivlavnklatetpgeqvatvgyfsvspnaanivparvdlkidlrdmsqthledmv
5BT_gi|434395507|ref|YP_007130454.1| llrlslrwfnpevrktmvqgiksvnesiaraygmpedqlptlttkggstplvndq........
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   apniiadqvemsgtmrslhpetraklpqwiegiisnvcqahnakyeidyqwgvssvendi...
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| iadraylsgtvryfntdlenyigqrvesiisgichshgasydlnywrmyppvindarvt....
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   iadsanlsgtvryfnpqlggyfrqrmeeiiagicqsqgasyqfdywqlyppvinhd.......
gi|166366573|ref|YP_001658846.1|   qvrmagtvrslhpethahlpewieslvtnvcstynakcqvkyrrgvpsvqndq..........
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       viaqsaylegtvrcfspeletrlperieqviagicqahgasyefeydrhypvlmndp......
gi|37522109|ref|NP_925486.1|       kgtvrsldpqtrtalptwieqivaqtcaafgadyrlhygngtpsvindp..............
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| iadtarmsgtvryfdpdfegfiqervkqiiagicqingasydleywglypptinnq.......
ADw_gi|427738968|ref|YP_007058512.1| apnviadsvllqgtvrslhpdsskelpswienivknvcdtygakykvdyrqgvpsvqndl...
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| iadsarmsgtvryfnpnfkgffqqrveqviagicqsygakydleywslyppvinda.......
rbN_gi|427716398|ref|YP_007064392.1| apnviadqvqllgtvrslhpetranlpnwidnivanvchaygaryqvnyhqgvpsvqndy...
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       iadtatmkgtvryfnpafqgffpqrieqviagicqshgakydfkytelyppvindq.......
gi|75907282|ref|YP_321578.1|       apnviadkvqllgtvrslhpetraqlpnwierivanvchsygasyqvnyrqgvpgvyndy...
gi|75910294|ref|YP_324590.1|       egtirttnldvqnhiidglkriatavgelhnarveieirhgyppvintg..............
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   iahtarmtgslryfntdlagffkqrieqiiagvcqshganydleyinlypavinnpgia....
gi|298490648|ref|YP_003720825.1|   apniiadqvqllgtvrslhpetrtqlpswienivanvcnsygakyqvnyrqgvpsvqndy...
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   vpdqdpeeisdlletyirkitppgvrveiqrmhggkpaivpidh...................
gi|269925376|ref|YP_003321999.1|   ideeh..........................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   lgkdkvaqalreinqrlfesgtdsrmrcaelvrtawnmsgmsgpaavvyfsppyypsvkgged
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ...............................................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| iltadlkaiatatkteislhpymqnqpalcn................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ...............................................................
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       ...............................................................
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   ...............................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ...............................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      ...............................................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ...............................................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| aqiknqlvdiaaatqteiemtqmlhvlptlaap..............................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| ...............................................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| ...............................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       ...............................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| ...............................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                        200       210                          220          230     
                                          |         |                            |            |     
d1cg2a1                              .K..LVDKAVAYYKEAG......GTLGV..........EER...TGGGT...DAAYAAL..SG
gi|269926470|ref|YP_003323093.1|   .Y..WTDIVLNAASQV-......GEK--..........---...-----...-------..--
gi|269926320|ref|YP_003322943.1|   .R..LVSQFRSVAEKY-......NIPYQm.........EIL...PRGGT...DAGAIQQarAG
gi|269925335|ref|YP_003321958.1|   .P..INQAAARALEKAF......GKKAV..........FIR...AGGTI...PVVASLKeiLG
gi|269925376|ref|YP_003321999.1|   .P..LVRIAQEALSESF......SRKVE..........VKR...WDFAT...DAGHLVA..AG
gi|269925438|ref|YP_003322061.1|   .P..LVRAFMQSLRSV-......GVTPR..........FKV...KTGTS...DMNVVAPe.WR
gi|269926083|ref|YP_003322706.1|   .W..LYELAKDLAQEI-......GFELG..........AVE...TGGAS...DANNIAM..MG
gi|269838949|ref|YP_003323641.1|   .A..VNDRVWAAARLA-......GHGDV..........FVE...ERGASildDHLPLLR..RG
gi|269926500|ref|YP_003323123.1|   nP..LVRAVTELAANL-......GTKIQ..........HYY...-----...-------..--
TLn_gi|427723016|ref|YP_007070293.1| .E..LADAISSAS----......-----..........---...-----...-------..--
TLn_gi|427722057|ref|YP_007069334.1| .P..AIAALVKTVAEE-......SIETPlgvap.....ECQ...TMGSE...DMSYFLQ..E-
TLn_gi|427722694|ref|YP_007069971.1| .R..LTQILEQASREAL......GDRHVqil.......PEP...SLGAE...DFAVYLE..H-
TLn_gi|427723545|ref|YP_007070822.1| .P..ISQEVAQILQEN-......GVGVR..........---...-----...-------..--
TLn_gi|427726210|ref|YP_007073487.1| .G..LNQDIIAAASQI-......RRPLQq.........AII...QGFGS...DASIAMK..FG
TLn_gi|427724197|ref|YP_007071474.1| .E..------------Wlpa...GWRGY..........PVP...DARRS...DHLAFWE..QG
TLn_gi|427725916|ref|YP_007073193.1| .-..-------------......-----..........---...-----...-------..--
TLn_gi|427723370|ref|YP_007070647.1| .-..-------------......-----..........---...-----...-------..--
TLn_gi|427724429|ref|YP_007071706.1| .-..-------------......-----..........---...-----...-------..--
Cy2_gi|428218721|ref|YP_007103186.1| .-..-------------......-----..........---...-----...-------..--
Cy2_gi|428217331|ref|YP_007101796.1| .E..IADLVRSVAEAVV......PTELGnvp.......DCQ...TMGGE...DMSFFLN..A-
Cy2_gi|428218965|ref|YP_007103430.1| .-..-------------......-----..........---...-----...-------..--
Cy2_gi|428218329|ref|YP_007102794.1| .P..LSQRLGQVLQQM-......GYSVV..........YTR...-----...-------..--
Cy2_gi|428218498|ref|YP_007102963.1| .E..WLAA---------......GLQGK..........IVP...DTRRS...DHAPFWD..LG
Cy2_gi|428218676|ref|YP_007103141.1| .N..LNRGIAQIAQDH-......KLALQf.........AVL...NSFGS...DGSIAMK..FG
Cy2_gi|428218275|ref|YP_007102740.1| .-..-------------......-----..........---...-----...-------..--
Cy2_gi|428217320|ref|YP_007101785.1| .-..--------L----......-----..........---...-----...-------..--
Cy2_gi|428217360|ref|YP_007101825.1| .-..-------------......-----..........---...-----...-------..--
Cy2_gi|428217620|ref|YP_007102085.1| .-..-------------......-----..........---...-----...-------..--
gi|158336127|ref|YP_001517301.1|   .-..-------------......-----..........---...-----...-------..--
gi|158335082|ref|YP_001516254.1|   .A..ISDLIRSVSTEVI......ETPTG..........VVPncqTMGGE...DMSFFLQ..E-
gi|158334581|ref|YP_001515753.1|   .S..LTQLIETAAQGVC......GSENVril.......TEP...SLGAE...DFSLYLE..H-
gi|158339037|ref|YP_001520214.1|   .-..-------------......-----..........---...-----...-------..--
gi|158335668|ref|YP_001516840.1|   .D..VSTQVHNLLRKR-......GINAV..........LTR...TG---...-------..--
gi|158335292|ref|YP_001516464.1|   .A..-------------......-----..........---...-----...-------..--
gi|158338092|ref|YP_001519268.1|   .T..HFKRNGAPCEWL-......PVPLRgt........PIP...DTRRS...DHASFWD..YG
gi|158337208|ref|YP_001518383.1|   .P..LLNAFSEHHQPNLpalvpvSIPFKgl........LTP...VILRS...DHTPFWF..EG
gi|158338413|ref|YP_001519590.1|   .-..-------------......-----..........---...-----...-------..--
gi|158336876|ref|YP_001518051.1|   .-..-------------......-----..........---...-----...-------..--
gi|16330631|ref|NP_441359.1|       .-..-------------......-----..........---...-----...-------..--
gi|16332230|ref|NP_442958.1|       .R..LADLVRSAAADVLlt....DDHLQp.........DYQ...TLAGE...DMSFFLQ..A-
gi|16331842|ref|NP_442570.1|       .Q..LNKLLENAVREAW......GESALqii.......PEP...SLGAE...DFALYLE..H-
gi|16329830|ref|NP_440558.1|       .-..-------------......-----..........---...-----...-------..--
gi|16330558|ref|NP_441286.1|       .-..--------W----......-----..........---...-----...-------..--
gi|16330376|ref|NP_441104.1|       .A..VSQYLQRYLEQQ-......GVRVL..........MTR...TG---...-------..--
gi|16329723|ref|NP_440451.1|       .A..ITRGVARELEKQ-......GIEVV..........MT-...-----...-------..--
gi|16330213|ref|NP_440941.1|       .-..-------------......-----..........---...-----...-------..--
toq_gi|571027785|ref|YP_008899903.1| .E..-------------......-----..........---...-----...-------..--
toq_gi|571026933|ref|YP_008899051.1| .K..MAKLVRSVAESVV......EVPAGvts.......HCQ...TMAAE...DMSFFLK..A-
toq_gi|571028537|ref|YP_008900657.1| .Py.LSQLLAEAATDVV......GAPHVhil.......PEP...SLGAE...DFALYLE..H-
toq_gi|571027463|ref|YP_008899581.1| .-..-------------......-----..........---...-----...-------..--
toq_gi|571027813|ref|YP_008899931.1| .-..-------------......-----..........---...-----...-------..--
gi|22299288|ref|NP_682535.1|       .E..-------------......-----..........---...-----...-------..--
gi|22299990|ref|NP_683237.1|       .K..MAKLVRSVAESVV......EVPAGvts.......HCQ...TMAAE...DMSFFLK..A-
gi|22297557|ref|NP_680804.1|       .Py.LSQLLAEAATEVV......GAPHVhil.......PEP...SLGAE...DFALYLE..H-
gi|22297795|ref|NP_681042.1|       .-..-------------......-----..........---...-----...-------..--
gi|22299317|ref|NP_682564.1|       .-..-------------......-----..........---...-----...-------..--
fN9_gi|428220463|ref|YP_007104633.1| .-..-------------......-----..........---...-----...-------..--
fN9_gi|428222328|ref|YP_007106498.1| .A..IANLVRSVAESVI......ETPAGivp.......ECQ...TMGGE...DMSFFLQ..E-
fN9_gi|428221241|ref|YP_007105411.1| .Sv.IQSAIAETCEDL-......GLTYL..........HLP...SRAGH...DAQEMAK..L-
fN9_gi|428222603|ref|YP_007106773.1| .-..-------------......-----..........---...-----...-------..--
fN9_gi|428221486|ref|YP_007105656.1| .K..LVETVVDSFRQHT......QFPSEgaalse....LMS...AIGMS...DHWSFWQ..NG
fN9_gi|428221848|ref|YP_007106018.1| .-..-------------......-----..........---...-----...-------..--
fN9_gi|428221485|ref|YP_007105655.1| .-..-------------......-----..........---...-----...-------..--
qVl_gi|427712524|ref|YP_007061148.1| .-..-------------......-----..........---...-----...-------..--
qVl_gi|427712396|ref|YP_007061020.1| .E..LVRSVATTVIET-......ELGVVp.........ECQ...TMAAE...DMSFFLQ..Q-
qVl_gi|427714252|ref|YP_007062876.1| .Q..LTQLLQEAAQEVI......GKENVhtl.......PEP...SLGAE...DFSLYLD..Q-
qVl_gi|427711704|ref|YP_007060328.1| .-..-------------......-----..........---...-----...-------..--
qVl_gi|427711553|ref|YP_007060177.1| .D..ISQRLAQSLQQR-......GVQAV..........LT-...-----...-------..--
qVl_gi|427714522|ref|YP_007063146.1| .-..-------------......-----..........---...-----...-------..--
qVl_gi|427713716|ref|YP_007062340.1| .-..-------------......-----..........---...-----...-------..--
gi|113954246|ref|YP_731406.1|      .-..-------------......-----..........---...-----...-------..--
gi|113955421|ref|YP_729363.1|      .A..LTALLERSAVEQL......GADQVqrl.......DQP...SLGAE...DFAELLQ..D-
gi|113954748|ref|YP_731585.1|      .-..-------------......-----..........---...-----...-------..--
gi|113954650|ref|YP_730754.1|      .D..ISLQVARLLEAR-......GVQVT..........---...-----...-------..--
gi|81299999|ref|YP_400207.1|       .-..-------------......-----..........---...-----...-------..--
gi|81299067|ref|YP_399275.1|       .A..IADLVRSVAEEVL......EPPLGvvp.......DCQ...TMGAE...DMSYFLQ..K-
gi|81300780|ref|YP_400988.1|       .-..-------------......-----..........---...-----...-------..--
gi|81300390|ref|YP_400598.1|       .-..-------------......-----..........---...-----...-------..--
gi|81301169|ref|YP_401377.1|       .D..ISQQVAAILRNS-......GLDVR..........MT-...-----...-------..--
gi|81300943|ref|YP_401151.1|       .P..-------------......-----..........---...-----...-------..--
gi|81299525|ref|YP_399733.1|       .-..-------------......-----..........---...-----...-------..--
gi|81301079|ref|YP_401287.1|       .D..LNRALRQAAIAI-......DLPIQe.........AIL...QGFGS...DGSIAMK..FG
gi|81300779|ref|YP_400987.1|       .T..LTRLVEAAAIEAW......GQTAVeri.......EEP...SLGAE...DFSVYLE..K-
gi|123966726|ref|YP_001011807.1|   .-..-------------......-----..........---...-----...-------..--
gi|123967035|ref|YP_001012116.1|   .G..INKLLRNSSIEIL......GQENViel.......QKP...SLGAE...DFAEFLN..E-
gi|123965487|ref|YP_001010568.1|   .-..-------------......-----..........---...-----...-------..--
gi|123965916|ref|YP_001010997.1|   .D..VSKRVRNLLSKK-......GVNVR..........---...-----...-------..--
JuK_gi|428313309|ref|YP_007124286.1| .-..-------------......-----..........---...-----...-------..--
JuK_gi|428311057|ref|YP_007122034.1| .Q..MAELVRSVASDVV......ETPAGvvp.......ECQ...TMGGE...DMSFFLK..E-
JuK_gi|428309062|ref|YP_007120039.1| .A..LTQLLEESAKEAW......GSERVqil.......PEP...SMGAE...DFSIYLE..N-
JuK_gi|428312940|ref|YP_007123917.1| .T..-------------......-----..........---...-----...-------..--
JuK_gi|428309925|ref|YP_007120902.1| .P..IAQQVASLLEQQ-......GIQAV..........MTR...-----...-------..--
JuK_gi|428310093|ref|YP_007121070.1| .G..LVREVIASFRRHT......QFPSEgaalpg....FVT...GVGWS...DQWSFWQ..QG
JuK_gi|428313512|ref|YP_007124489.1| .P..ISQQVAALLQQN-......GVQAV..........MTR...----S...-------..--
JuK_gi|428309552|ref|YP_007120529.1| .P..ISQRVAAILEQQ-......GIHAI..........LTR...-----...-------..--
JuK_gi|428313083|ref|YP_007124060.1| .-..-------------......-----..........---...-----...-------..--
JuK_gi|428310554|ref|YP_007121531.1| .DegLNGELRQTAKAC-......NVPLQl.........AAI...SGFGS...DASIAMK..FG
JuK_gi|428310231|ref|YP_007121208.1| .N..-------------......-----..........---...-----...-------..--
JuK_gi|428312499|ref|YP_007123476.1| .-..-------------......-----..........---...-----...-------..--
JuK_gi|428313236|ref|YP_007124213.1| .-..-------------......-----..........---...-----...-------..--
JuK_gi|428313477|ref|YP_007124454.1| .-..-------------......-----..........---...-----...-------..--
JuK_gi|428311704|ref|YP_007122681.1| .-..-------------......-----..........---...-----...-------..--
gi|113473990|ref|YP_720051.1|      .-..-------------......-----..........---...-----...-------..--
gi|113475511|ref|YP_721572.1|      .D..IVRSVAELIVET-......PAGVIp.........ECQ...TMGAE...DMSFFLQ..E-
gi|113477163|ref|YP_723224.1|      .Pv.LTQLVESVALEAW......GSDRVivl.......PEP...SLGAE...DFSMYLQ..K-
gi|113478073|ref|YP_724134.1|      .K..-------------......-----..........---...-----...-------..--
gi|113476499|ref|YP_722560.1|      .-..-------------......-----..........---...-----...-------..--
gi|113474224|ref|YP_720285.1|      .-..-------------......-----..........--R...-----...-------..--
gi|113477463|ref|YP_723524.1|      .-..-------------......-----..........---...-----...-------..--
gi|113476944|ref|YP_723005.1|      .-..-------------......-----..........---...-----...-------..--
gi|113474394|ref|YP_720455.1|      .-..-------------......-----..........---...-----...-------..--
HFg_gi|428224156|ref|YP_007108253.1| .-..-------------......-----..........---...-----...-------..--
HFg_gi|428226397|ref|YP_007110494.1| .D..LVRSVASAVVET-......PAGIVp.........ECQ...TMGGE...DMSFFLQ..E-
HFg_gi|428224388|ref|YP_007108485.1| .A..LTQLVEASALDAW......GSDRIdil.......PEA...SLGAE...DFALYLQ..H-
HFg_gi|428223916|ref|YP_007108013.1| .-..L------------......-----..........---...-----...-------..--
HFg_gi|428226743|ref|YP_007110840.1| .-..-------------......-----..........-T-...-----...-------..--
HFg_gi|428224382|ref|YP_007108479.1| .P..ISKEVASLLERQ-......GVQAV..........L--...-----...-------..--
HFg_gi|428223590|ref|YP_007107687.1| .D..LTRQIRQAAEQM-......ALPLQi.........ATI...SGFGS...DGSIAMK..FG
HFg_gi|428224655|ref|YP_007108752.1| .H..FHRAMQRVGARSEwlpa..GRRGL..........MVP...QTRQS...DHAPFWD..RG
HFg_gi|428226160|ref|YP_007110257.1| .-..-------------......-----..........---...-----...-------..--
HFg_gi|428226051|ref|YP_007110148.1| .G..LLTAFQEARQSDSpgvftlPVPFKgl........LTP...DTMRS...DHAPFWY..RG
HFg_gi|428224780|ref|YP_007108877.1| .-..-------------......-----..........---...-----...-------..--
gi|257061661|ref|YP_003139549.1|   .-..-------------......-----..........---...-----...-------..--
gi|257062162|ref|YP_003140050.1|   .El.VRSVALDVVETST......GIVPT..........CQT...-MGGE...DMSFFLE..E-
gi|257059081|ref|YP_003136969.1|   .E..LTKILESASREAW......GNGNVqil.......PEP...SLGSE...DFSLFLE..H-
gi|257058278|ref|YP_003136166.1|   .A..-------------......-----..........---...-----...-------..--
gi|257060857|ref|YP_003138745.1|   .E..IYKILGNKGKKLT......GYD--..........---...-----...-------..--
gi|257061491|ref|YP_003139379.1|   .-..-------------......-----..........---...-----...-------..--
gi|257058498|ref|YP_003136386.1|   .-..-------------......-----..........---...-----...-------..--
gi|257060846|ref|YP_003138734.1|   .-..-------------......-----..........---...-----...-------..--
gi|257057955|ref|YP_003135843.1|   .Q..LWQKARQIGAEL-......GIELE..........EAT...AGGGS...DGNTTNL..Y-
5BT_gi|434391707|ref|YP_007126654.1| .E..-------------......-----..........---...-----...-------..--
5BT_gi|434395368|ref|YP_007130315.1| .Ef.VRSQAVRVVETPL......GIVPE..........CQT...M-GGE...DMSFFLQ..Q-
5BT_gi|434393016|ref|YP_007127963.1| .S..LAQLMQTAAEEAW......GSDRVqil.......PEP...SLGAE...DFSVYLE..K-
5BT_gi|434392062|ref|YP_007127009.1| .D..IQAAIAQICQHL-......GLSYT..........YLP...SRAGH...DAQEIGR..F-
5BT_gi|434395507|ref|YP_007130454.1| .A..VIDRINPQLANLV......GANKLiad.......FPG...TTGSE...DVHLLKGdnKN
5BT_gi|434391636|ref|YP_007126583.1| .P..ISKQIAAILEKE-......GIKVV..........MTR...-----...D------..--
5BT_gi|434395491|ref|YP_007130438.1| .-..--------LAQVT......QSDIS..........TFG...GQGGS...DHAPFAR..VG
5BT_gi|434391354|ref|YP_007126301.1| .Y..LSRSIRQAGVSS-......EWLPVfnkgl.....IVP...QTRLS...DHAHFWD..QG
5BT_gi|434391607|ref|YP_007126554.1| .-..-------------......-----..........---...-----...-------..--
5BT_gi|434395336|ref|YP_007130283.1| .DetLNGQLRQVAQKL-......EMPVQl.........ATL...SGFGS...DASIAMK..FG
5BT_gi|434391236|ref|YP_007126183.1| .-..-------------......-----..........---...-----...-------..--
5BT_gi|434391792|ref|YP_007126739.1| .-..-------------......-----..........---...-----...-------..--
5BT_gi|434395419|ref|YP_007130366.1| .-..-------------......-----..........---...-----...-------..--
gi|284929626|ref|YP_003422148.1|   .-..-------------......-----..........---...-----...-------..--
gi|284928900|ref|YP_003421422.1|   .H..LTSILENASREAW......GNDFVril.......SEP...SLGSE...DFSSYLE..YS
gi|284929040|ref|YP_003421562.1|   .-..-------------......-----..........---...-----...-------..--
8V2_gi|428775164|ref|YP_007166951.1| .-..-------------......-----..........---...-----...-------..--
8V2_gi|428777931|ref|YP_007169718.1| .N..LVRSVAQTVVET-......PTGVVp.........ECQ...TMGSE...DMSFFLE..Q-
8V2_gi|428776138|ref|YP_007167925.1| .-..-------------......-----..........---...-----...-------..--
8V2_gi|428777938|ref|YP_007169725.1| .P..ISHHVRKTLERN-......GLQVKmtrwddr...FIS...LGGR-...-------..--
8V2_gi|428777493|ref|YP_007169280.1| .Q..ESRFFTRQMRHS-......GTPSEwlsvpfsgt.MIP...ETRLS...DHSPFWD..QG
8V2_gi|428778337|ref|YP_007170124.1| .G..LNQEIVQAAKKA-......DVPLQp.........AII...DGFGS...DGSIAMK..MG
8V2_gi|428777769|ref|YP_007169556.1| .-..-------------......-----..........---...-----...-------..--
8V2_gi|428775818|ref|YP_007167605.1| .-..-------------......-----..........---...-----...-------..--
gi|166368941|ref|YP_001661214.1|   .-..-------------......-----..........---...-----...-------..--
gi|166365183|ref|YP_001657456.1|   .Q..MAELVRSIAAQVV......ETPAGivp.......ECQ...TMGGE...DMSFFLQ..E-
gi|166366573|ref|YP_001658846.1|   .F..LTRLVEEAGLEAW......GRDRVlil.......SEP...SMGAE...DFSLYLQ..Q-
gi|166362930|ref|YP_001655203.1|   .-..-------------......-----..........---...-----...-------..--
gi|166364322|ref|YP_001656595.1|   .-..-------------......-----..........---...-----...-------..--
gi|166368299|ref|YP_001660572.1|   .P..ISLEVTRILQQQ-......GIDVR..........L--...-----...-------..--
gi|166366765|ref|YP_001659038.1|   .K..DLNFLSRVMREN-......QTPCEwlpvifggy.IVP...DTRRS...DHSPFWS..RG
gi|166368835|ref|YP_001661108.1|   .-..-------------......-----..........---...-----...-------..--
gi|166366493|ref|YP_001658766.1|   .E..LNQELRIAAEKA-......GIPLQl.........AII...SGFGS...DASIAMK..FG
gi|166363064|ref|YP_001655337.1|   .-..----------N--......-----..........---...-----...-------..--
gi|166366413|ref|YP_001658686.1|   .-..-------------......-----..........---...-----...-------..L-
gi|37522180|ref|NP_925557.1|       .-..-------------......-----..........---...-----...-------..--
gi|37519943|ref|NP_923320.1|       .A..VAELVRSVAEEFL......GRGRVr.........PET...TLGGE...DMAFFLQ..K-
gi|37522109|ref|NP_925486.1|       .H..LTHLVEDCVRTLL......GAQYLqal.......PEP...SMGAE...DFAVFCE..Q-
gi|37520936|ref|NP_924313.1|       .R..IVGGSGEARREAR......-ERPDlr........LAA...LGSGS...DFTPFLQh.LG
gi|37523992|ref|NP_927369.1|       .N..LAQPLRESAGQV-......GVTVIsdpep.....NRN...SFVRS...DQYSFIR..TG
gi|37520534|ref|NP_923911.1|       .-..-------------......-----..........---...-----...-------..--
gi|37520091|ref|NP_923468.1|       .-..-------------......-----..........---...-----...-------..--
gi|37522227|ref|NP_925604.1|       .E..LVALVEKSVSAV-......----Q..........KVR...PSNAS...DHASFAA..AK
gi|37522043|ref|NP_925420.1|       .-..-------------......-----..........---...-----...-------..--
gi|37523548|ref|NP_926925.1|       .-..-------------......-----..........QHN...WIAGT...VAQALFE..RG
gi|37523547|ref|NP_926924.1|       .-..-------------......-----..........---...-----...-------..--
gi|37520329|ref|NP_923706.1|       .-..-------------......-----..........---...-----...-------..--
gi|37520932|ref|NP_924309.1|       .-..-------------......-----..........---...-----...-------..--
ADw_gi|427733727|ref|YP_007053271.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427739887|ref|YP_007059431.1| .E..MAELVRSVAQEVV......ETPLGvvp.......ECQ...TMGGE...DMSYFLQ..E-
ADw_gi|427738968|ref|YP_007058512.1| .A..LTQILQTAAEEAW......GSDRVeil.......PEP...SLGGE...DFSMYLE..K-
ADw_gi|427737605|ref|YP_007057149.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427737907|ref|YP_007057451.1| .Q..-------------......-----..........---...-----...-------..--
ADw_gi|427736327|ref|YP_007055871.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427735146|ref|YP_007054690.1| .P..ISKKVAEILRKN-......GVNAV..........LTR...-----...-------..--
ADw_gi|427735148|ref|YP_007054692.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427734182|ref|YP_007053726.1| .W..LVKKTIDLFRKQVqfqse.GVAIFg.........QIP...GVGWS...DHWSFWE..QD
ADw_gi|427738036|ref|YP_007057580.1| .P..LINTFQNLDKSS-......ELPPVftlpvplkgfFTP...DVLRS...DHAPFWL..QG
ADw_gi|427737291|ref|YP_007056835.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427733824|ref|YP_007053368.1| .N..LNGQLRNCAKQL-......DMPVQl.........ATL...SQFGS...DASIAMK..FG
ADw_gi|427734438|ref|YP_007053982.1| .R..LRNSFRKSGTKS-......EFLPVpnngk.....MVA...DTRRS...DHSPFWD..AG
ADw_gi|427737664|ref|YP_007057208.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427735400|ref|YP_007054944.1| .-..-------------......-----..........---...--Y--...-------..--
ADw_gi|427736713|ref|YP_007056257.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427735785|ref|YP_007055329.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427733974|ref|YP_007053518.1| .N..VVTYVLSSSAEE-......--NKV..........IDF...FPYGY...DERQYCSpgFN
ADw_gi|427735097|ref|YP_007054641.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427734372|ref|YP_007053916.1| .-..-------------......-----..........---...-----...-------..--
ADw_gi|427738248|ref|YP_007057792.1| .-..-------------......-----..........---...-----...-----Y-..--
rbN_gi|427718504|ref|YP_007066498.1| .-..-------------......-----..........---...-----...-------..--
rbN_gi|427717245|ref|YP_007065239.1| .T..VAELVRSVAEEVI......ETPMGvvp.......ECQ...TMAAE...DMSYFLE..A-
rbN_gi|427716398|ref|YP_007064392.1| .T..LTQLLQSAAEEAW......SSDRVqvl.......PEA...SLGAE...DFSVYLD..H-
rbN_gi|427716007|ref|YP_007064001.1| .P..LVKV---------......-----..........---...-----...-------..--
rbN_gi|427716207|ref|YP_007064201.1| .P..ISKKLAAILQQN-......GVQVV..........M--...-----...-------..--
rbN_gi|427716208|ref|YP_007064202.1| .P..IGRRIAAILQQN-......GVQAV..........LT-...-----...-------..--
rbN_gi|427720501|ref|YP_007068495.1| .-..-------------......-----..........---...-----...-------..--
rbN_gi|427720149|ref|YP_007068143.1| .P..LLNAFQNSNSANLppvltlPIPLKgl........LAP...DTLRS...DHAPFWY..QG
rbN_gi|427717825|ref|YP_007065819.1| .P..DLISISRSIRQV-......GVPSQwlpapnrgl.IVP...QTRLS...DHASFWD..VG
rbN_gi|427716163|ref|YP_007064157.1| .DetLNAQLRQSAKDL-......DIPVQl.........AIL...NGFGS...DASIAMK..LG
rbN_gi|427716185|ref|YP_007064179.1| .-..-------------......-----..........---...-----...-------..--
rbN_gi|427715920|ref|YP_007063914.1| .-..-------------......-----..........---...-----...-------..--
gi|75908939|ref|YP_323235.1|       .-..-------------......-----..........---...-----...-------..--
gi|75908435|ref|YP_322731.1|       .A..IAQLVRSVAAEVI......ETPIGivp.......ECQ...TMGGE...DMSFFLQ..E-
gi|75907282|ref|YP_321578.1|       .G..LTQLFQSAGEEAW......TSDRVqvl.......PEP...SLGAE...DFSVYLE..H-
gi|75910294|ref|YP_324590.1|       .K..ETEIARRAIVDIL......GSKGLvtm.......DYP...SMGAE...DFSFYLL..H-
gi|75908006|ref|YP_322302.1|       .E..-------------......-----..........---...-----...-------..--
gi|75907687|ref|YP_321983.1|       .P..ISQRIAEVLQQN-......GVQVV..........M--...-----...-------..--
gi|75907688|ref|YP_321984.1|       .-..-------------......-----..........---...-----...-------..--
gi|75908485|ref|YP_322781.1|       .-..-------------......-----..........---...-----...-------..--
gi|75908181|ref|YP_322477.1|       .A..----FNHADTKNLpsvltiPIPLKgl........LTP...DTLRS...DHAPFWY..QG
gi|75907143|ref|YP_321439.1|       .G..MSRHIRKAGISSQ......-WLPVpnrgl.....IVP...QTRLS...DHAPFWD..AG
gi|75909389|ref|YP_323685.1|       .G..LNGELRQCAKQL-......NMPVQl.........TTL...SGFGS...DASIAMK..FG
gi|75910593|ref|YP_324889.1|       .-..-------------......-----..........---...-----...-------..--
gi|75909995|ref|YP_324291.1|       .-..-------------......-----..........---...-----...-------..--
gi|298491029|ref|YP_003721206.1|   .-..-------------......-----..........---...-----...-------..--
gi|298492645|ref|YP_003722822.1|   .E..LVRNVAESVVET-......PVNIVp.........ECQ...IMGSE...DMSFFLQ..E-
gi|298490648|ref|YP_003720825.1|   .A..LTKLLQSSAEEAW......TTDRIqvl.......PEP...SLGAE...DFSVYLE..H-
gi|298491800|ref|YP_003721977.1|   .-..-------------......-----..........---...-----...-------..--
gi|298490223|ref|YP_003720400.1|   .P..IGRRVAAILQQN-......GVQAV..........M--...-----...-------..--
gi|298490222|ref|YP_003720399.1|   .P..IGRRVAAILERN-......GVQAV..........MT-...-----...-------..--
gi|298492458|ref|YP_003722635.1|   .-..-------------......-----..........---...-----...-------..--
gi|298492145|ref|YP_003722322.1|   .-..-------------......-----..........---...-----...-------..--
gi|298492188|ref|YP_003722365.1|   .-..-------------......-----..........---...-----...-------..--
gi|298491532|ref|YP_003721709.1|   .-..-------------......-----..........---...-----...-------..--


                                               240                          250             260     
                                                 |                            |               |     
d1cg2a1                              ..KPVIES....LGLPG....FG...............YHSDKA...E...YVDISAIPRRLY
gi|269926470|ref|YP_003323093.1|   ..------....-----....--...............------...-...------------
gi|269926320|ref|YP_003322943.1|   ..VPVIT-....LSIPV....RY...............IHT-VN...E...SARISDLEATID
gi|269925335|ref|YP_003321958.1|   ..LPSIL-....MGMGLpd..EN...............AHA-PN...E...WFLLDNFYGGIK
gi|269925376|ref|YP_003321999.1|   ..IPSIG-....FGPGDe...TL...............AHT-NQ...E...RISIEEMVEASM
gi|269925438|ref|YP_003322061.1|   ..CPAIA-....YGPGDs...SL...............DHT-PE...E...HIYISEYEKSID
gi|269926083|ref|YP_003322706.1|   ..VPVLDG....LGPVG....EK...............AHS-PE...E...RMFIPSIAERGA
gi|269838949|ref|YP_003323641.1|   ..IPVVDV....IDFDY....PH...............WHT-LR...D...------------
gi|269926500|ref|YP_003323123.1|   ..------....-----....--...............------...-...------------
TLn_gi|427723016|ref|YP_007070293.1| ..------....-----....--...............------...-...------------
TLn_gi|427722057|ref|YP_007069334.1| ..VPGCY-....FFLGS....ANpqldlayp.......HHH-PR...F...NFDESALGMGVE
TLn_gi|427722694|ref|YP_007069971.1| ..KPGAMFr...LGVGH....QNrinyp..........LHH-PL...F...DIDESAIRTGVI
TLn_gi|427723545|ref|YP_007070822.1| ..------....-----....--...............------...-...------------
TLn_gi|427726210|ref|YP_007073487.1| hiSRGAC-....LSFPT....EN...............THG--Y...E...ITHLGAIAHCID
TLn_gi|427724197|ref|YP_007071474.1| ..YKAMMV....TDTADmrn.PH...............YHQ-PT...DtfeTLDLDFLGQVCE
TLn_gi|427725916|ref|YP_007073193.1| ..------....-----....--...............------...-...------------
TLn_gi|427723370|ref|YP_007070647.1| ..------....-----....--...............------...-...------------
TLn_gi|427724429|ref|YP_007071706.1| ..------....-----....--...............------...-...------------
Cy2_gi|428218721|ref|YP_007103186.1| ..------....-----....--...............------...-...------------
Cy2_gi|428217331|ref|YP_007101796.1| ..VPGCY-....FFLGS....ANpakdlayp.......HHH-PK...F...NFDETALGMGVE
Cy2_gi|428218965|ref|YP_007103430.1| ..------....-----....--...............------...-...------------
Cy2_gi|428218329|ref|YP_007102794.1| ..------....-----....--...............------...-...------------
Cy2_gi|428218498|ref|YP_007102963.1| ..YRAIMV....TDTANlrn.PH...............YHQ-PG...D...RLETLDLDF---
Cy2_gi|428218676|ref|YP_007103141.1| .hVPRAAC....LGFPT....EN...............THG--Y...E...IAHLGAIANCIR
Cy2_gi|428218275|ref|YP_007102740.1| ..------....-----....--...............------...-...------------
Cy2_gi|428217320|ref|YP_007101785.1| ..------....-----....--...............------...-...------------
Cy2_gi|428217360|ref|YP_007101825.1| ..------....-----....--...............------...-...------------
Cy2_gi|428217620|ref|YP_007102085.1| ..------....-----....--...............------...-...------------
gi|158336127|ref|YP_001517301.1|   ..------....-----....--...............------...-...------------
gi|158335082|ref|YP_001516254.1|   ..VPGCY-....FFLGS....ANadrglayp.......HHH-PQ...F...DFDETALAMGVE
gi|158334581|ref|YP_001515753.1|   ..APGAMFr...LGVGKv...DQvnpp...........LHH-PQ...F...EAQESAIVTGVM
gi|158339037|ref|YP_001520214.1|   ..------....-----....--...............------...-...------------
gi|158335668|ref|YP_001516840.1|   ..------....-----....--...............------...-...------------
gi|158335292|ref|YP_001516464.1|   ..------....-----....--...............------...-...------------
gi|158338092|ref|YP_001519268.1|   ..YSAVMV....TDTADsrn.PH...............YHK-PS...D...TIATLNLEF---
gi|158337208|ref|YP_001518383.1|   ..IGAVML....-TDTAhlrnPH...............YHR-RT...DtpdTVDAAFLTGNAQ
gi|158338413|ref|YP_001519590.1|   ..------....-----....--...............------...-...------------
gi|158336876|ref|YP_001518051.1|   ..------....-----....--...............------...-...------------
gi|16330631|ref|NP_441359.1|       ..------....-----....--...............------...-...------------
gi|16332230|ref|NP_442958.1|       ..VPGCY-....FFLGS....ANgdlglayp.......HHH-PR...F...NFDEAVLPVGVE
gi|16331842|ref|NP_442570.1|       ..APGAMFr...LGTGFg...DRqmnhp..........LHH-PR...F...EADEAAILTGVV
gi|16329830|ref|NP_440558.1|       ..------....-----....--...............------...-...------------
gi|16330558|ref|NP_441286.1|       ..------....-----....--...............------...-...------------
gi|16330376|ref|NP_441104.1|       ..------....-----....--...............------...-...------------
gi|16329723|ref|NP_440451.1|       ..------....-----....--...............------...-...------------
gi|16330213|ref|NP_440941.1|       ..------....-----....--...............------...-...------------
toq_gi|571027785|ref|YP_008899903.1| ..------....-----....--...............------...-...------------
toq_gi|571026933|ref|YP_008899051.1| ..VPGCY-....FFLGS....ANgtlgldfp.......HHH-PR...F...DFDEIVLSIGVE
toq_gi|571028537|ref|YP_008900657.1| ..APGAMFr...LGVGFr...DRpnyp...........LHH-PE...F...DVDEQAIPVGVM
toq_gi|571027463|ref|YP_008899581.1| ..------....-----....--...............------...-...------------
toq_gi|571027813|ref|YP_008899931.1| ..------....-----....--...............------...-...------------
gi|22299288|ref|NP_682535.1|       ..------....-----....--...............------...-...------------
gi|22299990|ref|NP_683237.1|       ..VPGCY-....FFLGS....ANgtlgldfp.......HHH-PR...F...DFDETVLSIGVE
gi|22297557|ref|NP_680804.1|       ..APGAMFr...LGVGFr...DRpnyp...........LHH-PE...F...DVDEQAIPVGVM
gi|22297795|ref|NP_681042.1|       ..------....-----....--...............------...-...------------
gi|22299317|ref|NP_682564.1|       ..------....-----....--...............------...-...------------
fN9_gi|428220463|ref|YP_007104633.1| ..------....-----....--...............------...-...------------
fN9_gi|428222328|ref|YP_007106498.1| ..VPGCY-....FFLGS....ANpdldlayp.......HHH-PR...F...DFDETVLSAGVE
fN9_gi|428221241|ref|YP_007105411.1| ..TAMGM-....IFVPSqn..GV...............SHS-ET...E...FTSPELCIQGAN
fN9_gi|428222603|ref|YP_007106773.1| ..------....-----....--...............------...-...------------
fN9_gi|428221486|ref|YP_007105656.1| ..YPALMVtd..TAPFRy...PY...............YHR-PE...D...T-----------
fN9_gi|428221848|ref|YP_007106018.1| ..------....-----....--...............------...-...------------
fN9_gi|428221485|ref|YP_007105655.1| ..-P----....-----....--...............------...-...------------
qVl_gi|427712524|ref|YP_007061148.1| ..------....-----....--...............------...-...------------
qVl_gi|427712396|ref|YP_007061020.1| ..VPGCY-....FFLGS....ANselgldfp.......HHH-PR...F...DFDETVLGLGVE
qVl_gi|427714252|ref|YP_007062876.1| ..APGAMFr...LGVGFa...DRpnyp...........LHH-PQ...F...DVDERAITVGVL
qVl_gi|427711704|ref|YP_007060328.1| ..------....-----....--...............------...-...------------
qVl_gi|427711553|ref|YP_007060177.1| ..------....-----....--...............------...-...------------
qVl_gi|427714522|ref|YP_007063146.1| ..------....-----....--...............------...-...------------
qVl_gi|427713716|ref|YP_007062340.1| ..------....-----....--...............------...-...------------
gi|113954246|ref|YP_731406.1|      ..------....-----....--...............------...-...------------
gi|113955421|ref|YP_729363.1|      ..VPGSMFrlgvAGPDGc...AA...............LHN-GH...F...NPEEGALGVGVQ
gi|113954748|ref|YP_731585.1|      ..------....-----....--...............------...-...------------
gi|113954650|ref|YP_730754.1|      ..------....-----....--...............------...-...------------
gi|81299999|ref|YP_400207.1|       ..------....-----....--...............------...-...------------
gi|81299067|ref|YP_399275.1|       ..VPGCY-....FFLGS....ANldrglnfp.......HHH-PR...F...NFDETALALGVE
gi|81300780|ref|YP_400988.1|       ..------....-----....--...............------...-...------------
gi|81300390|ref|YP_400598.1|       ..-SFHTF....SGVLLr...PY...............SHK-PD...D...TFPVADLRA---
gi|81301169|ref|YP_401377.1|       ..------....-----....--...............------...-...------------
gi|81300943|ref|YP_401151.1|       ..------....-----....--...............------...-...------------
gi|81299525|ref|YP_399733.1|       ..------....-----....--...............------...-...------------
gi|81301079|ref|YP_401287.1|       .hVPRAAC....LGFAT....DN...............THG--Y...E...IADLAAIAHCSR
gi|81300779|ref|YP_400987.1|       ..IPGMMFr...LGVGYp...DRqnpp...........LHH-PQ...F...EIDERALIVGVI
gi|123966726|ref|YP_001011807.1|   ..------....-----....--...............------...-...------------
gi|123967035|ref|YP_001012116.1|   ..VPGSM-....FRLGVar..DTgcap...........LHS-SE...F...DPDERAISIGIK
gi|123965487|ref|YP_001010568.1|   ..------....-----....--...............------...-...------------
gi|123965916|ref|YP_001010997.1|   ..------....-----....--...............------...-...------------
JuK_gi|428313309|ref|YP_007124286.1| ..------....-----....--...............------...-...------------
JuK_gi|428311057|ref|YP_007122034.1| ..VPGCY-....FFLGS....ANpsrdlayp.......HHH-PR...F...DFDETALLMGTE
JuK_gi|428309062|ref|YP_007120039.1| ..APGTMFr...LGVGF....PDkpnyp..........LHH-PE...F...EVNESAIVTGVV
JuK_gi|428312940|ref|YP_007123917.1| ..------....-----....--...............------...-...------------
JuK_gi|428309925|ref|YP_007120902.1| ..------....-----....--...............------...-...------------
JuK_gi|428310093|ref|YP_007121070.1| ..YPGLMItd..TAPFRy...PY...............YHT-LD...D...TPDKVDYDRLAR
JuK_gi|428313512|ref|YP_007124489.1| ..------....-----....--...............------...-...------------
JuK_gi|428309552|ref|YP_007120529.1| ..------....-----....--...............------...-...------------
JuK_gi|428313083|ref|YP_007124060.1| ..------....-----....--...............------...-...------------
JuK_gi|428310554|ref|YP_007121531.1| hvARAAC-....LSFPT....QN...............THG--Y...E...IAHLGAIANCIH
JuK_gi|428310231|ref|YP_007121208.1| ..------....-----....--...............------...-...------------
JuK_gi|428312499|ref|YP_007123476.1| ..------....-----....--...............------...-...------------
JuK_gi|428313236|ref|YP_007124213.1| ..------....-----....--...............------...-...------------
JuK_gi|428313477|ref|YP_007124454.1| ..------....-----....--...............------...-...------------
JuK_gi|428311704|ref|YP_007122681.1| ..------....-----....--...............------...-...------------
gi|113473990|ref|YP_720051.1|      ..------....-----....--...............------...-...------------
gi|113475511|ref|YP_721572.1|      ..VPGCY-....FFLGS....ANsekglayp.......HHH-PR...F...DFDETALGIGVE
gi|113477163|ref|YP_723224.1|      ..VPGMMFr...LGVGYkd..KYnyp............LHH-PQ...F...EVDESSIVTCVV
gi|113478073|ref|YP_724134.1|      ..------....-----....--...............------...-...------------
gi|113476499|ref|YP_722560.1|      ..------....-----....R-...............------...-...------------
gi|113474224|ref|YP_720285.1|      ..------....-----....--...............------...-...------------
gi|113477463|ref|YP_723524.1|      ..------....Q----....--...............------...-...------------
gi|113476944|ref|YP_723005.1|      ..------....-----....--...............------...-...------------
gi|113474394|ref|YP_720455.1|      ..------....-----....--...............------...-...------------
HFg_gi|428224156|ref|YP_007108253.1| ..------....-----....--...............------...-...------------
HFg_gi|428226397|ref|YP_007110494.1| ..VPGCY-....FFLGS....ANlsqnlayp.......HHH-PR...F...DFDETVLGVGVE
HFg_gi|428224388|ref|YP_007108485.1| ..APGMMFr...LGVGK....PQgpnyp..........LHH-PK...F...EVDESAIITGVI
HFg_gi|428223916|ref|YP_007108013.1| ..------....-----....--...............------...-...------------
HFg_gi|428226743|ref|YP_007110840.1| ..------....-----....--...............------...-...------------
HFg_gi|428224382|ref|YP_007108479.1| ..------....-----....--...............------...-...------------
HFg_gi|428223590|ref|YP_007107687.1| hvARAAC-....LGFPT....DN...............THG--Y...E...IAHLGAIAHCAR
HFg_gi|428224655|ref|YP_007108752.1| ..YRALMVtdt.AFLRN....PH...............YHQ-PS...D...RLETLDLDF---
HFg_gi|428226160|ref|YP_007110257.1| ..------....-----....--...............------...-...------------
HFg_gi|428226051|ref|YP_007110148.1| ..LGAVLV....TDTANlrn.PH...............YHT-RSdrpE...TLDRDFFIGTAQ
HFg_gi|428224780|ref|YP_007108877.1| ..------....-----....--...............------...-...------------
gi|257061661|ref|YP_003139549.1|   ..------....-----....--...............------...-...------------
gi|257062162|ref|YP_003140050.1|   ..VPGCY-....FFLGS....ANpdkglsyp.......HHH-PR...F...DFDESVLSMGVE
gi|257059081|ref|YP_003136969.1|   ..APGSMFr...LGVGF....PDkanyp..........LHH-PQ...F...EIDESAILTGVV
gi|257058278|ref|YP_003136166.1|   ..------....-----....--...............------...-...------------
gi|257060857|ref|YP_003138745.1|   ..------....-----....--...............------...-...------------
gi|257061491|ref|YP_003139379.1|   ..------....-----....--...............------...-...------------
gi|257058498|ref|YP_003136386.1|   ..------....-----....--...............------...-...------------
gi|257060846|ref|YP_003138734.1|   ..------....-----....--...............------...-...------------
gi|257057955|ref|YP_003135843.1|   ..TPTLDG....LGAIG....DA...............AHS-PG...E...FIYLDSLVERSA
5BT_gi|434391707|ref|YP_007126654.1| ..------....-----....--...............------...-...------------
5BT_gi|434395368|ref|YP_007130315.1| ..VPGCY-....FFLGA....ANlsrnlayp.......HHH-PR...F...DFDETALGMGVE
5BT_gi|434393016|ref|YP_007127963.1| ..APGVMFr...LGVGY....PDrsvnhp.........LHH-PQ...F...EVDETAIVTGVV
5BT_gi|434392062|ref|YP_007127009.1| ..ADMGM-....IFVPSra..GI...............SHA-ED...E...YTSPEHCTQGAN
5BT_gi|434395507|ref|YP_007130454.1| ..IQVGF-....VFVGVae..PAlfakaraegktvpfsNHN-SN...F...QVDLNAVPFGTK
5BT_gi|434391636|ref|YP_007126583.1| ..------....-----....--...............------...-...------------
5BT_gi|434395491|ref|YP_007130438.1| ..VPVLF-....FYRGQe...PN...............YHT-PN...Dk..AVEPQLLDETTQ
5BT_gi|434391354|ref|YP_007126301.1| ..YPAMMItdt.AMLRN....PH...............YHK-AS...D...TIET--------
5BT_gi|434391607|ref|YP_007126554.1| ..------....-----....--...............------...-...------------
5BT_gi|434395336|ref|YP_007130283.1| .hVPRAAC....LAFPT....QN...............THG--Y...E...IAHLGAIANCIQ
5BT_gi|434391236|ref|YP_007126183.1| ..------....-----....--...............------...-...------------
5BT_gi|434391792|ref|YP_007126739.1| ..------....-----....--...............------...-...------------
5BT_gi|434395419|ref|YP_007130366.1| ..------....-----....--...............------...-...------------
gi|284929626|ref|YP_003422148.1|   ..------....-----....--...............------...-...------------
gi|284928900|ref|YP_003421422.1|   ..PGTMFR....LGTGY....PNkinhp..........LHH-PL...F...DIDESAIATGIT
gi|284929040|ref|YP_003421562.1|   ..------....-----....--...............------...-...------------
8V2_gi|428775164|ref|YP_007166951.1| ..------....-----....--...............------...-...------------
8V2_gi|428777931|ref|YP_007169718.1| ..VPGCY-....FFLGS....ANpelrlnyp.......HHH-PR...F...DFDETALGMGVE
8V2_gi|428776138|ref|YP_007167925.1| ..------....-----....--...............------...-...------------
8V2_gi|428777938|ref|YP_007169725.1| ..------....-----....--...............------...-...------------
8V2_gi|428777493|ref|YP_007169280.1| ..YKAMMVtdt.SFLRN....PH...............YHQ-PT...D...TIETLDLD----
8V2_gi|428778337|ref|YP_007170124.1| hvSRAAC-....LGFPT....DN...............THG--Y...E...IAHLSAIAHCTK
8V2_gi|428777769|ref|YP_007169556.1| ..------....-----....--...............------...-...------------
8V2_gi|428775818|ref|YP_007167605.1| ..------....-----....--...............------...-...------------
gi|166368941|ref|YP_001661214.1|   ..------....-----....--...............------...-...------------
gi|166365183|ref|YP_001657456.1|   ..VPGCY-....FFLGS....ANpelglayp.......HHH-PR...F...DFDESVLAMGVE
gi|166366573|ref|YP_001658846.1|   ..APGTMFr...LGVGS....PHllnpp..........LHH-PE...F...LVDESAILTGVI
gi|166362930|ref|YP_001655203.1|   ..------....-----....--...............------...-...------------
gi|166364322|ref|YP_001656595.1|   ..------....-----....--...............----PD...E...YFPVEDLE----
gi|166368299|ref|YP_001660572.1|   ..------....-----....--...............------...-...------------
gi|166366765|ref|YP_001659038.1|   ..YSAIMVtdt.A---Nmrn.PY...............YHS-YR...D...TIATLDLNFL--
gi|166368835|ref|YP_001661108.1|   ..------....-----....--...............------...-...------------
gi|166366493|ref|YP_001658766.1|   hiAKAAC-....LGFPT....QN...............THG--Y...E...IAHLGAIANCIS
gi|166363064|ref|YP_001655337.1|   ..------....-----....--...............------...-...------------
gi|166366413|ref|YP_001658686.1|   ..------....-----....--...............------...-...------------
gi|37522180|ref|NP_925557.1|       ..------....-----....--...............------...-...------------
gi|37519943|ref|NP_923320.1|       ..VPGCY-....FFLGS....ANpergldkp.......HHH-PC...F...DFDETALGLGVE
gi|37522109|ref|NP_925486.1|       ..VPGTMFr...LGVGG....PTsyp............LHH-PS...F...DGGDGAIAPGV-
gi|37520936|ref|NP_924313.1|       ..IASLN-....LGYGG....EGrggs...........YHS-SY...D...SV----------
gi|37523992|ref|NP_927369.1|       ..VPALA-....FKFGYe...KGsaeeklqkawlttr.YHA-PS...D...DINQPVDLEAAA
gi|37520534|ref|NP_923911.1|       ..------....-----....--...............------...-...------------
gi|37520091|ref|NP_923468.1|       ..D-----....-----....--...............------...-...------------
gi|37522227|ref|NP_925604.1|       ..VPVLF-....FHRGQd...PN...............YHQ-PG...D...------------
gi|37522043|ref|NP_925420.1|       ..------....-----....--...............------...-...------------
gi|37523548|ref|NP_926925.1|       ..VPALV-....IELGTg...RR...............IHRGHC...E...RVFQGILQW---
gi|37523547|ref|NP_926924.1|       ..------....-----....--...............------...-...------------
gi|37520329|ref|NP_923706.1|       ..M-----....-----....--...............------...-...------------
gi|37520932|ref|NP_924309.1|       ..------....-----....--...............------...-...------------
ADw_gi|427733727|ref|YP_007053271.1| ..------....-----....--...............------...-...------------
ADw_gi|427739887|ref|YP_007059431.1| ..VPGCY-....FFLGS....ANpqkdlayp.......HHH-PR...F...NFDETALAMGVE
ADw_gi|427738968|ref|YP_007058512.1| ..APGSMFr...LGVGFa...DRevnhp..........LHH-PK...F...EVDESAIITGVV
ADw_gi|427737605|ref|YP_007057149.1| ..------....-----....--...............------...-...------------
ADw_gi|427737907|ref|YP_007057451.1| ..------....-----....--...............------...-...------------
ADw_gi|427736327|ref|YP_007055871.1| ..------....-----....--...............------...-...------------
ADw_gi|427735146|ref|YP_007054690.1| ..------....-----....--...............------...-...------------
ADw_gi|427735148|ref|YP_007054692.1| ..------....-----....--...............------...-...------------
ADw_gi|427734182|ref|YP_007053726.1| ..YQALMVtd..TAPFRy...KH...............YHT-LE...D...IPDKIDYEKFAR
ADw_gi|427738036|ref|YP_007057580.1| ..IGALLV....TDTANlrs.SY...............YHQ-PS...DtptNIERDFFKGAAQ
ADw_gi|427737291|ref|YP_007056835.1| ..------....-----....--...............------...-...------------
ADw_gi|427733824|ref|YP_007053368.1| .hVPRGAC....LSFPT....QN...............THG--Y...E...IAHLGAIANCID
ADw_gi|427734438|ref|YP_007053982.1| ..YRAMMVtdt.SFMRN....PH...............YHK-PS...D...KIETLDLDF---
ADw_gi|427737664|ref|YP_007057208.1| ..------....-----....--...............------...-...------------
ADw_gi|427735400|ref|YP_007054944.1| ..------....-----....--...............------...-...------------
ADw_gi|427736713|ref|YP_007056257.1| ..------....-----....--...............------...-...------------
ADw_gi|427735785|ref|YP_007055329.1| ..------....-----....--...............------...-...------------
ADw_gi|427733974|ref|YP_007053518.1| ..LPVGCLm...RSPHNsf..PE...............YHT-SA...D...NLDFV-------
ADw_gi|427735097|ref|YP_007054641.1| ..------....-----....--...............------...-...------------
ADw_gi|427734372|ref|YP_007053916.1| ..------....-----....--...............------...-...------------
ADw_gi|427738248|ref|YP_007057792.1| ..------....-----....--...............------...-...------------
rbN_gi|427718504|ref|YP_007066498.1| ..------....-----....--...............------...-...------------
rbN_gi|427717245|ref|YP_007065239.1| ..VPGCY-....FFLGS....ANpaknlayp.......HHH-PR...F...DFDETALPIGVE
rbN_gi|427716398|ref|YP_007064392.1| ..APGSMFr...LGVGYt...DRitnhp..........LHH-PE...F...EVDESAIITGVV
rbN_gi|427716007|ref|YP_007064001.1| ..------....-----....--...............------...-...------------
rbN_gi|427716207|ref|YP_007064201.1| ..------....-----....--...............------...-...------------
rbN_gi|427716208|ref|YP_007064202.1| ..------....-----....--...............------...-...------------
rbN_gi|427720501|ref|YP_007068495.1| ..------....-----....--...............------...-...------------
rbN_gi|427720149|ref|YP_007068143.1| ..VGAVLV....TDTANlrt.PH...............YHQ-PS...DipaTIDRPFFLGAAQ
rbN_gi|427717825|ref|YP_007065819.1| ..YPAMMVtdt.AFLRN....PH...............YHK-PS...D...TIATLDLDFLTG
rbN_gi|427716163|ref|YP_007064157.1| hvGRAAC-....LAFPT....QN...............THG--Y...E...IAHLGAIANCIH
rbN_gi|427716185|ref|YP_007064179.1| ..------....-----....--...............------...-...------------
rbN_gi|427715920|ref|YP_007063914.1| ..------....-----....--...............------...-...------------
gi|75908939|ref|YP_323235.1|       ..------....-----....--...............------...-...------------
gi|75908435|ref|YP_322731.1|       ..VSGCY-....FFLGS....ANpdkdlayp.......HHH-PR...F...DFDETALAMGVE
gi|75907282|ref|YP_321578.1|       ..VPGSMFr...LGVGYp...ERiinhp..........LHH-PE...F...EVDESAIVTGVV
gi|75910294|ref|YP_324590.1|       ..VPGCYVr...FGACQ....QGcenip..........LHS-PS...F...DFDEEALKVGAA
gi|75908006|ref|YP_322302.1|       ..------....-----....--...............------...-...------------
gi|75907687|ref|YP_321983.1|       ..------....-----....--...............------...-...------------
gi|75907688|ref|YP_321984.1|       ..------....-----....--...............------...-...------------
gi|75908485|ref|YP_322781.1|       ..------....-----....--...............------...-...------------
gi|75908181|ref|YP_322477.1|       ..IGAVLV....TDTANlrt.PH...............YHQ-PT...DtpsNIEQAFFVGAAQ
gi|75907143|ref|YP_321439.1|       ..YPAIMVtdt.AFLRN....PH...............YHK-PS...D...AIATLDLD----
gi|75909389|ref|YP_323685.1|       hvGRAAC-....LAFPT....QN...............THG--Y...E...IAHLGAISNCIN
gi|75910593|ref|YP_324889.1|       ..------....-----....--...............------...-...------------
gi|75909995|ref|YP_324291.1|       ..------....-----....--...............------...-...------------
gi|298491029|ref|YP_003721206.1|   ..------....-----....--...............------...-...------------
gi|298492645|ref|YP_003722822.1|   ..VPGCY-....FLLGS....ANaaknlnyp.......HHH-PR...F...DFDETALVMGVE
gi|298490648|ref|YP_003720825.1|   ..APGSMFr...LGVGYq...DRsinhp..........LHH-PQ...F...EVDESAIVTGVV
gi|298491800|ref|YP_003721977.1|   ..------....-----....--...............------...-...------------
gi|298490223|ref|YP_003720400.1|   ..------....-----....--...............------...-...------------
gi|298490222|ref|YP_003720399.1|   ..------....-----....--...............------...-...------------
gi|298492458|ref|YP_003722635.1|   ..------....-----....--...............------...-...------------
gi|298492145|ref|YP_003722322.1|   ..------....-----....--...............------...-...------------
gi|298492188|ref|YP_003722365.1|   ..------....-----....--...............------...-...------------
gi|298491532|ref|YP_003721709.1|   ..------....-----....--...............------...-...------------


                                       270                                                          
                                         |                                                          
d1cg2a1                              MAARLIMDL---gag................................................
gi|269926470|ref|YP_003323093.1|   ------------mwqmptfaeyreqldsdiadiansggreagaitgalfikefaedtpwvhld
gi|269926320|ref|YP_003322943.1|   LLSKFMEH----ah.................................................
gi|269925335|ref|YP_003321958.1|   SVAALWLDL---...................................................
gi|269925376|ref|YP_003321999.1|   AYAFLCHRL---t..................................................
gi|269925438|ref|YP_003322061.1|   ILVKALKY----l..................................................
gi|269926083|ref|YP_003322706.1|   LLSSLIL-----r..................................................
gi|269838949|ref|YP_003323641.1|   ------------dpsacsphslevvgrtvlaal..............................
gi|269926500|ref|YP_003323123.1|   ------------pyisdasy...........................................
TLn_gi|427723016|ref|YP_007070293.1| ------------ekageefwkmpmppkyfegmkspiadmkntgpryggsitaalflkefvedt
TLn_gi|427722057|ref|YP_007069334.1| MFVRCVEKF---l..................................................
TLn_gi|427722694|ref|YP_007069971.1| TLAYSAYKY---fq.................................................
TLn_gi|427723545|ref|YP_007070822.1| ------------mtrdtdyfvslagrtqlannanadlfvsihanaislsrpevnglevyyyqs
TLn_gi|427726210|ref|YP_007073487.1| ILEAYC------ndts...............................................
TLn_gi|427724197|ref|YP_007071474.1| ------------glcevi.............................................
TLn_gi|427725916|ref|YP_007073193.1| ------------agdaentagigmfwynahahdlaqflhdelvqnlnrpsygvfwnnlaltrp
TLn_gi|427723370|ref|YP_007070647.1| ------------klqclcldadyvidihsssndgldfvyyfpnretqaswfnfdysilltqgg
TLn_gi|427724429|ref|YP_007071706.1| ------------tdpsvsgatayyiannsdrqgnantvlksllrrvpelssrgakpdtqtglg
Cy2_gi|428218721|ref|YP_007103186.1| ------------nmisgraihpgdiltasngktievnntdaegrltladalvfadkleldgiv
Cy2_gi|428217331|ref|YP_007101796.1| IFVRCVEQFC--...................................................
Cy2_gi|428218965|ref|YP_007103430.1| ------------acaqafaapimihantrdgslrqaaanlgipillyeggealrfdpkaidag
Cy2_gi|428218329|ref|YP_007102794.1| ------------tsdieldleprvqlaervrgdvfvslhansvasrsatvtgietyyapgstr
Cy2_gi|428218498|ref|YP_007102963.1| ------------ltgvcsgl...........................................
Cy2_gi|428218676|ref|YP_007103141.1| LLYAYL------...................................................
Cy2_gi|428218275|ref|YP_007102740.1| ------------wyhpqshdlatflhdylvleldrptygifwnnlalarptvapsvlmefgfm
Cy2_gi|428217320|ref|YP_007101785.1| ------------anlfghsivyftspntlltmafaemcpsitlecgqpgkpegtrhalnylet
Cy2_gi|428217360|ref|YP_007101825.1| ------------pddqlslpetvswinnrgsyrdlaieihmgaydnaslrgvrvyyisfneer
Cy2_gi|428217620|ref|YP_007102085.1| ------------psddlsltgtiswinarasrrdvaleihgnaaadrsangtedfyiagnqer
gi|158336127|ref|YP_001517301.1|   ------------dlatltgacivalgndiagmwtpedslaeelsqaseqagekfwrmpleeky
gi|158335082|ref|YP_001516254.1|   IFVRCVEKFC--...................................................
gi|158334581|ref|YP_001515753.1|   TMANAALNY---wq.................................................
gi|158339037|ref|YP_001520214.1|   ------------rwtqenqenafvsslcqlgfaievgpipqgillaslfketetlihqtldyl
gi|158335668|ref|YP_001516840.1|   ------------drevdlpprvakaegaradvfvsihanaislsrpevngletyyyvtgyrla
gi|158335292|ref|YP_001516464.1|   ------------fvsihanaismsrpdvngletyhapgarlgarlartvhntilrrlrmpdrr
gi|158338092|ref|YP_001519268.1|   ------------lesiyi.............................................
gi|158337208|ref|YP_001518383.1|   TAVNAI------talldr.............................................
gi|158338413|ref|YP_001519590.1|   ------------sgdavntagigafwyhaqshdlavflhhylvddlkrpdygifwdnlaltrp
gi|158336876|ref|YP_001518051.1|   ------------aqtqqilasqlptwlgptqrivhldlhtglgrwtaptflvkpqvhqtdlpw
gi|16330631|ref|NP_441359.1|       ------------nmisgtamhpgdiltasngktievnntdaegrltladalvfaeklgveaiv
gi|16332230|ref|NP_442958.1|       LFVRCVERFC--...................................................
gi|16331842|ref|NP_442570.1|       TLSYAAWQY---wq.................................................
gi|16329830|ref|NP_440558.1|       ------------gltielgpvpqgvydptaiaktqrtlarilaylqastsgnvpaadnctvyq
gi|16330558|ref|NP_441286.1|       ------------qqhrningfisyhtysavilrpyasqadenlpvedlevykilgqkgkeltg
gi|16330376|ref|NP_441104.1|       ------------dyfislqgrtdmanragadlfvsihansmgmgrpdvngfeiyyhgnaglsq
gi|16329723|ref|NP_440451.1|       ------------rnsdifvslqgrvqraaaaradifvsihansiglgrpevngvetyyfqtgr
gi|16330213|ref|NP_440941.1|       ------------defvslvdrqtqiaqvqpaialsihynalpdsgnpnetdgistfwynaqaa
toq_gi|571027785|ref|YP_008899903.1| ------------laqalqkasdrcgekfwqmplenkyfeamksqvadmkntgprsagsitaal
toq_gi|571026933|ref|YP_008899051.1| LFVRCVEKYC--...................................................
toq_gi|571028537|ref|YP_008900657.1| TLAHAACRY---w..................................................
toq_gi|571027463|ref|YP_008899581.1| ------------raranafvsihanaigiarsdvsgletyfapgrssrlavaihnsilsslni
toq_gi|571027813|ref|YP_008899931.1| ------------idldlldrslaiesaqptlalslhynalpdagdarhtqgigafwyhpqshd
gi|22299288|ref|NP_682535.1|       ------------laqalqkasdrcgekfwqmplenkyfeamksqvadmkntgprsagsitaal
gi|22299990|ref|NP_683237.1|       LFIRCVEKYC--...................................................
gi|22297557|ref|NP_680804.1|       TLAHAACRY---w..................................................
gi|22297795|ref|NP_681042.1|       ------------hanaislarpdvngletyfapgrssrlataihksilsslnirdrgvrsarf
gi|22299317|ref|NP_682564.1|       ------------idldlldrslaiesaqptlalslhynalpdagdarntqgigafwyhpqshd
fN9_gi|428220463|ref|YP_007104633.1| ------------nmingnalhpgdiltasngktievnntdaegrltladalvfadklgldaiv
fN9_gi|428222328|ref|YP_007106498.1| IFVRCVEK----f..................................................
fN9_gi|428221241|ref|YP_007105411.1| VLLHTILKL---d..................................................
fN9_gi|428222603|ref|YP_007106773.1| ------------velqprvdiaervnadtfvsihanslearqsqisgietyyapgatlsgrla
fN9_gi|428221486|ref|YP_007105656.1| ------------pdrvcygefar........................................
fN9_gi|428221848|ref|YP_007106018.1| ------------qgdaentkgigtfwyhaqshslamfihnylvkdlnrpsygvfwnnlalarp
fN9_gi|428221485|ref|YP_007105655.1| ------------qglffggkepsqtanileeniqnwigdaqkvihidfhtglgawgtyklfag
qVl_gi|427712524|ref|YP_007061148.1| ------------isgkamhpgdiltaangktieinntdaegrltladalifaeklgvdaivdl
qVl_gi|427712396|ref|YP_007061020.1| IFVRCVERF---f..................................................
qVl_gi|427714252|ref|YP_007062876.1| TLAHAAWKY---w..................................................
qVl_gi|427711704|ref|YP_007060328.1| ------------vamaeraraavfvsihanaismsrpdvngletyyapgrssrlaaaihnsil
qVl_gi|427711553|ref|YP_007060177.1| ------------randqeldlaprvlraeqikarafvsihanslslahpevngletyyyasgl
qVl_gi|427714522|ref|YP_007063146.1| ------------nalpdqgdalntqgigafwyqaqshslalfledylatqlnrprygvfwnnl
qVl_gi|427713716|ref|YP_007062340.1| ------------gkslgqigsegqgadcfvslhlnafnrsaqghevfahtagtsvdvelatki
gi|113954246|ref|YP_731406.1|      ------------kgltfdsggynlkvgaaqidmmkfdmggsaavlgamrsiaelrpqgvevhm
gi|113955421|ref|YP_729363.1|      VLTAAML-----aw.................................................
gi|113954748|ref|YP_731585.1|      ------------lpiylheadqaqqgflveswpcglvievgpvpqmvrhhkiltqtrlaleav
gi|113954650|ref|YP_730754.1|      ------------mtrtaevdvdlpprvsianrvganafvsihanaismarpdvngietffysd
gi|81299999|ref|YP_400207.1|       ------------dlppkfihltyrpestprrklaivgkgltfdsggynikgagsgiemmktdm
gi|81299067|ref|YP_399275.1|       LFLRCVERFC--...................................................
gi|81300780|ref|YP_400988.1|       ------------galtaaaddleiviqgesghgarpheakdaiw...................
gi|81300390|ref|YP_400598.1|       ------------yevigkageeqtgypaigvydnfryhpkeittgvfddwaydhlglfawtve
gi|81301169|ref|YP_401377.1|       ------------rtadidldleprvqiaeqaradifvsihanalsldrpevngletyyyasqa
gi|81300943|ref|YP_401151.1|       ------------rvaiaqraratvfvsihanalsmsrpdvngietyffsaasrplaqaiqdrm
gi|81299525|ref|YP_399733.1|       ------------srkgdediwpqeraaqiqalepdialslhynalpdagdaegtqgigafwyq
gi|81301079|ref|YP_401287.1|       WLQQYL------q..................................................
gi|81300779|ref|YP_400987.1|       TLAYSIWRY---w..................................................
gi|123966726|ref|YP_001011807.1|   ------------vaacenmingsavhpgdvikasngktieinntdaegrltladaltyasnlk
gi|123967035|ref|YP_001012116.1|   VIAGTILK----l..................................................
gi|123965487|ref|YP_001010568.1|   ------------ekdfclaallqhkfglpiylhekdekqtgflveawpcglvieigpvaqnfy
gi|123965916|ref|YP_001010997.1|   ------------mtrnkevdldlpprvsianrtnadvfvsihanasrgkrrdingletfyytg
JuK_gi|428313309|ref|YP_007124286.1| ------------misgtamhpgdiltasngktievnntdaegrltladalvfaeklgvdaivd
JuK_gi|428311057|ref|YP_007122034.1| IFVRCVEKFC--...................................................
JuK_gi|428309062|ref|YP_007120039.1| TMAYTIYQYW--qk.................................................
JuK_gi|428312940|ref|YP_007123917.1| ------------qygqksavlrslcelsfsieigpvyqgvldasffnkteelihvildyleay
JuK_gi|428309925|ref|YP_007120902.1| ------------tsdyfvdlaprvtmaeranadlfvsihanaislnrsdvsgletyyyssgqr
JuK_gi|428310093|ref|YP_007121070.1| VVAGLER-----aiadl..............................................
JuK_gi|428313512|ref|YP_007124489.1| ------------ddrfislagrvqmarqaranvfvsihanaislrrpevngvetyyfssqrla
JuK_gi|428309552|ref|YP_007120529.1| ------------ssdyfvdlaprvemakreradlfvsihansidkrpdvngletyyfergerl
JuK_gi|428313083|ref|YP_007124060.1| ------------dkdvslqdrvamidklqpaiaisvhynslpdngdaentqgigtfwyntqah
JuK_gi|428310554|ref|YP_007121531.1| ILNAY-------cq.................................................
JuK_gi|428310231|ref|YP_007121208.1| ------------rvdvfvsihfnsfnrqangteiftgsdtgrriaqpvldnivklgffnrgvk
JuK_gi|428312499|ref|YP_007123476.1| ------------sreesanaflldygilmneydgdafdeafmkpwlaleknlaalgnkikfdi
JuK_gi|428313236|ref|YP_007124213.1| ------------rgttafyiannterkkhaellllalvrrlpqlpnrgakpdtatgigriafs
JuK_gi|428313477|ref|YP_007124454.1| ------------swinnrvlpsdvaielsgnafngsvrgtevfyidgneerkkaaqllleefl
JuK_gi|428311704|ref|YP_007122681.1| ------------gslrilglkasgfdvfcsvhhnalrkgqntaqrseafshatkgekpdqela
gi|113473990|ref|YP_720051.1|      ------------gagttfgtikaiaqlkpdvevhfisavtenmvsghaihpgdfltasngkii
gi|113475511|ref|YP_721572.1|      MFIRCTE-----kf.................................................
gi|113477163|ref|YP_723224.1|      VLAYAAYKY---whn................................................
gi|113478073|ref|YP_724134.1|      ------------lvqisldfiehfnegkldhinrdiviykhlkvvdypktkdgeivamihpql
gi|113476499|ref|YP_722560.1|      ------------syctypdehfpvkdleiykligekgtaitgyecisiyhnflypnsekiygg
gi|113474224|ref|YP_720285.1|      ------------ktdrdldlpprselanrvgadlfvsihanaismsrpdvngletfyyqsgqv
gi|113477463|ref|YP_723524.1|      ------------gigtfwyhsqahslaiflhnylvekldrpsygvfwnnlaltrpaiapsvll
gi|113476944|ref|YP_723005.1|      ------------ssnqsldyfycfhgreesaksflfdygilvlegeyegntfdegflkpwlal
gi|113474394|ref|YP_720455.1|      ------------alaiilkygfvavkqavangqydfpkglffggielqeelvnykewllknlp
HFg_gi|428224156|ref|YP_007108253.1| ------------nmisgramrpgdiltasngktievnntdaegrltladalvfadklgldaiv
HFg_gi|428226397|ref|YP_007110494.1| IFARCVEAF---c..................................................
HFg_gi|428224388|ref|YP_007108485.1| TLAYAAYQF---w..................................................
HFg_gi|428223916|ref|YP_007108013.1| ------------shpetrrcaqafgaplmihaavrdgslrqaaanlgipvllyeggealrfde
HFg_gi|428226743|ref|YP_007110840.1| ------------rrddreidlaprvsaaeraradvfvsihsnslsmsrpdvngietyyydsgk
HFg_gi|428224382|ref|YP_007108479.1| ------------trrenidldleprvalaervnatlfvsihansismsrpdvngletyyyasg
HFg_gi|428223590|ref|YP_007107687.1| ILKGFC------et.................................................
HFg_gi|428224655|ref|YP_007108752.1| ------------ltlvcqgmi..........................................
HFg_gi|428226160|ref|YP_007110257.1| ------------ynalpdsgdaentqglsafwyhpqahslavflhnyltetldrpsygvfwnn
HFg_gi|428226051|ref|YP_007110148.1| IVVNAV------tsi................................................
HFg_gi|428224780|ref|YP_007108877.1| ------------arstdvaleihadafsnpsvrgasafyiaynaerrnhaelillallrrvpq
gi|257061661|ref|YP_003139549.1|   ------------nmisgraihpgdiltasngktievnntdaegrltladalvfaeklevdaiv
gi|257062162|ref|YP_003140050.1|   MFVRCVEK----f..................................................
gi|257059081|ref|YP_003136969.1|   TLAYSVYKY---wq.................................................
gi|257058278|ref|YP_003136166.1|   ------------qenlllrsltelgfaievgavaqgvldaalfqqteqliyhlldglekynqg
gi|257060857|ref|YP_003138745.1|   ------------cvsiyhgfryhsqdftygamddyaydhfgwfgftielwdiat.........
gi|257061491|ref|YP_003139379.1|   ------------dasvslkgrveqaetananvfvsihanavggnnsqvngletyyyssgyrla
gi|257058498|ref|YP_003136386.1|   ------------vsihanavgggrtevnglevyyhgnreladaihrsirrtvnirdrgvrqar
gi|257060846|ref|YP_003138734.1|   ------------kdvslqervnlinklqptlslsihynalpdggdamntdgigmfwyhpqaqd
gi|257057955|ref|YP_003135843.1|   LLARLL------i..................................................
5BT_gi|434391707|ref|YP_007126654.1| ------------laqqlaqaaeaageklwrmpfeekyfeglksgiadfkntgprgggsitaal
5BT_gi|434395368|ref|YP_007130315.1| IFVRCVENF---...................................................
5BT_gi|434393016|ref|YP_007127963.1| TLAYSAWKYW--qq.................................................
5BT_gi|434392062|ref|YP_007127009.1| VLLQTFLKL---d..................................................
5BT_gi|434395507|ref|YP_007130454.1| VASVMTMELL--n..................................................
5BT_gi|434391636|ref|YP_007126583.1| ------------sdyfldlaprvaiaeranadifvsihansmglsrpdingletyyfssgqrl
5BT_gi|434395491|ref|YP_007130438.1| VALNVLQ-----ql.................................................
5BT_gi|434391354|ref|YP_007126301.1| ------------lnldflagv..........................................
5BT_gi|434391607|ref|YP_007126554.1| ------------sgdamntqgfgafwyhpqahnlavflhnyvvnklrrpaygvywnnlaltrp
5BT_gi|434395336|ref|YP_007130283.1| LLQAFC------e..................................................
5BT_gi|434391236|ref|YP_007126183.1| ------------lidlhtssdrgldylyyfprrelsaqyflldygillddydgdafdeafikp
5BT_gi|434391792|ref|YP_007126739.1| ------------ahcispglffyvgnt....................................
5BT_gi|434395419|ref|YP_007130366.1| ------------vfelhtynhlrfgpdslpadprynpeinigtgtlnrqrwapvidrftqdlr
gi|284929626|ref|YP_003422148.1|   ------------nmisgcaihpgdvltasngktievnntdaegrltladalvfaeklevdsil
gi|284928900|ref|YP_003421422.1|   TLAYTAYKY---w..................................................
gi|284929040|ref|YP_003421562.1|   ------------sfdeaflkpwlalqkefkrlgkeieidreswtlelgsgmemepksvsvgfs
8V2_gi|428775164|ref|YP_007166951.1| ------------hfisaatenmisghamhpgdiltasngktievnntdaegrltladalvfte
8V2_gi|428777931|ref|YP_007169718.1| MFVRCVEKL---...................................................
8V2_gi|428776138|ref|YP_007167925.1| ------------dlhtasdhrtnfpqiranlkdeetyrcakafgapvmihattrdgslrqaaa
8V2_gi|428777938|ref|YP_007169725.1| ------------temanradadlfisihanaismsrpdvngtetfyyangralaqaiqrsils
8V2_gi|428777493|ref|YP_007169280.1| ------------fltgvceg...........................................
8V2_gi|428778337|ref|YP_007170124.1| ILAHFA------t..................................................
8V2_gi|428777769|ref|YP_007169556.1| ------------nalpddgdaintsgigafwynppahdlavflhnylveelnrdsygvfwntl
8V2_gi|428775818|ref|YP_007167605.1| ------------aflldvgirvdqpsgytfdeafikpwlvleetfrklgrnikfnvaswtlel
gi|166368941|ref|YP_001661214.1|   ------------nmisgramhpgdiltasngktievnntdaegrltladglvfaeklevdaiv
gi|166365183|ref|YP_001657456.1|   IFVRCVEKFCN-s..................................................
gi|166366573|ref|YP_001658846.1|   TLAYAAYKYW--qr.................................................
gi|166362930|ref|YP_001655203.1|   ------------kinpdvrliyhpvseeenhflkgicplaftleigpvnhgvicpylfrqtet
gi|166364322|ref|YP_001656595.1|   ------------mykyiadkgkamtgyecvsvyhdfryhpkevtngamddygydhfgwygftv
gi|166368299|ref|YP_001660572.1|   ------------trdsdffvtlqgrtdlanridadlfvsihansmgkarpdvnglevyyfgdr
gi|166366765|ref|YP_001659038.1|   ------------trvcqg.............................................
gi|166368835|ref|YP_001661108.1|   ------------dgdalntqgigifwyhpqaadlsvflhdyltknlnrpsygvfwnnlaltrp
gi|166366493|ref|YP_001658766.1|   ILEAYC------q..................................................
gi|166363064|ref|YP_001655337.1|   ------------afnkkavgaevygisqtsqaiaksvlteivklgfknrgvkntrfsvlvnts
gi|166366413|ref|YP_001658686.1|   ------------hhnatdrkphytcvmvhptkakpksiafakklstsvanaigqrdfgvmeng
gi|37522180|ref|NP_925557.1|       ------------mvsghaihpgdiltasngktievdntdaegrltladalvfseklgvdaivd
gi|37519943|ref|NP_923320.1|       LFVRCLERF---w..................................................
gi|37522109|ref|NP_925486.1|       ------------mtlaaaavsyw........................................
gi|37520936|ref|NP_924313.1|       ------------ayferfidpgyrygttlaqttgrlvlraanaev..................
gi|37523992|ref|NP_927369.1|       KFNRIIEGL---lvrvanq............................................
gi|37520534|ref|NP_923911.1|       ------------rsarlayvlhrrlvertgkpdrgvrvrglyvtrhnavpavllevgfltnpe
gi|37520091|ref|NP_923468.1|       ------------plrqygtsvywyhmqsrelaevlhrqllrdlgrpdyglywdslavirptaa
gi|37522227|ref|NP_925604.1|       ------------k..................................................
gi|37522043|ref|NP_925420.1|       ------------nlnrdflkadtpemrvwlnvferylpdlivdthdtdgadyqynltygletg
gi|37523548|ref|NP_926925.1|       ------------mlavgvlsggpvvavpnrplqanefnivyinaetgglflprpslnlgdrlk
gi|37523547|ref|NP_926924.1|       ------------prvqvyhsqpraldltktlglpvvwvrrhstaktahcyelpvrtqgtlahn
gi|37520329|ref|NP_923706.1|       ------------srvlfrqwfpqimynhhqtgpvgtilfappfrdpfnyvydplipmqldlvg
gi|37520932|ref|NP_924309.1|       ------------nlasveradlflsihfngfnkqtsgvetyirartngnvnfeedeafawriq
ADw_gi|427733727|ref|YP_007053271.1| ------------nmisghamhpgdvlkasngktievnntdaegrltladalvfadklgldaiv
ADw_gi|427739887|ref|YP_007059431.1| MFVRCVEKY---f..................................................
ADw_gi|427738968|ref|YP_007058512.1| TVAYAAYKY---w..................................................
ADw_gi|427737605|ref|YP_007057149.1| ------------hpyllrlsaylteinpkvkvlqyapnqkpchlrslaelgiaievgaiangl
ADw_gi|427737907|ref|YP_007057451.1| ------------knsshlrslaelgitievgavangildaklfqetekliysildyiqaeeke
ADw_gi|427736327|ref|YP_007055871.1| ------------ryvvdlnrqakeplfgsfwsavipentafnksiyqnqptdkeikariekyy
ADw_gi|427735146|ref|YP_007054690.1| ------------nsdffvslkgrvvmaerrdadlfvsihanslglsrpdinglevyyynsgkr
ADw_gi|427735148|ref|YP_007054692.1| ------------dmaergnadlfvsihansvglsrpdvsglevyyyssgynlarsvrsgilns
ADw_gi|427734182|ref|YP_007053726.1| VVAGL-------ek.................................................
ADw_gi|427738036|ref|YP_007057580.1| LIV---------nat................................................
ADw_gi|427737291|ref|YP_007056835.1| ------------nalpdygdaentkgigmfwyhpqahslaiylhnylvkkldrpsygvfwnnl
ADw_gi|427733824|ref|YP_007053368.1| LLKEFCES----md.................................................
ADw_gi|427734438|ref|YP_007053982.1| ------------ltgvcrg............................................
ADw_gi|427737664|ref|YP_007057208.1| ------------ckpaksdsvgdslrqrcakansskvdifvsihfnafngfangtevfaasdt
ADw_gi|427735400|ref|YP_007054944.1| ------------gtevyaistkgkaiarkvvnnisalgyynrgvkhkafhvlrytsmpailve
ADw_gi|427736713|ref|YP_007056257.1| ------------rtlaqavldkivalgfrnrkvktanfavlkytnmpailieccfltndedmk
ADw_gi|427735785|ref|YP_007055329.1| ------------nafssprangsevyvydlrsaarplaqsvvsniaslgffnrgvkkarfrvl
ADw_gi|427733974|ref|YP_007053518.1| ------------qpqylaesffkcisivnilennr............................
ADw_gi|427735097|ref|YP_007054641.1| ------------stnqglnylyyfrdreesakfflldfgilldeydgdafdeafikpwlalee
ADw_gi|427734372|ref|YP_007053916.1| ------------lsarasiqwinsrarrndvaveihadaaaspavngasvyyiannevrkgna
ADw_gi|427738248|ref|YP_007057792.1| ------------digktaadydvfcsihhnsakrdtqgaevlvhhnkadtqdlelaslmsaei
rbN_gi|427718504|ref|YP_007066498.1| ------------nmisgkamhpgdilkasngktievnntdaegrltladalvfadklgvdaiv
rbN_gi|427717245|ref|YP_007065239.1| IFVRSVEKF---l..................................................
rbN_gi|427716398|ref|YP_007064392.1| TMAYAAYKYCQ-q..................................................
rbN_gi|427716007|ref|YP_007064001.1| ------------yrcsfpsvadnpflnslcelgfaievgpiaqgilraslfqqteelihtile
rbN_gi|427716207|ref|YP_007064201.1| ------------arnsdyfvslpgrvemaakaratvfvsihansagagrpdvsgletyyydsg
rbN_gi|427716208|ref|YP_007064202.1| ------------rdadffvelqgrvdiaqrvnatlfvsvhansvdarpdvnglevyyydsgyd
rbN_gi|427720501|ref|YP_007068495.1| ------------rdlslaerqaiiskaepaialsihhnslpddgdaqnikgfsafwynpqahn
rbN_gi|427720149|ref|YP_007068143.1| IVVNATARLL--d..................................................
rbN_gi|427717825|ref|YP_007065819.1| ------------vceglavgirr........................................
rbN_gi|427716163|ref|YP_007064157.1| LLKAFCE-----s..................................................
rbN_gi|427716185|ref|YP_007064179.1| ------------sastvrdslskrcdkanaskvdiyvsihfncfngqangtevfaisntsnki
rbN_gi|427715920|ref|YP_007063914.1| ------------nsrgrstdvaleiqsnaassptvrgasvyyiatnsdrksnaelllvgllrr
gi|75908939|ref|YP_323235.1|       ------------nmisgkamhpgdiltasngktievnntdaegrltladalvytdklgldaiv
gi|75908435|ref|YP_322731.1|       IFVRCVEKFF--n..................................................
gi|75907282|ref|YP_321578.1|       TMAYAAYKY---l..................................................
gi|75910294|ref|YP_324590.1|       FFDRVVR-----e..................................................
gi|75908006|ref|YP_322302.1|       ------------lfqkteqliytildyvekynqgnipkinnllslykftgtidyprngngdiq
gi|75907687|ref|YP_321983.1|       ------------arnsdyfvslpgrvqmaervgadvfvsihansagagrpdvsgletyyydsg
gi|75907688|ref|YP_321984.1|       ------------eranatlfvsihansvdgrpdvnglevyyydsgyalaetvrktilqsigtl
gi|75908485|ref|YP_322781.1|       ------------ngdaentkgvgtfwynaqahslavfmhnylvnklrrpsygvfwnnlaltrp
gi|75908181|ref|YP_322477.1|       IVVNAV------ntl................................................
gi|75907143|ref|YP_321439.1|       ------------fltgvcegleisir.....................................
gi|75909389|ref|YP_323685.1|       LLKAFC------e..................................................
gi|75910593|ref|YP_324889.1|       ------------hfnafngqangtevfatsdngrriakpvldeiiklgyfnrgvksgshlfvl
gi|75909995|ref|YP_324291.1|       ------------sasspavrgasvfyiasnnerksngelllvgllrrvpqlpnrgvkpdtdsg
gi|298491029|ref|YP_003721206.1|   ------------nmisgramrpgdiltasngktievnntdaegrltladalvyadklgvdaiv
gi|298492645|ref|YP_003722822.1|   MFVRCVEKY---f..................................................
gi|298490648|ref|YP_003720825.1|   TLAYAAYKY---w..................................................
gi|298491800|ref|YP_003721977.1|   ------------glaaylsainplvkvyihqqarnsgflrslcqlgfsievgavaqgtldgel
gi|298490223|ref|YP_003720400.1|   ------------trdsdyfvslpgrvemaeranadvfvsihansaganrpeisgletyyydng
gi|298490222|ref|YP_003720399.1|   ------------rdadffvelqgrvdiakrvnailfvsihansvdsrpdvnglevyyydsgyd
gi|298492458|ref|YP_003722635.1|   ------------daektkgfgafwyhpqshspavflhnyvvkklrkpsygvfwknlaltrpsi
gi|298492145|ref|YP_003722322.1|   ------------ieccfidsakdmqlydgeamasaivtgltg.....................
gi|298492188|ref|YP_003722365.1|   ------------rgagvfyiannnqrkqnaemvlmgllrrvpqlpnrgvkpdtdsglgslqfc
gi|298491532|ref|YP_003721709.1|   ------------ad.................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   iagtawnnkdlphiakgptgvatatltk...................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| pwvhldiagpawsdkesdiyskggtgfpvrtlvhwvl..........................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| gkklaqtihrnilgqirmrdrgvrtarfyvlrhtampsvlvevgfvtgredapnlsspafrsr
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| heapsvllelgfminptefewitdpqaqdqlaqaiataievwlq...................
TLn_gi|427723370|ref|YP_007070647.1| dyafdeafiwpwivlekafaetgqkiklavdgctlelgsgmkmrpssvakglasiknylahrg
TLn_gi|427724429|ref|YP_007071706.1| rlpfcrevvipsilldvgfltspsdrtllinrrkdfalgiaeglaawl...............
Cy2_gi|428218721|ref|YP_007103186.1| dlatltgacvvalgdeiagmwsndddlagtihaaaklagekfwrmpleepyfeamksvvadfk
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| vrgilrvmaslgmyeltgddlavpesrrveqtkwlrsprsgllharftlgqqvnkqqllaevt
Cy2_gi|428218329|ref|YP_007102794.1| grrlaalvhsqviaatgavdrrvrsarfyvlrrtsmpailvetgfvtnpgdaarlrdpnyqqr
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| inpeefewiidpqaqqelakttadgiaawl.................................
Cy2_gi|428217320|ref|YP_007101785.1| claldtipttpvtdidlfhtvaivkipehisfgfgdpacepiaidlcfpidldrlnfqelpvn
Cy2_gi|428217360|ref|YP_007101825.1| qqhaelmleslligvpqlasrgikpdsatalgrlafcrdiaprslfielgfisnptdlrllqt
Cy2_gi|428217620|ref|YP_007102085.1| krhgelliasllrrvpelrnrgakpdtaaavgrlafcrdiippslllelcflsnpsdlrllqt
gi|158336127|ref|YP_001517301.1|   feglkspiadmkntgprpggsitaalflkqyientpwahldvagpvwtekengylnvgatgfa
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   eqvnrgaspplpktltlfqhlevvdypktsngelagmihpqlqgrdyqplnpgdpifltfedq
gi|158335668|ref|YP_001516840.1|   raihtsirrtvsvgdrgirqarfyvlrkssmpaalvelgfvtgstdaaklrtaahrkrlaeai
gi|158335292|ref|YP_001516464.1|   vrparfyvirktsmpailvetgfltgaqdivrlrnpawrkqmaqaiaqgilnyln........
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   tvaptvlmelgfminptefewitdpkaqkqlavsmadaiaawf....................
gi|158336876|ref|YP_001518051.1|   fqqtftaeglqilgqqgatyicqgdigpwcqalmqdcdyrfatvefgt...............
gi|16330631|ref|NP_441359.1|       dlatltgacivalgddigglwspnqeladelkvaadkagekfwqmpmeskyfeglkspiadmk
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       qidtidyprdeqgqivaeiaphirdyqaikpgtplfyhrrgnvtpyqgaatvypvfigeaayv
gi|16330558|ref|NP_441286.1|       yncisayhdfryhpkeviygvmddyaydhygwfgftvelwdapt...................
gi|16330376|ref|NP_441104.1|       aihrnvvnslnvrdrrvrqarfyvlrnsrmpstlvemgfvtgnednykltdpnfqqqmaqaia
gi|16329723|ref|NP_440451.1|       slaqtihrsilqrlnvrdrrvrqarfyvlrrtsmpstlvevgfvtgsqdsrnlsnprfqqqma
gi|16330213|ref|NP_440941.1|       dlanflqrylvenlgrnshgvywnnlaltrptiapavllelgfmispqefewitnaqaqeqlv
toq_gi|571027785|ref|YP_008899903.1| flqqfvdhtpwahldiagpvwtekedgynnpcgtgypvrtlvewlcs................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| rdrgvrsarfyvirntsmdstlvetgfvtgaedaanfqnptwrtqmaraiaqgilnfln....
toq_gi|571027813|ref|YP_008899931.1| lavflesyltqrlrrqhygvfwnnlaltrptiapavllelgfmihpeefewivnpqaqgelar
gi|22299288|ref|NP_682535.1|       flqqfvdhtpwahldiagpvwtekedgynnpcgtgypvrtlvewlcs................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       yvirntsmdsalvetgfvtgaedaanfqnpawrtqmaraiaqgilnfln..............
gi|22299317|ref|NP_682564.1|       lavflgnylsqqlrrpqygvfwnnlaltrptiapavllelgfmihpeefewivnpqaqgelar
fN9_gi|428220463|ref|YP_007104633.1| dlatltgaiiislgttmagywanddelatkietaastagekfwrmpleesyfdkmksvvadfk
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| nfvhnqiinttgasdrgvrtarfhvirrtsmpsilvetgfvtnpqesanlnnpsyqermagai
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| tvapsvllelgfminpeelewiinpveqkklakslsdaiaqw.....................
fN9_gi|428221485|ref|YP_007105655.1| evdnpqkiqsltaqfgvdkietwtpqgisypirgglgkwcktkfpqcdydfltaefgtyptlk
qVl_gi|427712524|ref|YP_007061148.1| atltgacivalgesiaglwatdqpladhlltaanqagekfwqmpmeekyfegmkspiadmknt
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ssvnirdrsvraarfyvirntsmpaalvetgfvtgaedaanfnspawrsqmaqaiargilqfl
qVl_gi|427711553|ref|YP_007060177.1| plaqaihrsilsqvqirdrgvkqarfyvlrntsmpavlvevgfltgredgirlaqstyrqama
qVl_gi|427714522|ref|YP_007063146.1| altrptvapavvlelgfminpwefewitdetsqkqlaktlgdgiqawl...............
qVl_gi|427713716|ref|YP_007062340.1| ndaldkalpitnrgvkraglgvlsgvplpvpavlvesffidsvpdiqtldqwtndaakaiaeg
gi|113954246|ref|YP_731406.1|      lvascenmingsavhpgdivtasngttieinntdaegrltladalvyaselepdaivdlatlt
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      leacsdalagraryprqlvvhrhlgsldlprsqsgspdaflhplrqgsdwqplrdgdplflka
gi|113954650|ref|YP_730754.1|      rrsarlathlqrqmlnvspgspnrgvkrgrffvirrttmpsalvemgfvtgnidsprlasssh
gi|81299999|ref|YP_400207.1|       ggaaatlgaakaiglikpdvevhfisavtenmisgrgmhpgdiltasngktievnntdaegrl
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       iwspq..........................................................
gi|81301169|ref|YP_401377.1|       gerlartihqsilssvsirdrgvrqarfyvirrttmpavlvetgfvtgsedsrnlanpnhrrk
gi|81300943|ref|YP_401151.1|       mqffpdmrnrgvkqarfyvirqttmpsslvevgfvtgaedaprladptfraqmsqaiaagild
gi|81299525|ref|YP_399733.1|       dqsqdlarslhdslvsrlqrpsygifwnnlaltrptvapsvllelgfminprefewivdldaq
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   pdsiidlatltgaivvalgndvagfwtnnhlmaedlkiassqagealwqmplqksykdglksh
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   dpkiinrfliiisslreeinklknkqkqlpklvivhvhqgsidyprgedgninalihpkrmnq
gi|123965916|ref|YP_001010997.1|   wrgrllakkiqkqilkvspgspdrgvrqgrffvikntrmpavlveigfltgrldarrleksih
JuK_gi|428313309|ref|YP_007124286.1| latltgacivalgndiggiwatddtvasqlkaaaeaagekfwqmpmeekyfeglkspiadmkn
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| nqgkvlhrssaftlyqyvgtidyprnkngeiqamihpqlqgkdyeelnpgepifltfenqvit
JuK_gi|428309925|ref|YP_007120902.1| laqtihnsilqsldvkdrgvrrarfyvlrkssmpsvlvevgfvtgredaaklsnsayrsqmaq
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| eaihssmlqslnvrdrrvrrsrfyvlrnnsipavlvevgyvtgaedaprlaspafqrqmaeai
JuK_gi|428309552|ref|YP_007120529.1| aqtihnsilqsldikdrrvrrarfyvlrnnpmpavlvevgfvtgvedaprlataayenqmaqa
JuK_gi|428313083|ref|YP_007124060.1| slavflhnylvkklerpsygvfwnnlaltrpattpsvllelgfmsnpvefewvtnpkeqpkla
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| sglhlyvvkntnmpailveccfcdaqqdmnrynpdslsdaivrgltg................
JuK_gi|428312499|ref|YP_007123476.1| eswtlelgsgmqmnpesvkkgvlgiknylaqkgvlelpnlpvagrdshpikltkknqikkyya
JuK_gi|428313236|ref|YP_007124213.1| rdtilpsillevgflsnpddrsllqnrrrdvalgiadglaaws....................
JuK_gi|428313477|ref|YP_007124454.1| ekvpelrlgkplsrgvkpdtlsaknqlpfcrdvaassvifklcfldnpedlkllqnnrdrfak
JuK_gi|428311704|ref|YP_007122681.1| smisaemsktlglidggakqanlgvlsgaedtnvraavlaevyfid.................
gi|113473990|ref|YP_720051.1|      evnntdaegrltladalvfaeklgvdaiidlatltgacvvalgndiaglwspndnlaaeitaa
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      qgrdyqklspgepmfltfdnqtiyyqeespvwpvfineaayyekgiamcltkkes........
gi|113476499|ref|YP_722560.1|      mvdycydrfgwfgfsielwdap.........................................
gi|113474224|ref|YP_720285.1|      laqyiqnsmleafptmnnrgvkrarfhvlrhtkmpaalvevgfvtgnydsriladpgqrsrma
gi|113477463|ref|YP_723524.1|      elgfminpyefewimnsqeqqklakaladgivew.............................
gi|113476944|ref|YP_723005.1|      erhlkklgkpiqfdieswtlelgsgmkmnpesvtkgirglknylankkllkipefplkeladh
gi|113474394|ref|YP_720455.1|      lvknicaidvhtglgrfaddlllieencshsdleklqkhfgkeriktlnpnksvaysikgsis
HFg_gi|428224156|ref|YP_007108253.1| dlatltgacvialgndvaglwstsdaiadqlkqaadqageklwpmpmedkyfdglkspiadmk
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| eaiaagvtgilrvmaalemqadwpgpaaapsieiqqtrwvrsphsgilhrqvklgqcvqrqqv
HFg_gi|428226743|ref|YP_007110840.1| klaesihssllqstnardrgvrtanfyvikntsmpavlvevgfvtgkedsvrlsdansrkqma
HFg_gi|428224382|ref|YP_007108479.1| erlartihnvmvqetgardrgvrqarfyvlrrtsmpavlietgfvtgsedaanlsrpeyrsrl
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| laltrpavapavmlelgfmihpeeyewivdpeaqedlaeaiaegvsrw...............
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| lpnrgakpdtetavgslafcrnvaapslllevgfltnpddrfllqnrrrdmalgiadglaaw.
gi|257061661|ref|YP_003139549.1|   dlatltgaciialgdnisglwstdqtladqlkaaaetagekfwqmpleekyfeglkspiadmk
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ddfngcksltlyqvieridyprtgeditamihpdlqfkdyhplhpgdplfvtfegetihyqgd
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ltihnnllrkvnvvdnrgvkqarfyvlrkssmpaalvevgfvtgsidnrnlsnpsyrqqlaea
gi|257058498|ref|YP_003136386.1|   fyvlrtsrmpsslvevgfvtgaednanlsnpayrqqmaqaiaqgildyiq.............
gi|257060846|ref|YP_003138734.1|   lsvflhdylteklnrpsygvfwnnlaltrphstpsillelgfminpnefewiindqeqqklak
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| flkqfvketpwahldiagpvwtdkengcsnpgatgygvrtlvhwvl.................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| aqvihrnivrrvtvrdrgvrrarfyvlrkssmpsvlvevgymtgrednprlrnpayqtqmaea
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| asapsvllelgfminptefewivdpqaqrnlaaaiaegitewf....................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| wlalentfqqlgreivfdveawtlelgsgmqmqpqsvekgvagvknyllhkgilainntkaia
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| afnflgrhldvreninfsggyfprwvhqtfpdsacvlsievkk....................
gi|284929626|ref|YP_003422148.1|   diatltgacivalgdnisglwstdnnlineikiaseksgeqfwqmpmedkyfeglkssiadmk
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   giknylvqkeilklydyslnktkielvprekiknyyaptggmiqnrlslktqvkegdrlyqii
8V2_gi|428775164|ref|YP_007166951.1| klgvdaivdlatltgacvialgddiaglwstddllaeqlktaseiggekiwqmpledkyfegm
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| kkgipillyeggealrfdseairvgtqgilgvmrilgmttfpvitpfssvevektkwvrasrg
8V2_gi|428777938|ref|YP_007169725.1| kinmrdrgvkkanfyvlrnsampavlvevgfvtgredaprladpnfrqrmadaiadgilqyv.
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| altrphttlavllelgfminptefewvmnpaaqeklagtiadgvevww...............
8V2_gi|428775818|ref|YP_007167605.1| gsgmraqpesvakgvrgiknylvsqgivkipdfslqatqnhtvqfvqkeqiqkyyaptggiiq
gi|166368941|ref|YP_001661214.1|   dlatltgacvialgddiaglwssdeslaaqiqeaaklagekfwpmpleekyfegmksqiadmk
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   liyqildyieqenylaahldtfsesltvyqrlgsidyprdeqgeikamlhpqilqrdyqaiqp
gi|166364322|ref|YP_001656595.1|   elwdapt........................................................
gi|166368299|ref|YP_001660572.1|   rlsdtihrnivrsvdmrdrgvrrarfyvlrtsrmpstlvevgfvtgaedaaklanvnfqrqma
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ysspslllelgfmsnpqefewitdpqaqkqlaqvlaagisqwfq...................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   mpailieccfvdsqadmdlfdaekmaeaikvglig............................
gi|166366413|ref|YP_001658686.1|   vtvlsesedtncpicvlcesyfldaidtraeaeklsteaayaiastv................
gi|37522180|ref|NP_925557.1|       latltgacvvalgndiagllteneelarqiraageasgekfwqlpmeesyfegmksvvadmrn
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       eraqlqqpeyqeliadaiaqglqdy......................................
gi|37520091|ref|NP_923468.1|       pavllelgfmthpdeytlitapayqeriaraltrglerwl.......................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       asldpalvawqkvafegeifpavagrghvvspyiilrdskdvskgitqdpseprfstgygalq
gi|37523548|ref|NP_926925.1|       rgsrvgqvidplsgqeaeviapldghlftlrvhplvyagslvarlv.................
gi|37523547|ref|NP_926924.1|       lsqagvdvlviragggqaiepeyctrvfaglvrlmlhmgivlgpppeppgtasprvvtgtavq
gi|37520329|ref|NP_923706.1|       gamhtrfaaegkpgstmvdgagfstwwngglrttvyfhnmigllseingsptpieipfvpdrq
gi|37520932|ref|NP_924309.1|       gavlgalrtylpgtrdrgvkedtasgggvlgvlddralgnssqeypcraclveiefidvprvd
ADw_gi|427733727|ref|YP_007053271.1| dlatltgacivalgneiaglftpndelaselqkasesagekfwrmpmedkyfeglksgiadmk
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ldaklfqetedlihatldyleadrkgqslaapgnltfyrvsekvdyprnqdgeieamihpqlq
ADw_gi|427737907|ref|YP_007057451.1| kplsvppsftyysaigtvdfprdeqdkikamihpqlqfkdyqplhpgnpmfvtfdgkeifyqg
ADw_gi|427736327|ref|YP_007055871.1| lpyhhqlkslleekmerfgkvylldlhsfcglidddiclgnlnnqtcseflistvdksftnqg
ADw_gi|427735146|ref|YP_007054690.1| ladavrkgitrkvkvrdrgirrarfyvlrktsmpailvetgyvtgredaaklkqtwyrnkmae
ADw_gi|427735148|ref|YP_007054692.1| vsvrdrgvrkarfyvlrktsmpailvetgyvtgredaaklaspqyreqmaqgiangilsyi..
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| altrpeaapslllelgfmsnpeefewvnnpkqqkklartladgivkwl...............
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| gkkiakpvldeilkmgffnrgvkngshlfvmkntnmpailveccfidsakdmklfnsesmana
ADw_gi|427735400|ref|YP_007054944.1| ccfcdswrdmnlfdadkmaqailrgll....................................
ADw_gi|427736713|ref|YP_007056257.1| lfdaekmataivdglvg..............................................
ADw_gi|427735785|ref|YP_007055329.1| eltampailieccfissdkdmrlfnaekmataivdglvg........................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| cflqlgrtikfdveawtlelgrgmemipdsvakgvrgiknylkqkgvlsndfqlddipqrnhd
ADw_gi|427734372|ref|YP_007053916.1| emllmgllrrvpqinsrgvkpdtstgmgrlmftrevaiasllmqviflsspddrallqsrrre
ADw_gi|427738248|ref|YP_007057792.1| adelgisdriakgrnprsklkvlsgakdtnvrvavlaelyfihvsvpnnqdwttrggeaiara
rbN_gi|427718504|ref|YP_007066498.1| dlatltgacvvalgedmaglfspddavasqlekaaagsgekiwrmpmeekyfeglksgladmk
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ylekfnlgeieltnipltiyqhlevvdypknedgaitamihpelqdrdyqalnpgdpmfltld
rbN_gi|427716207|ref|YP_007064201.1| lnlartvhksilqslnirdrgvrrarffvlrkssmpsilvetgyltgredvaklqtsayqnqm
rbN_gi|427716208|ref|YP_007064202.1| lanvvrqtilneigtikdrgtrkarfyvlrksampsilvetgymtgrednprlaspeyqnrma
rbN_gi|427720501|ref|YP_007068495.1| lalflhnyivknlkrpsygvlwdnlaltrptaapsvllelgfmsnpdefdgivnpqeqqkmak
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| akpvldeivklgffnrgvksgshlfvlrntnmpailvegcfldskkdmdlynpeamanaivkg
rbN_gi|427715920|ref|YP_007063914.1| vpqlpnrgvkpdtdsglgklifcrqvaiaslamqvgflsnpddrallqsrrrdfalgiadgla
gi|75908939|ref|YP_323235.1|       dlatltganvialgddiaglytpddalagqleqaasesgekiwrmpleekyfeglksgiadmk
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       amihpdiqfrdyaplnpgdplfltldgkaiayegtsivypifineaayyekgiamlftekqli
gi|75907687|ref|YP_321983.1|       lslarvvhssilrnvnvrdrgvrrarfyvlrkssmpsilvetgyltgrddaaklrnsayqrqm
gi|75907688|ref|YP_321984.1|       kdrgtrkarfyvlrkssmpsilvetgymsgrednprlgspeyqnrmadaiargilqyl.....
gi|75908485|ref|YP_322781.1|       aaapsvllelgfmsnpdefewvtnpqeqkklaevlaegitewf....................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       rntnmpailveccfidaqkdmnlfdpeatanaivkgltgk.......................
gi|75909995|ref|YP_324291.1|       lgrlafcrqiaiasllmqvaflsspedrallqnrrrdfalgiadglasw..............
gi|298491029|ref|YP_003721206.1|   dlatltgacvvalgddiaglftpddavasqlqtasesageklwrlpmeekyfeglksgiadmk
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   fkqtenlvyavldyfedfnkgknpliqnsvtvyrasgvvnyprnedgdiaamihpqlqfrdyq
gi|298490223|ref|YP_003720400.1|   lrlartvhnrilqslnikdrrvrkarfyvlrkssmpsilvetgyvtgredaaklstsayqnqm
gi|298490222|ref|YP_003720399.1|   laevvrktilqdistikdrgtrkarfyvlrkntmpailvetgymtgrednprlgspeyqsrma
gi|298492458|ref|YP_003722635.1|   apsvllelgfmsnpyefeevvnpeeqkkmaktladgvtewf......................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   rqtnvpallmqvgfisspddhsllqtrrrdfalgivdglvaws....................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| makaiadgileyi..................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| ilsaeipeatttkclpsgnitryratvggmigdrlplgqavkageklydilsfnrqgklpkvt
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ntgnraggaitaalflkkfvantpawahldiagpvwtdkdsgaytnpggtgypvrtlvnlal.
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| dafgeqrtkiyapftglvignvqnplvnqgdgiihlav.........................
Cy2_gi|428218329|ref|YP_007102794.1| iaeaiargvdqfl..................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| tslcyvrsn......................................................
Cy2_gi|428217360|ref|YP_007101825.1| yrrniaiaiadaldt................................................
Cy2_gi|428217620|ref|YP_007102085.1| rrrdfaigiadglqlwl..............................................
gi|158336127|ref|YP_001517301.1|   vrtlvnwvm......................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   tlfyegcstvwpifineaayyekgiamclthkqdis...........................
gi|158335668|ref|YP_001516840.1|   aqgivnyl.......................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ntgprsggsitaalflqqfiketpwahldiagpvwtdkqngvhnagatgypvrtlvqwvlg..
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ekgiamaltqrkti.................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       rgvleylqq......................................................
gi|16329723|ref|NP_440451.1|       eaiaagivqylk...................................................
gi|16330213|ref|NP_440941.1|       qalatgittwlq...................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| tlaqgilewlq....................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       tlaqgllkwlq....................................................
fN9_gi|428220463|ref|YP_007104633.1| ntgsreggsitaalflkqfidktpawahldiagpvwadkdsgytnvggtgypvrtlvnliln.
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| argvdqflk......................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| vvkalraen......................................................
qVl_gi|427712524|ref|YP_007061148.1| gpraggsitaalflkqfiqstpwahldiagpvwvekedgylnpggtgfgvqtlvnwvl.....
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| naiatgimryf....................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| veaf...........................................................
gi|113954246|ref|YP_731406.1|      gacvialgdeiaglwtgddslanslegaakdageglwrmpmhqayrkglkslladlkntgprp
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      dgsciayegadglvplfineaayaeksialsltlrecwplslew...................
gi|113954650|ref|YP_730754.1|      rrrlalaiatgildyl...............................................
gi|81299999|ref|YP_400207.1|       tladalvfadglgvdaivdlatltgaciialgddiaglwspsddlaeqllqagkaageklwrl
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       maeaiargilqyv..................................................
gi|81300943|ref|YP_401151.1|       fln............................................................
gi|81299525|ref|YP_399733.1|       sqlveaiaqglvdwfh...............................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   iadmkntgpraggsitaalfleeffdnkikwahidiagtcwtdkskginplgatgfgvktlvq
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   dwkpikkgdplfmdmegctksyngkntlwpvfigevaykekniamsytkkevinlptq.....
gi|123965916|ref|YP_001010997.1|   reriayaitkgileyl...............................................
JuK_gi|428313309|ref|YP_007124286.1| tgpraggsitaalflkqfvketpwahldvagpvwadkedgcnnagatgypvrtlvnwvl....
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| yegestvypifineaayyekgiamcltekhqlt..............................
JuK_gi|428309925|ref|YP_007120902.1| aiargilqyiq....................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| argillyi.......................................................
JuK_gi|428309552|ref|YP_007120529.1| iangilqyiq.....................................................
JuK_gi|428313083|ref|YP_007124060.1| saiadgitewf....................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| ptggmiqtrvslgssikagqllyqlicfnkkgelpllidvcaeaeglifdvstnygvnegeyv
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| gladgliqwsg....................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      aekagekmwrmpleekyfeglkamhadmkntgprpggaitaalflkqfvkntpwahldiagpv
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      qaiargilkyvqvy.................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      qivfttrqemkpyyapvggmiqnrmepgtivkknqrlyqilnfnknqdlpkvvdvfaqtdgli
gi|113474394|ref|YP_720455.1|      eaipqllnqakvnlltqefgtvspisvl...................................
HFg_gi|428224156|ref|YP_007108253.1| ntgprpggaitaalflkqfvkdtpwahldiagpvwadkedsytvagatgygvrtlvnwva...
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| lgyiadafgdspvtvrspwdgivigctrnplvhqgdgifhlal....................
HFg_gi|428226743|ref|YP_007110840.1| aaiargilqyvk...................................................
HFg_gi|428224382|ref|YP_007108479.1| aaaiargilqyiq..................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ntgpraggsitaalflkqfikdtpwahldiagpvwaekenglnnvggtgfpvrtlvnwvls..
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ctvypvfineaayyekgiamcftekqe....................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   iangildyl......................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   tladgitkwfe....................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| iaqgileyl......................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| hkmtftlksqitkyyapvggmvqarvplgskvkmgerlyqilmfnktgelpyvidicaekdgf
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ntgpraggsitaalflkqfvektpwlhldiagtawidkengvnnagatgvpvrtivnwlt...
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   sfnkhgnlpevinitaekdgfifdlstnfsvnqgeyvlsi.......................
8V2_gi|428775164|ref|YP_007166951.1| kseiadmtnvgprqggsitaalflkqfiqetpwahidiagtawadkesgvnnagatgfpvrtl
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| gilrlqvrlgesvvkkqilgaianpfgkqelkirsplnglvightqnplvnqgdgiihla...
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ncvdlktvvnkgdviyqilelnkqgeplkvisitaqtsglifdlginqgvhegey........
gi|166368941|ref|YP_001661214.1|   ntgprpggsitaalflkqfinntpwlhldiagpvwsdkengvnnsgatgfpvrtlvnwvm...
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   nqpiflgfdgqeiiyrgeselypifvgessykekgialcwtakkqid................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   aaiaggiieyi....................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       tgsreggtitaalflkqfvektpwvhldiagpvwtekqkgytnrggtgfgvrtlvrfvl....
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       nrptllvethmlkdyksrvtatydllveifah...............................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       pvhcrapglfvsaaalgdslaegevlgkvvdplrgetlervhtpepgllialrthpvvmqgal
gi|37520329|ref|NP_923706.1|       lp.............................................................
gi|37520932|ref|NP_924309.1|       rllntdaqarqvrgaiaeaiaa.........................................
ADw_gi|427733727|ref|YP_007053271.1| ntgpraggsitaslflkqfvkdtpawahldvagpvwtdkengyhpsgatgfgvrtlvnwvl..
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| fqdykplhpgnpifisfdgkdifyegdktvypvfinevayyekgiamyftqkeri........
ADw_gi|427737907|ref|YP_007057451.1| eeivypvfineaayyekgiamyltk......................................
ADw_gi|427736327|ref|YP_007055871.1| lqvvrnktfsggyitrhygempnieslqievryhvylqenqidkp..................
ADw_gi|427735146|ref|YP_007054690.1| giadgilryl.....................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ivkgltg........................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| mmfktkskvtkyyatvggminsrialgrevrageqiyqilifnkqgklpttvdifadrdgfvy
ADw_gi|427734372|ref|YP_007053916.1| favgiadgiaaw...................................................
ADw_gi|427738248|ref|YP_007057792.1| ilkwl..........................................................
rbN_gi|427718504|ref|YP_007066498.1| ntgpraggsitaalflkqfvkdtpwahldiagpvwtdkengyngsgatgfgvrtlvnwvls..
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| gqtiayeskstvwpifineaayyekgiamcltkqqqisik.......................
rbN_gi|427716207|ref|YP_007064201.1| aeaiargvlqylk..................................................
rbN_gi|427716208|ref|YP_007064202.1| daiargilkylq...................................................
rbN_gi|427720501|ref|YP_007068495.1| alaagitewf.....................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ltgk...........................................................
rbN_gi|427715920|ref|YP_007063914.1| sw.............................................................
gi|75908939|ref|YP_323235.1|       ntgprpggsitaalflkqfvkdtpwahldiagpvwadkengyngpgatgygvrllvdwvl...
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       n..............................................................
gi|75907687|ref|YP_321983.1|       adaiargilqyl...................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ntgpryggsitaalflkqfvkdtpwahldiagpvwadkencyngagatgfgvrtlvnwvl...
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   plysgdplfltfeskeifyegestvhpifineaayyekgiamylsqkeli.............
gi|298490223|ref|YP_003720400.1|   aeaiaqgilqylr..................................................
gi|298490222|ref|YP_003720399.1|   daiargilqylr...................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                                                                    
                                                                                                    
d1cg2a1                              ...............................................................
gi|269926470|ref|YP_003323093.1|   ...............................................................
gi|269926320|ref|YP_003322943.1|   ...............................................................
gi|269925335|ref|YP_003321958.1|   ...............................................................
gi|269925376|ref|YP_003321999.1|   ...............................................................
gi|269925438|ref|YP_003322061.1|   ...............................................................
gi|269926083|ref|YP_003322706.1|   ...............................................................
gi|269838949|ref|YP_003323641.1|   ...............................................................
gi|269926500|ref|YP_003323123.1|   ...............................................................
TLn_gi|427723016|ref|YP_007070293.1| ...............................................................
TLn_gi|427722057|ref|YP_007069334.1| ...............................................................
TLn_gi|427722694|ref|YP_007069971.1| ...............................................................
TLn_gi|427723545|ref|YP_007070822.1| ...............................................................
TLn_gi|427726210|ref|YP_007073487.1| ...............................................................
TLn_gi|427724197|ref|YP_007071474.1| ...............................................................
TLn_gi|427725916|ref|YP_007073193.1| ...............................................................
TLn_gi|427723370|ref|YP_007070647.1| tinsmvdgivfdlaisesanq..........................................
TLn_gi|427724429|ref|YP_007071706.1| ...............................................................
Cy2_gi|428218721|ref|YP_007103186.1| ...............................................................
Cy2_gi|428217331|ref|YP_007101796.1| ...............................................................
Cy2_gi|428218965|ref|YP_007103430.1| ...............................................................
Cy2_gi|428218329|ref|YP_007102794.1| ...............................................................
Cy2_gi|428218498|ref|YP_007102963.1| ...............................................................
Cy2_gi|428218676|ref|YP_007103141.1| ...............................................................
Cy2_gi|428218275|ref|YP_007102740.1| ...............................................................
Cy2_gi|428217320|ref|YP_007101785.1| ...............................................................
Cy2_gi|428217360|ref|YP_007101825.1| ...............................................................
Cy2_gi|428217620|ref|YP_007102085.1| ...............................................................
gi|158336127|ref|YP_001517301.1|   ...............................................................
gi|158335082|ref|YP_001516254.1|   ...............................................................
gi|158334581|ref|YP_001515753.1|   ...............................................................
gi|158339037|ref|YP_001520214.1|   ...............................................................
gi|158335668|ref|YP_001516840.1|   ...............................................................
gi|158335292|ref|YP_001516464.1|   ...............................................................
gi|158338092|ref|YP_001519268.1|   ...............................................................
gi|158337208|ref|YP_001518383.1|   ...............................................................
gi|158338413|ref|YP_001519590.1|   ...............................................................
gi|158336876|ref|YP_001518051.1|   ...............................................................
gi|16330631|ref|NP_441359.1|       ...............................................................
gi|16332230|ref|NP_442958.1|       ...............................................................
gi|16331842|ref|NP_442570.1|       ...............................................................
gi|16329830|ref|NP_440558.1|       ...............................................................
gi|16330558|ref|NP_441286.1|       ...............................................................
gi|16330376|ref|NP_441104.1|       ...............................................................
gi|16329723|ref|NP_440451.1|       ...............................................................
gi|16330213|ref|NP_440941.1|       ...............................................................
toq_gi|571027785|ref|YP_008899903.1| ...............................................................
toq_gi|571026933|ref|YP_008899051.1| ...............................................................
toq_gi|571028537|ref|YP_008900657.1| ...............................................................
toq_gi|571027463|ref|YP_008899581.1| ...............................................................
toq_gi|571027813|ref|YP_008899931.1| ...............................................................
gi|22299288|ref|NP_682535.1|       ...............................................................
gi|22299990|ref|NP_683237.1|       ...............................................................
gi|22297557|ref|NP_680804.1|       ...............................................................
gi|22297795|ref|NP_681042.1|       ...............................................................
gi|22299317|ref|NP_682564.1|       ...............................................................
fN9_gi|428220463|ref|YP_007104633.1| ...............................................................
fN9_gi|428222328|ref|YP_007106498.1| ...............................................................
fN9_gi|428221241|ref|YP_007105411.1| ...............................................................
fN9_gi|428222603|ref|YP_007106773.1| ...............................................................
fN9_gi|428221486|ref|YP_007105656.1| ...............................................................
fN9_gi|428221848|ref|YP_007106018.1| ...............................................................
fN9_gi|428221485|ref|YP_007105655.1| ...............................................................
qVl_gi|427712524|ref|YP_007061148.1| ...............................................................
qVl_gi|427712396|ref|YP_007061020.1| ...............................................................
qVl_gi|427714252|ref|YP_007062876.1| ...............................................................
qVl_gi|427711704|ref|YP_007060328.1| ...............................................................
qVl_gi|427711553|ref|YP_007060177.1| ...............................................................
qVl_gi|427714522|ref|YP_007063146.1| ...............................................................
qVl_gi|427713716|ref|YP_007062340.1| ...............................................................
gi|113954246|ref|YP_731406.1|      ggsitaalflkefvrssipwahidiagtvwsdkgrgmdpagatgygvrtlvswvca.......
gi|113955421|ref|YP_729363.1|      ...............................................................
gi|113954748|ref|YP_731585.1|      ...............................................................
gi|113954650|ref|YP_730754.1|      ...............................................................
gi|81299999|ref|YP_400207.1|       pleepyldglkspvadykntgpraggsitaalflkqfvkhpvwahldvagpvwsdkekhynpa
gi|81299067|ref|YP_399275.1|       ...............................................................
gi|81300780|ref|YP_400988.1|       ...............................................................
gi|81300390|ref|YP_400598.1|       ...............................................................
gi|81301169|ref|YP_401377.1|       ...............................................................
gi|81300943|ref|YP_401151.1|       ...............................................................
gi|81299525|ref|YP_399733.1|       ...............................................................
gi|81301079|ref|YP_401287.1|       ...............................................................
gi|81300779|ref|YP_400987.1|       ...............................................................
gi|123966726|ref|YP_001011807.1|   wikn...........................................................
gi|123967035|ref|YP_001012116.1|   ...............................................................
gi|123965487|ref|YP_001010568.1|   ...............................................................
gi|123965916|ref|YP_001010997.1|   ...............................................................
JuK_gi|428313309|ref|YP_007124286.1| ...............................................................
JuK_gi|428311057|ref|YP_007122034.1| ...............................................................
JuK_gi|428309062|ref|YP_007120039.1| ...............................................................
JuK_gi|428312940|ref|YP_007123917.1| ...............................................................
JuK_gi|428309925|ref|YP_007120902.1| ...............................................................
JuK_gi|428310093|ref|YP_007121070.1| ...............................................................
JuK_gi|428313512|ref|YP_007124489.1| ...............................................................
JuK_gi|428309552|ref|YP_007120529.1| ...............................................................
JuK_gi|428313083|ref|YP_007124060.1| ...............................................................
JuK_gi|428310554|ref|YP_007121531.1| ...............................................................
JuK_gi|428310231|ref|YP_007121208.1| ...............................................................
JuK_gi|428312499|ref|YP_007123476.1| lsvm...........................................................
JuK_gi|428313236|ref|YP_007124213.1| ...............................................................
JuK_gi|428313477|ref|YP_007124454.1| ...............................................................
JuK_gi|428311704|ref|YP_007122681.1| ...............................................................
gi|113473990|ref|YP_720051.1|      wvdtengynnqgatgygvrtlvnwil.....................................
gi|113475511|ref|YP_721572.1|      ...............................................................
gi|113477163|ref|YP_723224.1|      ...............................................................
gi|113478073|ref|YP_724134.1|      ...............................................................
gi|113476499|ref|YP_722560.1|      ...............................................................
gi|113474224|ref|YP_720285.1|      ...............................................................
gi|113477463|ref|YP_723524.1|      ...............................................................
gi|113476944|ref|YP_723005.1|      ldnstnhcvnqgdfvleiir...........................................
gi|113474394|ref|YP_720455.1|      ...............................................................
HFg_gi|428224156|ref|YP_007108253.1| ...............................................................
HFg_gi|428226397|ref|YP_007110494.1| ...............................................................
HFg_gi|428224388|ref|YP_007108485.1| ...............................................................
HFg_gi|428223916|ref|YP_007108013.1| ...............................................................
HFg_gi|428226743|ref|YP_007110840.1| ...............................................................
HFg_gi|428224382|ref|YP_007108479.1| ...............................................................
HFg_gi|428223590|ref|YP_007107687.1| ...............................................................
HFg_gi|428224655|ref|YP_007108752.1| ...............................................................
HFg_gi|428226160|ref|YP_007110257.1| ...............................................................
HFg_gi|428226051|ref|YP_007110148.1| ...............................................................
HFg_gi|428224780|ref|YP_007108877.1| ...............................................................
gi|257061661|ref|YP_003139549.1|   ...............................................................
gi|257062162|ref|YP_003140050.1|   ...............................................................
gi|257059081|ref|YP_003136969.1|   ...............................................................
gi|257058278|ref|YP_003136166.1|   ...............................................................
gi|257060857|ref|YP_003138745.1|   ...............................................................
gi|257061491|ref|YP_003139379.1|   ...............................................................
gi|257058498|ref|YP_003136386.1|   ...............................................................
gi|257060846|ref|YP_003138734.1|   ...............................................................
gi|257057955|ref|YP_003135843.1|   ...............................................................
5BT_gi|434391707|ref|YP_007126654.1| ...............................................................
5BT_gi|434395368|ref|YP_007130315.1| ...............................................................
5BT_gi|434393016|ref|YP_007127963.1| ...............................................................
5BT_gi|434392062|ref|YP_007127009.1| ...............................................................
5BT_gi|434395507|ref|YP_007130454.1| ...............................................................
5BT_gi|434391636|ref|YP_007126583.1| ...............................................................
5BT_gi|434395491|ref|YP_007130438.1| ...............................................................
5BT_gi|434391354|ref|YP_007126301.1| ...............................................................
5BT_gi|434391607|ref|YP_007126554.1| ...............................................................
5BT_gi|434395336|ref|YP_007130283.1| ...............................................................
5BT_gi|434391236|ref|YP_007126183.1| vydvatnyavnegeyvlai............................................
5BT_gi|434391792|ref|YP_007126739.1| ...............................................................
5BT_gi|434395419|ref|YP_007130366.1| ...............................................................
gi|284929626|ref|YP_003422148.1|   ...............................................................
gi|284928900|ref|YP_003421422.1|   ...............................................................
gi|284929040|ref|YP_003421562.1|   ...............................................................
8V2_gi|428775164|ref|YP_007166951.1| vnwv...........................................................
8V2_gi|428777931|ref|YP_007169718.1| ...............................................................
8V2_gi|428776138|ref|YP_007167925.1| ...............................................................
8V2_gi|428777938|ref|YP_007169725.1| ...............................................................
8V2_gi|428777493|ref|YP_007169280.1| ...............................................................
8V2_gi|428778337|ref|YP_007170124.1| ...............................................................
8V2_gi|428777769|ref|YP_007169556.1| ...............................................................
8V2_gi|428775818|ref|YP_007167605.1| ...............................................................
gi|166368941|ref|YP_001661214.1|   ...............................................................
gi|166365183|ref|YP_001657456.1|   ...............................................................
gi|166366573|ref|YP_001658846.1|   ...............................................................
gi|166362930|ref|YP_001655203.1|   ...............................................................
gi|166364322|ref|YP_001656595.1|   ...............................................................
gi|166368299|ref|YP_001660572.1|   ...............................................................
gi|166366765|ref|YP_001659038.1|   ...............................................................
gi|166368835|ref|YP_001661108.1|   ...............................................................
gi|166366493|ref|YP_001658766.1|   ...............................................................
gi|166363064|ref|YP_001655337.1|   ...............................................................
gi|166366413|ref|YP_001658686.1|   ...............................................................
gi|37522180|ref|NP_925557.1|       ...............................................................
gi|37519943|ref|NP_923320.1|       ...............................................................
gi|37522109|ref|NP_925486.1|       ...............................................................
gi|37520936|ref|NP_924313.1|       ...............................................................
gi|37523992|ref|NP_927369.1|       ...............................................................
gi|37520534|ref|NP_923911.1|       ...............................................................
gi|37520091|ref|NP_923468.1|       ...............................................................
gi|37522227|ref|NP_925604.1|       ...............................................................
gi|37522043|ref|NP_925420.1|       ...............................................................
gi|37523548|ref|NP_926925.1|       ...............................................................
gi|37523547|ref|NP_926924.1|       vaclvr.........................................................
gi|37520329|ref|NP_923706.1|       ...............................................................
gi|37520932|ref|NP_924309.1|       ...............................................................
ADw_gi|427733727|ref|YP_007053271.1| ...............................................................
ADw_gi|427739887|ref|YP_007059431.1| ...............................................................
ADw_gi|427738968|ref|YP_007058512.1| ...............................................................
ADw_gi|427737605|ref|YP_007057149.1| ...............................................................
ADw_gi|427737907|ref|YP_007057451.1| ...............................................................
ADw_gi|427736327|ref|YP_007055871.1| ...............................................................
ADw_gi|427735146|ref|YP_007054690.1| ...............................................................
ADw_gi|427735148|ref|YP_007054692.1| ...............................................................
ADw_gi|427734182|ref|YP_007053726.1| ...............................................................
ADw_gi|427738036|ref|YP_007057580.1| ...............................................................
ADw_gi|427737291|ref|YP_007056835.1| ...............................................................
ADw_gi|427733824|ref|YP_007053368.1| ...............................................................
ADw_gi|427734438|ref|YP_007053982.1| ...............................................................
ADw_gi|427737664|ref|YP_007057208.1| ...............................................................
ADw_gi|427735400|ref|YP_007054944.1| ...............................................................
ADw_gi|427736713|ref|YP_007056257.1| ...............................................................
ADw_gi|427735785|ref|YP_007055329.1| ...............................................................
ADw_gi|427733974|ref|YP_007053518.1| ...............................................................
ADw_gi|427735097|ref|YP_007054641.1| dvsanqsvne.....................................................
ADw_gi|427734372|ref|YP_007053916.1| ...............................................................
ADw_gi|427738248|ref|YP_007057792.1| ...............................................................
rbN_gi|427718504|ref|YP_007066498.1| ...............................................................
rbN_gi|427717245|ref|YP_007065239.1| ...............................................................
rbN_gi|427716398|ref|YP_007064392.1| ...............................................................
rbN_gi|427716007|ref|YP_007064001.1| ...............................................................
rbN_gi|427716207|ref|YP_007064201.1| ...............................................................
rbN_gi|427716208|ref|YP_007064202.1| ...............................................................
rbN_gi|427720501|ref|YP_007068495.1| ...............................................................
rbN_gi|427720149|ref|YP_007068143.1| ...............................................................
rbN_gi|427717825|ref|YP_007065819.1| ...............................................................
rbN_gi|427716163|ref|YP_007064157.1| ...............................................................
rbN_gi|427716185|ref|YP_007064179.1| ...............................................................
rbN_gi|427715920|ref|YP_007063914.1| ...............................................................
gi|75908939|ref|YP_323235.1|       ...............................................................
gi|75908435|ref|YP_322731.1|       ...............................................................
gi|75907282|ref|YP_321578.1|       ...............................................................
gi|75910294|ref|YP_324590.1|       ...............................................................
gi|75908006|ref|YP_322302.1|       ...............................................................
gi|75907687|ref|YP_321983.1|       ...............................................................
gi|75907688|ref|YP_321984.1|       ...............................................................
gi|75908485|ref|YP_322781.1|       ...............................................................
gi|75908181|ref|YP_322477.1|       ...............................................................
gi|75907143|ref|YP_321439.1|       ...............................................................
gi|75909389|ref|YP_323685.1|       ...............................................................
gi|75910593|ref|YP_324889.1|       ...............................................................
gi|75909995|ref|YP_324291.1|       ...............................................................
gi|298491029|ref|YP_003721206.1|   ...............................................................
gi|298492645|ref|YP_003722822.1|   ...............................................................
gi|298490648|ref|YP_003720825.1|   ...............................................................
gi|298491800|ref|YP_003721977.1|   ...............................................................
gi|298490223|ref|YP_003720400.1|   ...............................................................
gi|298490222|ref|YP_003720399.1|   ...............................................................
gi|298492458|ref|YP_003722635.1|   ...............................................................
gi|298492145|ref|YP_003722322.1|   ...............................................................
gi|298492188|ref|YP_003722365.1|   ...............................................................
gi|298491532|ref|YP_003721709.1|   ...............................................................


                                                    
                                                    
d1cg2a1                              ...............
gi|269926470|ref|YP_003323093.1|   ...............
gi|269926320|ref|YP_003322943.1|   ...............
gi|269925335|ref|YP_003321958.1|   ...............
gi|269925376|ref|YP_003321999.1|   ...............
gi|269925438|ref|YP_003322061.1|   ...............
gi|269926083|ref|YP_003322706.1|   ...............
gi|269838949|ref|YP_003323641.1|   ...............
gi|269926500|ref|YP_003323123.1|   ...............
TLn_gi|427723016|ref|YP_007070293.1| ...............
TLn_gi|427722057|ref|YP_007069334.1| ...............
TLn_gi|427722694|ref|YP_007069971.1| ...............
TLn_gi|427723545|ref|YP_007070822.1| ...............
TLn_gi|427726210|ref|YP_007073487.1| ...............
TLn_gi|427724197|ref|YP_007071474.1| ...............
TLn_gi|427725916|ref|YP_007073193.1| ...............
TLn_gi|427723370|ref|YP_007070647.1| ...............
TLn_gi|427724429|ref|YP_007071706.1| ...............
Cy2_gi|428218721|ref|YP_007103186.1| ...............
Cy2_gi|428217331|ref|YP_007101796.1| ...............
Cy2_gi|428218965|ref|YP_007103430.1| ...............
Cy2_gi|428218329|ref|YP_007102794.1| ...............
Cy2_gi|428218498|ref|YP_007102963.1| ...............
Cy2_gi|428218676|ref|YP_007103141.1| ...............
Cy2_gi|428218275|ref|YP_007102740.1| ...............
Cy2_gi|428217320|ref|YP_007101785.1| ...............
Cy2_gi|428217360|ref|YP_007101825.1| ...............
Cy2_gi|428217620|ref|YP_007102085.1| ...............
gi|158336127|ref|YP_001517301.1|   ...............
gi|158335082|ref|YP_001516254.1|   ...............
gi|158334581|ref|YP_001515753.1|   ...............
gi|158339037|ref|YP_001520214.1|   ...............
gi|158335668|ref|YP_001516840.1|   ...............
gi|158335292|ref|YP_001516464.1|   ...............
gi|158338092|ref|YP_001519268.1|   ...............
gi|158337208|ref|YP_001518383.1|   ...............
gi|158338413|ref|YP_001519590.1|   ...............
gi|158336876|ref|YP_001518051.1|   ...............
gi|16330631|ref|NP_441359.1|       ...............
gi|16332230|ref|NP_442958.1|       ...............
gi|16331842|ref|NP_442570.1|       ...............
gi|16329830|ref|NP_440558.1|       ...............
gi|16330558|ref|NP_441286.1|       ...............
gi|16330376|ref|NP_441104.1|       ...............
gi|16329723|ref|NP_440451.1|       ...............
gi|16330213|ref|NP_440941.1|       ...............
toq_gi|571027785|ref|YP_008899903.1| ...............
toq_gi|571026933|ref|YP_008899051.1| ...............
toq_gi|571028537|ref|YP_008900657.1| ...............
toq_gi|571027463|ref|YP_008899581.1| ...............
toq_gi|571027813|ref|YP_008899931.1| ...............
gi|22299288|ref|NP_682535.1|       ...............
gi|22299990|ref|NP_683237.1|       ...............
gi|22297557|ref|NP_680804.1|       ...............
gi|22297795|ref|NP_681042.1|       ...............
gi|22299317|ref|NP_682564.1|       ...............
fN9_gi|428220463|ref|YP_007104633.1| ...............
fN9_gi|428222328|ref|YP_007106498.1| ...............
fN9_gi|428221241|ref|YP_007105411.1| ...............
fN9_gi|428222603|ref|YP_007106773.1| ...............
fN9_gi|428221486|ref|YP_007105656.1| ...............
fN9_gi|428221848|ref|YP_007106018.1| ...............
fN9_gi|428221485|ref|YP_007105655.1| ...............
qVl_gi|427712524|ref|YP_007061148.1| ...............
qVl_gi|427712396|ref|YP_007061020.1| ...............
qVl_gi|427714252|ref|YP_007062876.1| ...............
qVl_gi|427711704|ref|YP_007060328.1| ...............
qVl_gi|427711553|ref|YP_007060177.1| ...............
qVl_gi|427714522|ref|YP_007063146.1| ...............
qVl_gi|427713716|ref|YP_007062340.1| ...............
gi|113954246|ref|YP_731406.1|      ...............
gi|113955421|ref|YP_729363.1|      ...............
gi|113954748|ref|YP_731585.1|      ...............
gi|113954650|ref|YP_730754.1|      ...............
gi|81299999|ref|YP_400207.1|       gatgygvrtlvnwvl
gi|81299067|ref|YP_399275.1|       ...............
gi|81300780|ref|YP_400988.1|       ...............
gi|81300390|ref|YP_400598.1|       ...............
gi|81301169|ref|YP_401377.1|       ...............
gi|81300943|ref|YP_401151.1|       ...............
gi|81299525|ref|YP_399733.1|       ...............
gi|81301079|ref|YP_401287.1|       ...............
gi|81300779|ref|YP_400987.1|       ...............
gi|123966726|ref|YP_001011807.1|   ...............
gi|123967035|ref|YP_001012116.1|   ...............
gi|123965487|ref|YP_001010568.1|   ...............
gi|123965916|ref|YP_001010997.1|   ...............
JuK_gi|428313309|ref|YP_007124286.1| ...............
JuK_gi|428311057|ref|YP_007122034.1| ...............
JuK_gi|428309062|ref|YP_007120039.1| ...............
JuK_gi|428312940|ref|YP_007123917.1| ...............
JuK_gi|428309925|ref|YP_007120902.1| ...............
JuK_gi|428310093|ref|YP_007121070.1| ...............
JuK_gi|428313512|ref|YP_007124489.1| ...............
JuK_gi|428309552|ref|YP_007120529.1| ...............
JuK_gi|428313083|ref|YP_007124060.1| ...............
JuK_gi|428310554|ref|YP_007121531.1| ...............
JuK_gi|428310231|ref|YP_007121208.1| ...............
JuK_gi|428312499|ref|YP_007123476.1| ...............
JuK_gi|428313236|ref|YP_007124213.1| ...............
JuK_gi|428313477|ref|YP_007124454.1| ...............
JuK_gi|428311704|ref|YP_007122681.1| ...............
gi|113473990|ref|YP_720051.1|      ...............
gi|113475511|ref|YP_721572.1|      ...............
gi|113477163|ref|YP_723224.1|      ...............
gi|113478073|ref|YP_724134.1|      ...............
gi|113476499|ref|YP_722560.1|      ...............
gi|113474224|ref|YP_720285.1|      ...............
gi|113477463|ref|YP_723524.1|      ...............
gi|113476944|ref|YP_723005.1|      ...............
gi|113474394|ref|YP_720455.1|      ...............
HFg_gi|428224156|ref|YP_007108253.1| ...............
HFg_gi|428226397|ref|YP_007110494.1| ...............
HFg_gi|428224388|ref|YP_007108485.1| ...............
HFg_gi|428223916|ref|YP_007108013.1| ...............
HFg_gi|428226743|ref|YP_007110840.1| ...............
HFg_gi|428224382|ref|YP_007108479.1| ...............
HFg_gi|428223590|ref|YP_007107687.1| ...............
HFg_gi|428224655|ref|YP_007108752.1| ...............
HFg_gi|428226160|ref|YP_007110257.1| ...............
HFg_gi|428226051|ref|YP_007110148.1| ...............
HFg_gi|428224780|ref|YP_007108877.1| ...............
gi|257061661|ref|YP_003139549.1|   ...............
gi|257062162|ref|YP_003140050.1|   ...............
gi|257059081|ref|YP_003136969.1|   ...............
gi|257058278|ref|YP_003136166.1|   ...............
gi|257060857|ref|YP_003138745.1|   ...............
gi|257061491|ref|YP_003139379.1|   ...............
gi|257058498|ref|YP_003136386.1|   ...............
gi|257060846|ref|YP_003138734.1|   ...............
gi|257057955|ref|YP_003135843.1|   ...............
5BT_gi|434391707|ref|YP_007126654.1| ...............
5BT_gi|434395368|ref|YP_007130315.1| ...............
5BT_gi|434393016|ref|YP_007127963.1| ...............
5BT_gi|434392062|ref|YP_007127009.1| ...............
5BT_gi|434395507|ref|YP_007130454.1| ...............
5BT_gi|434391636|ref|YP_007126583.1| ...............
5BT_gi|434395491|ref|YP_007130438.1| ...............
5BT_gi|434391354|ref|YP_007126301.1| ...............
5BT_gi|434391607|ref|YP_007126554.1| ...............
5BT_gi|434395336|ref|YP_007130283.1| ...............
5BT_gi|434391236|ref|YP_007126183.1| ...............
5BT_gi|434391792|ref|YP_007126739.1| ...............
5BT_gi|434395419|ref|YP_007130366.1| ...............
gi|284929626|ref|YP_003422148.1|   ...............
gi|284928900|ref|YP_003421422.1|   ...............
gi|284929040|ref|YP_003421562.1|   ...............
8V2_gi|428775164|ref|YP_007166951.1| ...............
8V2_gi|428777931|ref|YP_007169718.1| ...............
8V2_gi|428776138|ref|YP_007167925.1| ...............
8V2_gi|428777938|ref|YP_007169725.1| ...............
8V2_gi|428777493|ref|YP_007169280.1| ...............
8V2_gi|428778337|ref|YP_007170124.1| ...............
8V2_gi|428777769|ref|YP_007169556.1| ...............
8V2_gi|428775818|ref|YP_007167605.1| ...............
gi|166368941|ref|YP_001661214.1|   ...............
gi|166365183|ref|YP_001657456.1|   ...............
gi|166366573|ref|YP_001658846.1|   ...............
gi|166362930|ref|YP_001655203.1|   ...............
gi|166364322|ref|YP_001656595.1|   ...............
gi|166368299|ref|YP_001660572.1|   ...............
gi|166366765|ref|YP_001659038.1|   ...............
gi|166368835|ref|YP_001661108.1|   ...............
gi|166366493|ref|YP_001658766.1|   ...............
gi|166363064|ref|YP_001655337.1|   ...............
gi|166366413|ref|YP_001658686.1|   ...............
gi|37522180|ref|NP_925557.1|       ...............
gi|37519943|ref|NP_923320.1|       ...............
gi|37522109|ref|NP_925486.1|       ...............
gi|37520936|ref|NP_924313.1|       ...............
gi|37523992|ref|NP_927369.1|       ...............
gi|37520534|ref|NP_923911.1|       ...............
gi|37520091|ref|NP_923468.1|       ...............
gi|37522227|ref|NP_925604.1|       ...............
gi|37522043|ref|NP_925420.1|       ...............
gi|37523548|ref|NP_926925.1|       ...............
gi|37523547|ref|NP_926924.1|       ...............
gi|37520329|ref|NP_923706.1|       ...............
gi|37520932|ref|NP_924309.1|       ...............
ADw_gi|427733727|ref|YP_007053271.1| ...............
ADw_gi|427739887|ref|YP_007059431.1| ...............
ADw_gi|427738968|ref|YP_007058512.1| ...............
ADw_gi|427737605|ref|YP_007057149.1| ...............
ADw_gi|427737907|ref|YP_007057451.1| ...............
ADw_gi|427736327|ref|YP_007055871.1| ...............
ADw_gi|427735146|ref|YP_007054690.1| ...............
ADw_gi|427735148|ref|YP_007054692.1| ...............
ADw_gi|427734182|ref|YP_007053726.1| ...............
ADw_gi|427738036|ref|YP_007057580.1| ...............
ADw_gi|427737291|ref|YP_007056835.1| ...............
ADw_gi|427733824|ref|YP_007053368.1| ...............
ADw_gi|427734438|ref|YP_007053982.1| ...............
ADw_gi|427737664|ref|YP_007057208.1| ...............
ADw_gi|427735400|ref|YP_007054944.1| ...............
ADw_gi|427736713|ref|YP_007056257.1| ...............
ADw_gi|427735785|ref|YP_007055329.1| ...............
ADw_gi|427733974|ref|YP_007053518.1| ...............
ADw_gi|427735097|ref|YP_007054641.1| ...............
ADw_gi|427734372|ref|YP_007053916.1| ...............
ADw_gi|427738248|ref|YP_007057792.1| ...............
rbN_gi|427718504|ref|YP_007066498.1| ...............
rbN_gi|427717245|ref|YP_007065239.1| ...............
rbN_gi|427716398|ref|YP_007064392.1| ...............
rbN_gi|427716007|ref|YP_007064001.1| ...............
rbN_gi|427716207|ref|YP_007064201.1| ...............
rbN_gi|427716208|ref|YP_007064202.1| ...............
rbN_gi|427720501|ref|YP_007068495.1| ...............
rbN_gi|427720149|ref|YP_007068143.1| ...............
rbN_gi|427717825|ref|YP_007065819.1| ...............
rbN_gi|427716163|ref|YP_007064157.1| ...............
rbN_gi|427716185|ref|YP_007064179.1| ...............
rbN_gi|427715920|ref|YP_007063914.1| ...............
gi|75908939|ref|YP_323235.1|       ...............
gi|75908435|ref|YP_322731.1|       ...............
gi|75907282|ref|YP_321578.1|       ...............
gi|75910294|ref|YP_324590.1|       ...............
gi|75908006|ref|YP_322302.1|       ...............
gi|75907687|ref|YP_321983.1|       ...............
gi|75907688|ref|YP_321984.1|       ...............
gi|75908485|ref|YP_322781.1|       ...............
gi|75908181|ref|YP_322477.1|       ...............
gi|75907143|ref|YP_321439.1|       ...............
gi|75909389|ref|YP_323685.1|       ...............
gi|75910593|ref|YP_324889.1|       ...............
gi|75909995|ref|YP_324291.1|       ...............
gi|298491029|ref|YP_003721206.1|   ...............
gi|298492645|ref|YP_003722822.1|   ...............
gi|298490648|ref|YP_003720825.1|   ...............
gi|298491800|ref|YP_003721977.1|   ...............
gi|298490223|ref|YP_003720400.1|   ...............
gi|298490222|ref|YP_003720399.1|   ...............
gi|298492458|ref|YP_003722635.1|   ...............
gi|298492145|ref|YP_003722322.1|   ...............
gi|298492188|ref|YP_003722365.1|   ...............
gi|298491532|ref|YP_003721709.1|   ...............


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046134 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitif