SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

alpha/beta-Hydrolases alignments

These alignments are sequences aligned to the 0045736 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1a88a_ g...........................................................................................
d1a8qa_ pic.........................................................................................
d1ac5a_ lpsseeykvayellpglsevpdpsnipqmhaghiplrsedadeqdssd............................................
d1auoa_ mteplilqpakp................................................................................
d1b6ga_ mvnairtpdqrfsnldqypfspnylddlpgy.............................................................
d1brta_ pfitvgqensts................................................................................
d1bu8a2 kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdtikfsnfqld.......................
d1c4xa_ tveiiekrfpsgtlas............................................................................
d1cexa_ rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvggayratlgdnalprgtss................
d1cv2a_ gakpfgek....................................................................................
d1dina_ mltegisiqsydg...............................................................................
d1dwoa_ piskmvtah...................................................................................
d1dx4a_ drlvvqtssgpvrgrsvtvqgrevhvytgipyakppvedlrfrkpvpaepwhgvldatglsatcvqeryeyfpgfsgeeiwnpntnvsedcl
d1ehya_ airrpedfkhye................................................................................
d1ei9a_ d...........................................................................................
d1ek1a2 lpvpcnpndvshg...............................................................................
d1evqa_ ldpviqqvldqlnrmpapdykhlsaqqfrsqqslfppvkkepvaevrefdmdl.......................................
d1ex9a_ stytq.......................................................................................
d1f0na_ srpglpveylqvpspsmgrdikvqfqsggnnspavylldglraqddyngwdintpafewyyqsglsivmpvggqssf...............
d1fj2a_ mdpefmstplpaivpaarkat.......................................................................
d1gkla_ sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifylmhgggenentifsndvklqnildhaimngele
d1i6wa_ h...........................................................................................
d1imja_ aasveqregt..................................................................................
d1iupa_ nleigksila..................................................................................
d1ivya_ apdqdeiqrlpglakqpsfrqysgyl..................................................................
d1j1ia_ ayv.........................................................................................
d1jfra_ npyergpaptnasieasrgpyatsqtsvsslvasgf........................................................
d1ji3a_ aslran......................................................................................
d1jjfa_ slptmppsgydqvrngvprgqvvnisyfstatnstrparvylppgysk............................................
d1jkma_ pgrlgdessgprtdprfspamvealatfgldavaaappvsasddlptvlaavgashdgfqavydsialdlptdrddvetstet.........
d1jmkc_ ggsdglqdvtimnqdqe...........................................................................
d1ju3a2 nysvasnvmv..................................................................................
d1k4ya_ ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvknttsyppmcsqdavsghmlselftnrkeniplkfse
d1k8qa_ afgklhptnpevtmnisqmitywgypaeeyev............................................................
d1l7aa_ mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrltyk..............................
d1lgya_ kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtngyvlrsdkqktiylvfrgtnsfrsaitdivfn
d1lnsa3 ldnhyhffndkslatfdssllerevlwvespvdseqrgendlikiqiirpksteklpvvmtaspyhlgindkandlalhdmnveleektshe
d1lzla_ ttfptldpelaaaltmlpkvdfadlpnaratydaligamladlsfdgvslrelsapgldgdpevkirfvtpdnt..................
d1m33a_ ni..........................................................................................
d1mnaa_ agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllaggptdraegra...............................
d1mpxa2 tspmtpditgkpfvaadasndyikrevmi...............................................................
d1mtza_ ecien.......................................................................................
d1n1ma2 mpskkldfiilnet..............................................................................
d1p0ia_ iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyansccqnidqsfpgfhgsemwnpntdlsedclyl
d1pjaa_ s...........................................................................................
d1pv1a_ mkvvkefsvcggrliklshnsnstktsmnvniylpkhy......................................................
d1q0ra_ se..........................................................................................
d1qe3a_ thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpicpqpsdllslsytelprqsedclyvnvfa....
d1qfma2 dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrlifvrhmggvlavanirgggeygetwhkg.....
d1qlwa_ vpktpagpltlsgqgsffvggrdvtsetlslspkydahgt....................................................
d1qo7a_ kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlttmrekwlsefdwrpfearlnsfpqf.......
d1qoza_ ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyansv...............................
d1qtra_ lrglypplaaydsgw.............................................................................
d1r1da_ ppkpfffeage.................................................................................
d1r3da_ sllsnqlhfakpta..............................................................................
d1tcaa_ lpsgsdpafsqpksvldagltcqgaspssv..............................................................
d1thga_ eaptavlngnevisgvlegkvdtfkgipfadpplndlrfkhpqpftgsyqglkandfspacmqldpgnsltlldkalglakvipeefrgply
d1thta_ qcktiahvlr..................................................................................
d1tiba_ evsqdlfnqfnlfaqysaaaycgknndapagtnitctgnacpevekadatflysfedsgvgdvtgflaldntnklivlsfrgsrsienwign
d1ufoa_ mrvrterltlaglsvlar..........................................................................
d1ukca_ shnaqpvinlgyaryqgvrleagvdeflgmryasppigdlrfrapqdppanqtlqsateygpicigldeeespgdisedclfinvfkpstat
d1uwca_ astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskeiitvfrgtgsdtnlqldtnytltpfdtlpqcn
d1uxoa_ tkq.........................................................................................
d1vkha_ hhmsntvraispditlfn..........................................................................
d1wht.1 ghaadriarlpgqpavdfdmysgyitvdega.............................................................
d1wpxa1 kikdpkilgidpnvtqytgyldvededkh...............................................................
d1xfda2 pkveyrdi....................................................................................
d1xkta_ vnlrsllvnpegptlmrlnsvqss....................................................................
d1zoib_ s...........................................................................................
d2b20a2 lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmpvwpvltslthrqqlppavyvlidaidtthra.
d2b61a1 svqnvvlfdtqpltlmlggklsy.....................................................................
d2bcea_ aklgsvyteggfvegvnkklslfgdsvdifkgipfaaapkalekperhpgwqgtlkaksfkkrclqatltqdstygnedclylniwvpqgrk
d2cbga_ saageq......................................................................................
d2d81a1 talpafnv....................................................................................
d2dsta1 rragylhly...................................................................................
d2fuka1 nplfptesaaltldgpvgpldvavdlpepdvavqpv........................................................
d2gzsa1 pniadkgsvfyhfsatsfdsvdgtrhyrvwtavpnttapasgypilymldgnavmdrlddellkqlsektppvivavgyqtnlpfdlnsray
d2h1ia1 mmkhvf......................................................................................
d2hu7a2 lpedlrrsiagsrlvwve..........................................................................
d2i3da1 pevifngpa...................................................................................
d2jbwa1 kpedemdnwgrlildgvsysdmvgardrpkeitwfdywmslaneyeqeaerkvalghdlsagellmsaalcaqyaqflwfderrqkgqarkv
d2ocka_ svtsak......................................................................................
d2ogsa_ rtvvetrygrlrgemnegvfvwkgipyakapvgerrflppeppdawdgvreatsfgpvvmqpsdpifsgllgrmseapsed...........
d2pbla1 melddayangayiegaadypprwaasaedfrnslqdrarlnlsygegdrhkfdlflpegt................................
d2psja_ skvydpeqrkrmitgpqwwarckqmnvldsf.............................................................
d2r8ba1 mtkdsyfhksragva.............................................................................
d2rhwa1 ltesstskfvkinekgfs..........................................................................
d2vata1 nrfeasldaqdiarislftlesgvilr.................................................................
d2vf2a_ ltfestsrfaev................................................................................
d2xmza_ mt..........................................................................................
d2xt0a_ mefvrtpddrfadlpdfpyaphyleglpgf..............................................................
d2xuah_ mp..........................................................................................
d3ainb_ asveeirslfkqfssltpreevgkieditipgse..........................................................
d3b5ea1 ensplltdla..................................................................................
d3bdia1 malqe.......................................................................................
d3be8b1 qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnttqfaavcpqhldersllhdmlpiwftanldtl
d3cn7c_ seplildapn..................................................................................
d3d2ci_ h...........................................................................................
d3dlta_ frkpqpfeye..................................................................................
d3fcyc_ fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydly...................................
d3foba_ akitvgtenqap................................................................................
d3g7nb_ atadaaafpdlhraaklssaaytgcigkafdvtivkriydlvtdtngfvgystekktiavimrgsttitdfvndidialitpelsgvtfpsd
d3grob_ apl.........................................................................................
d3hzoa1 in..........................................................................................
d3i1ia_ mqivkkekfilkeytfengrtip.....................................................................
d3k6ka_ dtkmdprdflqllkinaekaeknlpldqkragmealcerfpraeg...............................................
d3kxpb_ hfisr.......................................................................................
d3og9a_ mtdyv.......................................................................................
d3qpda_ ltggdelrdgpckpitfifarastepgllgistgpavcnrlklarsgdvacqgvgprytadlpsnalpegtsqaa.................
d3qvmb_ gmikqdvicyekedvvkrnninitgg..................................................................
d3qyjb_ mftnfeqtivdttea.............................................................................
d3stvb_ spfvk.......................................................................................
d3u0va_ lqrcivspagrhsa..............................................................................
d3vvma_ mrefippasrfielpdgfamrrggaly.................................................................
d3wibb_ phsafgdgakaydvpaf...........................................................................
d3wj2a_ mvdpdfnslielsksagdmtkiepamlrnfldesslssrgapveikeikdyk........................................
d4dnqa_ tlldal......................................................................................
d4ehba_ aeefpvpngfesa...............................................................................
d4ffwa2 mpskkldfivl.................................................................................
d4hs9a_ mst.........................................................................................
d4i3fa1 mqtsniqtgsf.................................................................................
d4j7ab_ qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqawqtlfamlgsqgepsnpvdvreetikgrggne
d4jeia_ ytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefhdprlifdvsgylavdhaskqiylvirgthsled
d4kafa1 eigtgfpfdp..................................................................................
d4ke6e_ qypvlsgaepfyae..............................................................................
d4l3wa_ evvtataaqikeltnyagvaataycrsvvpgtkwdckqclkyvpdgkliktftslltdtngfilrsdaqktiyvtfrgtnsfrsaitdmvft
d4lipd_ dnyaa.......................................................................................
d4lyea_ mfeqfes.....................................................................................
d4mwsa_ apdqdeiqrlpglakqpsfrqysgylkgs...............................................................
d4nmwa_ d...........................................................................................
d4nzzb_ msk.........................................................................................
d4pw0a_ ndhatapt....................................................................................
d4q34a_ ervlmvdeqgsfavggtvlvdslghtfhgdh.............................................................
d4rncb_ msirea......................................................................................
d4uhca1 aqrvkittta..................................................................................
d4updb_ ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpscpqmylstgngellfqlvgnliniplfqtatls
d4wy8a1 ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkngskieltitrpldtenqv..............
d4x00b_ rdyt........................................................................................
d4xvcb1 akspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpae...................................
d4zv9e1 qveftdpeifaeyitypspnghge....................................................................
d4zwna1 apypykvqttvpelq.............................................................................
d5a62a_ pflssp......................................................................................
d5ah0a1 ns..........................................................................................
d5dwda_ vklsgpmlpavsgaa.............................................................................
d5egna_ ph..........................................................................................
d5frda1 mlervfi.....................................................................................
d5fv4a_ sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvknttsyppmccqdpvagqmtsdlftnrkerlipefs
d5h3ha_ mgtf........................................................................................
d5hk8a_ vih.........................................................................................
d5jkja_ mvekrvfemphfttfggkqi........................................................................
d5mifa_ qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtaylykpvsgerekgkdl.................
d5n4fa1 ddfestqvwye.................................................................................
d5syna_ plltdaatvsgaer..............................................................................
d5uroa1 mdtsklkpndprvkyetkqirg......................................................................
d5w15a1 mldlanrf....................................................................................
d5w1ua_ sltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetldcsqqcepcyhfdrrlqkivgcedslkinvfake...
d5w8oa_ gelgivdigaltlesgav..........................................................................
d5yhpa_ tslfaaiqpykthllrvspl........................................................................
d6emia_ diiittkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqpltkwsgiwnatkyanscmqnidtsfpgfhgsemwnpntdlsedcly

d1a88a_ ............................................................................................
d1a8qa_ ............................................................................................
d1ac5a_ ............................................................................................
d1auoa_ ............................................................................................
d1b6ga_ ............................................................................................
d1brta_ ............................................................................................
d1bu8a2 ............................................................................................
d1c4xa_ ............................................................................................
d1cexa_ ............................................................................................
d1cv2a_ ............................................................................................
d1dina_ ............................................................................................
d1dwoa_ ............................................................................................
d1dx4a_ yinvwapakarlrhgrganggehpngkqadtdhlihngnpqnttnglpiliwiygggfmtgsatldiynadimaavgnvivasfqyrvgafg
d1ehya_ ............................................................................................
d1ei9a_ ............................................................................................
d1ek1a2 ............................................................................................
d1evqa_ ............................................................................................
d1ex9a_ ............................................................................................
d1f0na_ ............................................................................................
d1fj2a_ ............................................................................................
d1gkla_ plivvtptfnggnctaqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgf....................................
d1i6wa_ ............................................................................................
d1imja_ ............................................................................................
d1iupa_ ............................................................................................
d1ivya_ ............................................................................................
d1j1ia_ ............................................................................................
d1jfra_ ............................................................................................
d1ji3a_ ............................................................................................
d1jjfa_ ............................................................................................
d1jkma_ ............................................................................................
d1jmkc_ ............................................................................................
d1ju3a2 ............................................................................................
d1k4ya_ dclylniytpadlt..............................................................................
d1k8qa_ ............................................................................................
d1l7aa_ ............................................................................................
d1lgya_ fsdykpvkgakvhagf............................................................................
d1lnsa3 ihveqklpqklsakakelpivdkapyr.................................................................
d1lzla_ ............................................................................................
d1m33a_ ............................................................................................
d1mnaa_ ............................................................................................
d1mpxa2 ............................................................................................
d1mtza_ ............................................................................................
d1n1ma2 ............................................................................................
d1p0ia_ nvwip.......................................................................................
d1pjaa_ ............................................................................................
d1pv1a_ ............................................................................................
d1q0ra_ ............................................................................................
d1qe3a_ ............................................................................................
d1qfma2 ............................................................................................
d1qlwa_ ............................................................................................
d1qo7a_ ............................................................................................
d1qoza_ ............................................................................................
d1qtra_ ............................................................................................
d1r1da_ ............................................................................................
d1r3da_ ............................................................................................
d1tcaa_ ............................................................................................
d1thga_ dmakgtvsmnedclylnvfrpagtkpdaklpvmvwiyggafvygssaaypgnsyvkesinmgqpvvf.........................
d1thta_ ............................................................................................
d1tiba_ lnfdlkeindicsgcrghd.........................................................................
d1ufoa_ ............................................................................................
d1ukca_ sqs.........................................................................................
d1uwca_ dcevhggyyigwis..............................................................................
d1uxoa_ ............................................................................................
d1vkha_ ............................................................................................
d1wht.1 ............................................................................................
d1wpxa1 ............................................................................................
d1xfda2 ............................................................................................
d1xkta_ ............................................................................................
d1zoib_ ............................................................................................
d2b20a2 ............................................................................................
d2b61a1 ............................................................................................
d2bcea_ evshdlpvmiwiyggaflmgasqganflsnylydg.........................................................
d2cbga_ ............................................................................................
d2d81a1 ............................................................................................
d2dsta1 ............................................................................................
d2fuka1 ............................................................................................
d2gzsa1 dytpaaesrktdlhsgrfsrksggsnnfrqlletriapkveqglni..............................................
d2h1ia1 ............................................................................................
d2hu7a2 ............................................................................................
d2i3da1 ............................................................................................
d2jbwa1 elyqkaapllsppaerhelv........................................................................
d2ocka_ ............................................................................................
d2ogsa_ ............................................................................................
d2pbla1 ............................................................................................
d2psja_ ............................................................................................
d2r8ba1 ............................................................................................
d2rhwa1 ............................................................................................
d2vata1 ............................................................................................
d2vf2a_ ............................................................................................
d2xmza_ ............................................................................................
d2xt0a_ ............................................................................................
d2xuah_ ............................................................................................
d3ainb_ ............................................................................................
d3b5ea1 ............................................................................................
d3bdia1 ............................................................................................
d3be8b1 mtyvqdqnedclylniyvpteddihdq.................................................................
d3cn7c_ ............................................................................................
d3d2ci_ ............................................................................................
d3dlta_ ............................................................................................
d3fcyc_ ............................................................................................
d3foba_ ............................................................................................
d3g7nb_ vkimrgvhrpwsa...............................................................................
d3grob_ ............................................................................................
d3hzoa1 ............................................................................................
d3i1ia_ ............................................................................................
d3k6ka_ ............................................................................................
d3kxpb_ ............................................................................................
d3og9a_ ............................................................................................
d3qpda_ ............................................................................................
d3qvmb_ ............................................................................................
d3qyjb_ ............................................................................................
d3stvb_ ............................................................................................
d3u0va_ ............................................................................................
d3vvma_ ............................................................................................
d3wibb_ ............................................................................................
d3wj2a_ ............................................................................................
d4dnqa_ ............................................................................................
d4ehba_ ............................................................................................
d4ffwa2 ............................................................................................
d4hs9a_ ............................................................................................
d4i3fa1 ............................................................................................
d4j7ab_ iklyihs.....................................................................................
d4jeia_ vitdirimqapltnfdlaaqisstatcddclvhngfiqsyqn..................................................
d4kafa1 ............................................................................................
d4ke6e_ ............................................................................................
d4l3wa_ ftdyspvkgakvhagflssy........................................................................
d4lipd_ ............................................................................................
d4lyea_ ............................................................................................
d4mwsa_ ............................................................................................
d4nmwa_ ............................................................................................
d4nzzb_ ............................................................................................
d4pw0a_ ............................................................................................
d4q34a_ ............................................................................................
d4rncb_ ............................................................................................
d4uhca1 ............................................................................................
d4updb_ sedcltlniqrpagttsnsslpvlfwifgggfelgtnqyydgidlltegislgep.....................................
d4wy8a1 ............................................................................................
d4x00b_ ............................................................................................
d4xvcb1 ............................................................................................
d4zv9e1 ............................................................................................
d4zwna1 ............................................................................................
d5a62a_ ............................................................................................
d5ah0a1 ............................................................................................
d5dwda_ ............................................................................................
d5egna_ ............................................................................................
d5frda1 ............................................................................................
d5fv4a_ edclylniytpadlt.............................................................................
d5h3ha_ ............................................................................................
d5hk8a_ ............................................................................................
d5jkja_ ............................................................................................
d5mifa_ ............................................................................................
d5n4fa1 ............................................................................................
d5syna_ ............................................................................................
d5uroa1 ............................................................................................
d5w15a1 ............................................................................................
d5w1ua_ ............................................................................................
d5w8oa_ ............................................................................................
d5yhpa_ ............................................................................................
d6emia_ lnvwipapk...................................................................................

d1a88a_ ................................................................................-TVTTSDG..TN
d1a8qa_ ................................................................................---TTRDG..VE
d1ac5a_ ................................................................................--------..--
d1auoa_ ................................................................................--------..--
d1b6ga_ ................................................................................------PG..LR
d1brta_ ................................................................................--------..ID
d1bu8a2 ................................................................................--------..--
d1c4xa_ ................................................................................--------..--
d1cexa_ ................................................................................--------..--
d1cv2a_ ................................................................................-KFIEIKG..RR
d1dina_ ................................................................................--------..HT
d1dwoa_ ................................................................................--------..--
d1dx4a_ flhlapempsefaeeapgnvglwdqalairwlkdnahafggnpewmtlfgesagsssvnaqlmspvtrglvkrgmmqsgt--------..--
d1ehya_ ................................................................................---VQLPD..VK
d1ei9a_ ................................................................................--------..--
d1ek1a2 ................................................................................-YVTVKPG..IR
d1evqa_ ................................................................................------PG..RT
d1ex9a_ ................................................................................--------..--
d1f0na_ ................................................................................--------..--
d1fj2a_ ................................................................................--------..--
d1gkla_ ................................................................................--------..--
d1i6wa_ ................................................................................--------..--
d1imja_ ................................................................................---IQVQG..QA
d1iupa_ ................................................................................------AG..VL
d1ivya_ ................................................................................---KSSGS..KH
d1j1ia_ ................................................................................ERFVNAGG..VE
d1jfra_ ................................................................................------GG..GT
d1ji3a_ ................................................................................--------..--
d1jjfa_ ................................................................................--------..--
d1jkma_ ................................................................................--ILGVDG..NE
d1jmkc_ ................................................................................--------..--
d1ju3a2 ................................................................................---PMRDG..VR
d1k4ya_ ................................................................................--------..--
d1k8qa_ ................................................................................---VTEDG..YI
d1l7aa_ ................................................................................----SFGN..AR
d1lgya_ ................................................................................--------..--
d1lnsa3 ................................................................................--------..--
d1lzla_ ................................................................................--------..--
d1m33a_ ................................................................................--------..--
d1mnaa_ ................................................................................--------..--
d1mpxa2 ................................................................................---PMRDG..VK
d1mtza_ ................................................................................--YAKVNG..IY
d1n1ma2 ................................................................................--------..-K
d1p0ia_ ................................................................................--------..--
d1pjaa_ ................................................................................--------..--
d1pv1a_ ................................................................................--------..--
d1q0ra_ ................................................................................-RIVPSGD..VE
d1qe3a_ ................................................................................--------..--
d1qfma2 ................................................................................--------..--
d1qlwa_ ................................................................................---VTVDQ..MY
d1qo7a_ ................................................................................--TTEIEG..LT
d1qoza_ ................................................................................--------..--
d1qtra_ ................................................................................--LDTGDG..HR
d1r1da_ ................................................................................--------..--
d1r3da_ ................................................................................--------..--
d1tcaa_ ................................................................................--------..--
d1thga_ ................................................................................--------..--
d1thta_ ................................................................................----VNNG..QE
d1tiba_ ................................................................................--------..--
d1ufoa_ ................................................................................--------..--
d1ukca_ ................................................................................--------..--
d1uwca_ ................................................................................--------..--
d1uxoa_ ................................................................................--------..--
d1vkha_ ................................................................................--------..KT
d1wht.1 ................................................................................-------G..RS
d1wpxa1 ................................................................................--------..--
d1xfda2 ................................................................................----EIDD..YN
d1xkta_ ................................................................................--------..--
d1zoib_ ................................................................................-YVTTKDG..VQ
d2b20a2 ................................................................................--------..--
d2b61a1 ................................................................................--------..IN
d2bcea_ ................................................................................--------..--
d2cbga_ ................................................................................--------..--
d2d81a1 ................................................................................--------..--
d2dsta1 ................................................................................-------G..LN
d2fuka1 ................................................................................--------..--
d2gzsa1 ................................................................................--------..--
d2h1ia1 ................................................................................--------..--
d2hu7a2 ................................................................................----SFDGsrVP
d2i3da1 ................................................................................--------..GR
d2jbwa1 ................................................................................-----VDG..IP
d2ocka_ ................................................................................---VAVNG..VQ
d2ogsa_ ................................................................................-------G..LY
d2pbla1 ................................................................................--------..--
d2psja_ ................................................................................--------..--
d2r8ba1 ................................................................................--------..--
d2rhwa1 ................................................................................-------D..FN
d2vata1 ................................................................................-------D..VP
d2vf2a_ ................................................................................----DVDGp.LK
d2xmza_ ................................................................................--------..--
d2xt0a_ ................................................................................------EG..LR
d2xuah_ ................................................................................--YAAVNG..TE
d3ainb_ ................................................................................--------..TN
d3b5ea1 ................................................................................--------..--
d3bdia1 ................................................................................-EFIDVNG..TR
d3be8b1 ................................................................................--------..--
d3cn7c_ ................................................................................--------..--
d3d2ci_ ................................................................................--------..--
d3dlta_ ................................................................................--------..--
d3fcyc_ ................................................................................--FTGVRG..AR
d3foba_ ................................................................................--------..IE
d3g7nb_ ................................................................................--------..--
d3grob_ ................................................................................--------..--
d3hzoa1 ................................................................................--------..--
d3i1ia_ ................................................................................--------..VQ
d3k6ka_ ................................................................................--------..VE
d3kxpb_ ................................................................................--RVDIGR..IT
d3og9a_ ................................................................................--------..--
d3qpda_ ................................................................................--------..--
d3qvmb_ ................................................................................--------..--
d3qyjb_ ................................................................................--------..-R
d3stvb_ ................................................................................--------..--
d3u0va_ ................................................................................--------..--
d3vvma_ ................................................................................-------G..AR
d3wibb_ ................................................................................-------G..LQ
d3wj2a_ ................................................................................---IKLDG..RT
d4dnqa_ ................................................................................--------..--
d4ehba_ ................................................................................--YREVDG..VK
d4ffwa2 ................................................................................------NE..TR
d4hs9a_ ................................................................................--------..--
d4i3fa1 ................................................................................--------..-N
d4j7ab_ ................................................................................--------..--
d4jeia_ ................................................................................--------..--
d4kafa1 ................................................................................-HYVEVLG..ER
d4ke6e_ ................................................................................--------..--
d4l3wa_ ................................................................................--------..--
d4lipd_ ................................................................................--------..--
d4lyea_ ................................................................................-KFIDCDG..IR
d4mwsa_ ................................................................................------GS..KH
d4nmwa_ ................................................................................--------..--
d4nzzb_ ................................................................................-QYINVNG..VN
d4pw0a_ ................................................................................-QYIEVNG..TR
d4q34a_ ................................................................................--------..--
d4rncb_ ................................................................................---VSVDG..TS
d4uhca1 ................................................................................----TPGE..IE
d4updb_ ................................................................................--------..--
d4wy8a1 ................................................................................--------..--
d4x00b_ ................................................................................--VTAPDG..VV
d4xvcb1 ................................................................................--------..--
d4zv9e1 ................................................................................--------..--
d4zwna1 ................................................................................--YENFDG..AK
d5a62a_ ................................................................................-----SNS..VS
d5ah0a1 ................................................................................--------..--
d5dwda_ ................................................................................--------..--
d5egna_ ................................................................................---VENDG..VK
d5frda1 ................................................................................----DVDG..VK
d5fv4a_ ................................................................................--------..--
d5h3ha_ ................................................................................--IQAVDG..TK
d5hk8a_ ................................................................................--------..--
d5jkja_ ................................................................................------KN..VK
d5mifa_ ................................................................................--------..--
d5n4fa1 ................................................................................----SKDG..TK
d5syna_ ................................................................................--------..--
d5uroa1 ................................................................................--------..KT
d5w15a1 ................................................................................----NFEG..HR
d5w1ua_ ................................................................................--------..--
d5w8oa_ ................................................................................-----IDN..VQ
d5yhpa_ ................................................................................--------..HR
d6emia_ ................................................................................--------..--

                                20         30                                                     40
                                 |          |                                                      |
d1a88a_ IF.YKDWG.........PR......DGL.PVVFHHGWP......LSAD.........................D.....WD.........NQ
d1a8qa_ IF.YKDWG.........QG......--R.PVVFIHGWP......LNGD.........................A.....WQ.........DQ
d1ac5a_ LE.YFFWKftnnds...NGnv....DRP.LIIWLNGGP......GCSSmdgalvesgpfrvnsdgk.......L.....YL.........NE
d1auoa_ --.-----.........--......ADA.CVIWLHGLG......ADRY.........................D.....FM.........PV
d1b6ga_ AH.YLDEG.........NS......DAEdVFLCLHGEP......TWSY.........................L.....YR.........KM
d1brta_ LY.YEDHG.........TG......--Q.PVVLIHGFP......LSGH.........................S.....WE.........RQ
d1bu8a2 --.-----.........--......-RK.TRFIVHGFI......DKGE.........................Dg....WLl........DM
d1c4xa_ -H.ALVAG.........DP......QSP.AVVLLHGAGpga...HAAS.........................N.....WR.........PI
d1cexa_ --.-----.........--......---.---------......----.........................-.....--.........--
d1cv2a_ MA.YIDEG.........TG......--D.PILFQHGNP......TSSY.........................L.....WR.........NI
d1dina_ FG.-ALVG.........SPaka...PAP.VIVIAQEIF......GVNA.........................F.....MR.........ET
d1dwoa_ --.-----.........--......---.-FVLIHTIC......HGAW.........................I.....WH.........KL
d1dx4a_ --.-----.........--......---.---------......----.........................-.....--.........--
d1ehya_ IH.YVREG.........AG......--P.TLLLLHGWP......GFWW.........................E.....WS.........KV
d1ei9a_ --.-----.........-P......PAPlPLVIWHGMG......DSCC.........................N.....PLsm.......GA
d1ek1a2 LH.FVEMG.........SG......--P.ALCLCHGFP......ESWF.........................S.....WR.........YQ
d1evqa_ LK.VRMYR.........PEgvep..PYP.ALVYYHGGGwvv...GDLE.........................T.....HD.........PV
d1ex9a_ --.-----.........--......TKY.PIVLAHGMLgfdni.LGVD.........................Y.....WF.........GI
d1f0na_ --.-----.........--......---.---------......----.........................-.....--.........--
d1fj2a_ --.-----.........--......--A.AVIFLHGLG......DTGH.........................G.....WAeafagirs.SH
d1gkla_ --.-----.........--......---.---------......----.........................-.....--.........--
d1i6wa_ --.-----.........--......--N.PVVMVHGIG......GASF.........................N.....FA.........GI
d1imja_ LF.FREAL.........PGsgq...ARF.SVLLLHGIR......FSSE.........................T.....WQnl.......GT
d1iupa_ TN.YHDVG.........EG......--Q.PVILIHGSGpgv...SAYA.........................N.....WR.........LT
d1ivya_ LH.YWFVEsqkd.....PE......NSP.VVLWLNGGP......GCSSldglltehgpflvqpdgvtleynpyS.....WN.........LI
d1j1ia_ TR.YLEAG.........KG......--Q.PVILIHGGG......AGAE.........................Segn..WR.........NV
d1jfra_ IY.YPTSTa........DG......TFG.AVVISPGFT......AYQS.........................S.....IA.........WL
d1ji3a_ --.-----.........--......-DA.PIVLLHGFT......GWGR.........................Eem...FGfkywggvrgDI
d1jjfa_ --.-----.........DK......KYS.VLYLLHGIG......GSEN.........................D.....WFegggran..VI
d1jkma_ IT.LHVFRpagv.....EG......VLP.GLVYTHGGG......MTIL.........................T.....TDnrvhr....RW
d1jmkc_ --.-----.........--......--Q.IIFAFPPVL......GYGL.........................M.....YQ.........NL
d1ju3a2 LA.VDLYR.........PDa.....DGP.VPVLLVRNP......YDKF.........................Dvfa..WStqs......TN
d1k4ya_ --.----K.........RG......RLP.VMVWIHGGGlmv...GGAS.........................T.....YD.........GL
d1k8qa_ LG.IDRIPygrk.....NSenig..RRP.VAFLQHGLL......ASAT.........................N.....WIsnlpnn...SL
d1l7aa_ IT.GWYAVpdk......EG......PHP.AIVKYHGYN......ASYD.........................G.....EI.........HE
d1lgya_ --.-----.........--......---.---------......----.........................-.....--.........--
d1lnsa3 --.-----.........--......---.---FTHGWT......YSLN.........................D.....--.........--
d1lzla_ --.-----.........AG......PVP.VLLWIHGGGfai...GTAE.........................S.....SD.........PF
d1m33a_ -W.WQTKG.........QG......-NV.HLVLLHGWG......LNAE.........................V.....WR.........CI
d1mnaa_ --.-----.........--......---.VLVGCTGTAan....GGPH.........................E.....FL.........RL
d1mpxa2 LH.TVIVL.........PKgak...NAP.IVLTRTPYD......ASGR.........................T.....ERlas......PH
d1mtza_ IY.YKLCKa........PE......EKA.KLMTMHGGP......GMSH.........................D.....YL.........LS
d1n1ma2 FW.YQMIL.........PPhfdkskKYP.LLLDVYAGP......CSQK.........................Adtv..FRl........NW
d1p0ia_ --.----Apk.......PK......NAT.VLIWIYGGGfqt...GTSS.........................L.....HV.........YD
d1pjaa_ --.-----.........--......-YK.PVIVVHGLF......DSSY.........................S.....FR.........HL
d1pv1a_ -Y.AQDFPr........NK......RIP.TVFYLSGLT......CTPD.........................N.....ASek.......AF
d1q0ra_ LW.SDDFG.........DP......ADP.ALLLVMGGN......LSAL.........................G.....WPd........EF
d1qe3a_ --.-PDTP.........SQ......NLP.VMVWIHGGAfyl...GAGS.........................E.....PL.........YD
d1qfma2 --.-----.........--......---.---------......----.........................-.....--.........--
d1qlwa_ VR.YQIPQ.........RA......KRY.PITLIHGCC......LTGM.........................T.....WEttpdgrm..GW
d1qo7a_ IH.FAALF.........SEre....DAV.PIALLHGWP......GSFV.........................E.....FY.........PI
d1qoza_ --.-----.........--......---.---------......----.........................-.....--.........--
d1qtra_ IY.WELSG.........NP......NGK.PAVFIHGGP......GGGI.........................S.....-P.........HH
d1r1da_ --.-----.........--......--R.AVLLLHGFT......GNSA.........................D.....VR.........ML
d1r3da_ --.-----.........--......RTP.LVVLVHGLL......GSGA.........................D.....WQ.........PV
d1tcaa_ --.-----.........--......-SK.PILLVPGTG......TTGP.........................Qs....FDs........NW
d1thga_ --.-----.........--......---.---------......----.........................-.....--.........--
d1thta_ LH.VWETP.........PKenvpf.KNN.TILIASGFA......RRMD.........................H.....FA.........GL
d1tiba_ --.-----.........--......---.---------......----.........................-.....--.........--
d1ufoa_ --.---IP.........EA......PKA.LLLALHGLQ......GSKE.........................H.....IL.........AL
d1ukca_ --.-----.........--......KLP.VWLFIQGGGyaen..SNAN.........................Y.....NG.........TQ
d1uwca_ --.-----.........--......---.---------......----.........................-.....--.........--
d1uxoa_ --.-----.........--......---.-VYIIHGYR......ASST.........................Nh....WF.........PW
d1vkha_ LT.FQEIS.........QN......TRE.AVIYIHGGAwndpe.NTPN.........................D.....FN.........QL
d1wht.1 LF.YLLQE.........APedaq..PAP.LVLWLNGGP......GCSS.........................V.....AY.........GA
d1wpxa1 FF.FWTFEsrnd.....PA......KDP.VILWLNGGP......GCSS.........................L.....TGlffelgps.SI
d1xfda2 LP.MQILK.........PAtftdttHYP.LLLVVDGTP......GSQS.........................V.....AEkfevs....WE
d1xkta_ --.-----.........--......-ER.PLFLVHPIE......GSTT.........................V.....FH.........SL
d1zoib_ IF.YKDWG.........PR......DAP.VIHFHHGWP......LSAD.........................D.....WD.........AQ
d2b20a2 --.-----.........--......---.-----HELP......CNAD.........................F.....WL.........AV
d2b61a1 VA.YQTYGtln......DE......KNN.AVLICHALT......GDAEpyfddgrdg................W.....WQ.........NF
d2bcea_ --.-----.........--......---.---------......----.........................-.....--.........--
d2cbga_ -H.VIQLN.........QQ......GGK.NLFCFPPIS......GFGI.........................Y.....FK.........DL
d2d81a1 --.-----.........--......---.---------......----.........................-.....--.........--
d2dsta1 LV.FDRVG.........KG......--P.PVLLV----......--AE.........................E.....AS.........RW
d2fuka1 --.-----.........--......---.TAIVCHPLS......TEGG.........................S.....MHnkvvt....MA
d2gzsa1 --.-----.........--......---.---------......----.........................-.....--.........--
d2h1ia1 --.--QKGk........DT......SKP.VLLLLHGTG......GNEL.........................D.....LL.........PL
d2hu7a2 TY.VLESGra.......PT......PGP.TVVLVHGGPfa....EDSD.........................S.....WD.........TF
d2i3da1 LE.GRYQPsk.......EK......SAP.IAIILHPHP......QFGG.........................T.....MNnqivy....QL
d2jbwa1 MPvYVRIPeg.......PG......PHP.AVIMLGGLE......STKE.........................E.....SF.........QM
d2ocka_ LH.YQQTG.........EG......-DH.AVLLLPGML......GSGE.........................Td....FG.........PQ
d2ogsa_ LN.IWSPAa........DGk.....KRP.VLFWIHGGAflf...GSGS.........................S.....PW.........YD
d2pbla1 --.-----.........--......PVG.LFVFVHGGYwma...FDKS.........................S.....WS.........HL
d2psja_ IN.YYDSE.........KH......AEN.AVIFLHGNA......TSSY.........................L.....WR.........HV
d2r8ba1 --.-----.........--......GAP.LFVLLHGTG......GDEN.........................Q.....FF.........DF
d2rhwa1 IH.YNEAG.........NG......--E.TVIMLHGGGpga...GGWS.........................N.....YY.........RN
d2vata1 VA.YKSWGrm.......NVs.....RDN.CVIVCHTLT......SSAH.........................Vts...WWptlf.....GQ
d2vf2a_ LH.YHEAG.........VG......NDQ.TVVLLHGGG......PGAA.........................S.....WTnfs......RN
d2xmza_ -H.YKFYE.........ANve....TNQ.VLVFLHGFL......SDSR.........................T.....YH.........NH
d2xt0a_ MH.YVDEG.........PR......DAEhTFLCLHGEP......SWSF.........................L.....YR.........KM
d2xuah_ LH.YRIDGer.......HG......NAP.WIVLSNSLG......TDLS.........................M.....WA.........PQ
d3ainb_ IK.ARVYY.........PKtqg...PYG.VLVYYHGGGfvl...GDIE.........................S.....YD.........PL
d3b5ea1 FP.YRLLG.........AGke....SRE.CLFLLHGSG......VDET.........................T.....LV.........PL
d3bdia1 VF.QRKMVt........DS......NRR.SIALFHGYS......FTSM.........................D.....WDka.......DL
d3be8b1 --.-----.........NS......KKP.VMVYIHGGSyme...GTGN.........................M.....ID.........GS
d3cn7c_ --.-----.........--......ADA.CIIWLHGLG......ADRT.........................D.....FK.........PV
d3d2ci_ --.-----.........--......--N.PVVMVHGIG......GSSS.........................N.....FE.........GI
d3dlta_ --.-----.........-G......TDT.GVVLLHAYT......GSPN.........................D.....MN.........FM
d3fcyc_ IH.AKYIK.........PKteg...KHP.ALIRFHGYS......SNSG.........................D.....WN.........DK
d3foba_ IY.YEDHG.........TG......--K.PVVLIHGWP......LSGR.........................S.....WE.........YQ
d3g7nb_ --.-----.........--......---.---------......----.........................-.....--.........--
d3grob_ --.-----.........--......---.PLVIWHGMG......DSCC.........................N.....PLsm.......GA
d3hzoa1 LA.YDDNG.........TG......--D.PVVFIAGRG......GAGR.........................T.....WHp........HQ
d3i1ia_ MG.YETYGtln......RE......RSN.VILICHYFS......ATSHaagkytahdeesg............W.....WD.........GL
d3k6ka_ LT.LTDLGgvpcirqatDGa.....GAA.HILYFHGGGyis...GSPS.........................T.....HL.........VL
d3kxpb_ LN.VREKG.........SG......--P.LMLFFHGIT......SNSA.........................V.....FE.........PL
d3og9a_ --.-FKAG.........RK......DLA.PLLLLHSTG......GDEH.........................Q.....LV.........EI
d3qpda_ --.-----.........--......---.---------......----.........................-.....--.........--
d3qvmb_ --.-----.........--......GEK.TVLLAHGFG......CDQN.........................M.....WR.........FM
d3qyjb_ IN.LVKAG.........HG......--A.PLLLLHGYP......QTHV.........................M.....WH.........KI
d3stvb_ --.-----.........--......--K.HFVLVHTAF......HGAW.........................C.....WY.........KI
d3u0va_ --.-----.........--......---.SLIFLHGSG......DSGQ.........................G.....LR.........MW
d3vvma_ IA.YETFGsln......AA......RDN.AVLVLTALS......GDAHaasrpddptpg..............W.....WE.........AM
d3wibb_ IH.TVEHG.........SG......--A.PIVFLHGNP......TSSY.........................L.....WR.........HI
d3wj2a_ LN.ARMYD.........DNn.....AKS.AILYYHGGGflf...GNIE.........................T.....YD.........NY
d4dnqa_ -N.VRVVG.........SG......-ER.VLVLAHGFG......TDQS.........................A.....WN.........RI
d4ehba_ LH.YVKGG.........QG......--P.LVMLVHGFG......QTWY.........................E.....WH.........QL
d4ffwa2 FW.YQMIL.........PPhfdkskKYP.LLIDVYAGP......CSQK.........................Adaa..FRl........NW
d4hs9a_ --.-----.........--......-KY.PIVLVHGLA......GFSE.........................IvgfpyFY.........GI
d4i3fa1 TF.LNEAG.........TD......KDT.SILLLHGSGpg....ANAM.........................Sn....WQ.........YA
d4j7ab_ --.----Ptghtsd...SD......PLP.CVVHTHGGG......MVIL.........................TaadanYS.........RW
d4jeia_ --.-----.........--......---.---------......----.........................-.....--.........--
d4kafa1 MH.YVDVG.........PR......DGT.PVLFLHGNP......TSSY.........................V.....WR.........NI
d4ke6e_ --.-----.........--......NGPvGVLLVHGFT......GTPH.........................S.....MR.........PL
d4l3wa_ --.-----.........--......---.---------......----.........................-.....--.........--
d4lipd_ --.-----.........--......TRY.PIILVHGLTgtdkyaGVLE.........................Y.....WY.........GI
d4lyea_ TH.YIEMG.........EG......--D.PLVLVHGGG......AGAD.........................Grsn..FA.........DN
d4mwsa_ LH.YWFVEsqkd.....PE......NSP.VVLWLNGGP......GCSSldglltehgpflvqpdgvtleynpyS.....WN.........LI
d4nmwa_ IW.WQTYG.........EG......-NC.HLVLLHGWG......LNAE.........................V.....WH.........CI
d4nzzb_ LH.YISKG.........QG......--E.LMLFLHGFP......DFSH.........................I.....WR.........HQ
d4pw0a_ YA.YRSLG.........AP......SDI.PLICFQHFT......GTLD.........................N.....WD.........PL
d4q34a_ -A.YVFYQ.........KPvga...RKY.PLVFAHGVG......QFSK.........................T.....WEttpdgre..GF
d4rncb_ IV.YRVTG.........NS......AGT.PLVLLHGWA......QSSQ.........................C.....WGe........QV
d4uhca1 LA.FEDTG.........TG......--L.PVLLVHGFP......LDRT.........................M.....WK.........AQ
d4updb_ --.-----.........--......---.---------......----.........................-.....--.........--
d4wy8a1 --.-----.........--......-LP.PIVFFHGGGwvv...GSKL.........................T.....HR.........RT
d4x00b_ LA.VQEAG.........DP......EGS.PIIFIHGLL......GSRL.........................N.....WS.........KQ
d4xvcb1 --.WIYAP.........-Gar....DDQ.VFLYLHGGGyvi...GSMR.........................T.....HR.........VM
d4zv9e1 VR.GYLVKpakm.....SG......KTP.AVVVVHENR......GLNP.........................Y.....IE.........DV
d4zwna1 FG.YMFWPvqngt....NE......VRG.RVLLIHGFG......EYTK.........................I.....QF.........RL
d5a62a_ TY.YEDHG.........DA......RSY.PLVLIHPIG......GNIL.........................I.....WD.........YE
d5ah0a1 --.-----.........--......--Y.PIVLVHGFM......GWGRnevlglk..................Y.....WGgit......DY
d5dwda_ --.-----.........--......-KS.LVVLLHGYG......SDGR.........................D.....LI.........AL
d5egna_ IY.YDSYG.........EG......--V.PIVFLHPFS......TNGG.........................I.....WY.........FQ
d5frda1 VS.LLKGR.........--......-ER.KVFYIHSSG......SDAT.........................Q.....WV.........NQ
d5fv4a_ --.----K.........RG......RLP.VMVWIHGGGlvv...GGAS.........................T.....YD.........GL
d5h3ha_ IY.VEDIG.........SG......--Q.PVVMLHGWP......ANNN.........................M.....FE.........YQ
d5hk8a_ --.-----.........--......---.-FVFVHGAS......HGAW.........................C.....WY.........KL
d5jkja_ VG.WEAYGtln......DA......KSN.VILITHYFS......GSSHaagkydendpapg............Y.....WD.........SI
d5mifa_ --.-----.........--......-LP.VIAYFHGGGwvf...GGPK.........................S.....YR.........GL
d5n4fa1 IP.MFIVR.........HKstkf..DGT.AAAIQYGYG......GFAT.........................Sadpf.FS.........PI
d5syna_ --.-----.........--......ETA.AVIFLHGLG......DTGH.........................S.....WAdalstirl.PH
d5uroa1 YS.YILGE.........PAgp....KLE.TVVLVHGWP......DMAF.........................G.....WR.........HQ
d5w15a1 IA.WGTLG.........EG......--P.PLVLVHGTP......FSSQ.........................V.....WR.........RI
d5w1ua_ --.---INp........SK......PLP.VMLYIYGGGfte...GTSG.........................T.....EL.........YG
d5w8oa_ IA.VERWGels......PS......RDN.VVVVLHALT......GDSHvagpagpnyptpg............W.....WD.........GV
d5yhpa_ LS.IKEYG.........NP......QGK.PVVFLHGGP......GGGA.........................S.....-D.........SD
d6emia_ --.-----.........PK......NAT.VMVWIYGGGfqt...GTSS.........................L.....PV.........YD

d1a88a_ M........LFFL...........................SH...G....Y.............RVIAH..DRR.............G.H..
d1a8qa_ L........KAVV...........................DA...G....Y.............RGIAH..DRR.............G.H..
d1ac5a_ G........----...........................--...-....Swiskg........DLLFI..DQPt............G.T..
d1auoa_ A........EALQ...........................ESll.T....T.............RFVLP..QAP.............-.-..
d1b6ga_ I........PVFA...........................ES...G....A.............RVIAP..DFF.............G.F..
d1brta_ S........AALL...........................DA...G....Y.............RVITY..DRR.............G.F..
d1bu8a2 C........KKMF...........................QVe..K....V.............NCICV..DWR.............R.G..
d1c4xa_ I........PDLA...........................EN...-....F.............FVVAP..DLI.............G.F..
d1cexa_ -........----...........................--...-....-.............-----..---.............-.-..
d1cv2a_ M........PHCA...........................GL...-....G.............RLIAC..DLI.............G.M..
d1dina_ V........SWLV...........................DQ...G....Y.............AAVCP..DLY.............A.R..
d1dwoa_ K........PALE...........................RA...G....H.............KVTAL..DMA.............A.S..
d1dx4a_ -........----...........................--...-....-.............-----..---.............-.-..
d1ehya_ I........GPLA...........................EH...-....Y.............DVIVP..DLR.............G.F..
d1ei9a_ I........KKMV...........................EKkipG....I.............HVLSL..EI-.............-.-..
d1ek1a2 I........PALA...........................QA...G....F.............RVLAI..DMK.............G.Y..
d1evqa_ C........RVLA...........................KD...G....Ra............VVFSV..DYR.............-.-..
d1ex9a_ P........SALR...........................RD...G....A.............QVYVT..EV-.............-.-..
d1f0na_ -........----...........................--...-....-.............-----..---.............-.-..
d1fj2a_ I........KYIC...........................PH...-....Apvrpvtlnm....NVAMP..SWF.............DiI..
d1gkla_ -........----...........................--...-....-.............-----..---.............-.-..
d1i6wa_ K........SYLV...........................SQ...G....Wsrd..........KLYAV..DFW.............-.-..
d1imja_ L........HRLA...........................QA...G....Y.............RAVAI..DLP.............G.L..
d1iupa_ I........PALS...........................KF...-....Y.............RVIAP..DMV.............G.F..
d1ivya_ A........----...........................--...-....-.............NVLYL..ESPa............G.V..
d1j1ia_ I........PILA...........................RH...-....Y.............RVIAM..DML.............G.F..
d1jfra_ G........PRLA...........................SQ...G....F.............VVFTI..DT-.............-.-..
d1ji3a_ E........QWLN...........................DN...G....Y.............RTYTL..AVG.............-.-..
d1jjfa_ A........DNLI...........................AE...GkikpL.............IIVTP..NT-.............-.-..
d1jkma_ C........TDLA...........................AA...G....S.............VVVMV..DFR.............N.A..
d1jmkc_ S........SRLP...........................S-...-....Y.............KLCAF..DF-.............-.-..
d1ju3a2 W........LEFV...........................RD...G....Y.............AVVIQ..DTR.............G.L..
d1k4ya_ A........LSAH...........................EN...-....V.............VVVTI..QYRlgiw.........G.F..
d1k8qa_ A........FILA...........................DA...G....Y.............DVWLG..NSR.............G.N..
d1l7aa_ M........VNWA...........................LH...G....Y.............ATFGM..LVR.............G.Q..
d1lgya_ -........----...........................--...-....-.............-----..---.............-.-..
d1lnsa3 -........-YFL...........................TR...G....F.............ASIYV..AGV.............G.T..
d1lzla_ C........VEVA...........................REl..G....F.............AVANV..EYR.............-.-..
d1m33a_ D........EELS...........................SH...-....F.............TLHLV..DLP.............G.F..
d1mnaa_ S........TSFQ...........................EE...-....R.............DFLAV..PLP.............G.Y..
d1mpxa2 MkdllsagdDVFV...........................EG...G....Y.............IRVFQ..DVR.............G.K..
d1mtza_ L........RDMT...........................KE...G....I.............TVLFY..DQF.............G.C..
d1n1ma2 A........TYLA...........................STe..N....I.............IVASF..DGR.............G.S..
d1p0ia_ G........KFLA...........................RVe..R....V.............IVVSM..NYRvgal.........G.F..
d1pjaa_ L........EYIN...........................EThp.G....T.............VVTVL..DL-.............-.-..
d1pv1a_ W........QFQA...........................DKy..G....F.............AIVFP..DTS.............P.R..
d1q0ra_ A........RRLA...........................DG...G....L.............HVIRY..DHR.............D.T..
d1qe3a_ G........SKLA...........................AQ...Ge...V.............IVVTL..NYR.............-.-..
d1qfma2 -........----...........................--...-....-.............-----..---.............-.-..
d1qlwa_ D........EYFL...........................RK...G....Y.............STYVI..DQS.............G.R..
d1qo7a_ L........QLFR...........................EE...-....Ytpetlpf......HLVVP..SLP.............G.Y..
d1qoza_ -........----...........................--...-....-.............-----..---.............-.-..
d1qtra_ R........QLFD...........................PE...R....Y.............KVLLF..DQR.............G.C..
d1r1da_ G........RFLE...........................SK...G....Y.............TCHAP..IYK.............G.H..
d1r3da_ L........SHLA...........................RT...Q....C.............AALTL..DLP.............G.H..
d1tcaa_ I........PLST...........................QL...G....Y.............TPCWI..SPP.............-.-..
d1thga_ -........----...........................--...-....-.............--VSI..NYR.............-.-..
d1thta_ A........EYLS...........................TN...G....F.............HVFRY..DSL.............HhV..
d1tiba_ -........----...........................--...-....-.............-----..---.............-.-..
d1ufoa_ L........PGYA...........................ER...G....F.............LLLAF..DAP.............R.H..
d1ukca_ V........IQAS...........................DD...V....I.............VFVTF..NYRvgal.........G.F..
d1uwca_ -........----...........................--...-....-.............-----..---.............-.-..
d1uxoa_ Lk.......KRLL...........................AD...G....V.............QADIL..NMP.............-.-..
d1vkha_ A........NTIK...........................SM...DtestV.............CQYSI..EYR.............-.-..
d1wht.1 S........EELGafrvkpr....................G-...-....AglvlneyrwnkvaNVLFL..DSPa............G.V..
d1wpxa1 G........PDLKpignpysw...................NS...N....A.............TVIFL..DQPv............N.V..
d1xfda2 T........VMVS...........................SH...G....A.............VVVKC..DGR.............G.S..
d1xkta_ A........SRLS...........................--...-....I.............PTYGL..QC-.............-.-..
d1zoib_ L........LFFL...........................AH...G....Y.............RVVAH..DRR.............G.H..
d2b20a2 Q........QELL...........................PL...-....V.............KVIAP..---.............-.-..
d2b61a1 Mgag.....LALD...........................TD...R....Y.............FFISS..NVL.............GgC..
d2bcea_ -........EEIA...........................TRg..N....V.............IVVTF..NYRvgplgfl......S.T..
d2cbga_ A........LQLN...........................HK...-....A.............AVYGF..HF-.............-.-..
d2d81a1 -........----...........................--...-....-.............-----..---.............-.-..
d2dsta1 P........EALP...........................E-...G....Y.............AFYLL..DLP.............G.Y..
d2fuka1 A........RALR...........................EL...G....I.............TVVRF..NFR.............S.V..
d2gzsa1 -........----...........................--...-....-.............-----..---.............-.-..
d2h1ia1 A........EIVD...........................SE...-....A.............SVLSV..--R.............G.N..
d2hu7a2 A........ASLA...........................AA...G....F.............HVVMP..NYR.............GsT..
d2i3da1 F........YLFQ...........................KR...G....F.............TTLRF..NFR.............S.I..
d2jbwa1 E........NLVL...........................DR...G....M.............ATATF..DGP.............G.Q..
d2ocka_ L........KNLN...........................KK...L....F.............TVVAW..DPR.............G.Y..
d2ogsa_ G........TAFA...........................KHg..D....V.............VVVTI..NYRmnvfgfl......H.L..
d2pbla1 A........VGAL...........................SK...G....W.............AVAMP..SY-.............-.-..
d2psja_ V........PHIE...........................PV...-....A.............RCIIP..DLI.............G.M..
d2r8ba1 G........ARLL...........................PQ...-....A.............TILSPvgDVS.............E.H..
d2rhwa1 V........GPFV...........................DA...G....Y.............RVILK..DSP.............G.F..
d2vata1 G........RAFD...........................TS...R....Y.............FIICL..NYL.............G.S..
d2vf2a_ I........AVLA...........................RH...-....F.............HVLAV..DQP.............G.Y..
d2xmza_ I........EKFT...........................DN...-....Y.............HVITI..DLP.............G.H..
d2xt0a_ L........PVFT...........................AA...G....G.............RVVAP..DLF.............G.F..
d2xuah_ V........AALS...........................KH...-....F.............RVLRY..DTR.............G.H..
d3ainb_ C........RAIT...........................NSc..Q....C.............VTISV..DYR.............-.-..
d3b5ea1 A........RRIA...........................PT...-....A.............TLVAA..RGRipqed........G.F..
d3bdia1 F........NNYS...........................KI...G....Y.............NVYAP..DYP.............G.F..
d3be8b1 I........LASY...........................GN...-....V.............IVITI..NYRlgil.........G.-..
d3cn7c_ A........EALQmvlpstrfilpqapsqavtvnggwvmpSW...-....Y.............DILAF..---.............-.-..
d3d2ci_ K........SYLV...........................SQ...G....Wsrd..........KLYAV..DFW.............-.-..
d3dlta_ A........RALQ...........................RS...G....Y.............GVYVP..LFS.............G.H..
d3fcyc_ L........NYVA...........................A-...G....F.............TVVAM..DVR.............G.Q..
d3foba_ V........PALV...........................EA...G....Y.............RVITY..DRR.............G.F..
d3g7nb_ -........----...........................--...-....-.............-----..---.............-.-..
d3grob_ I........KKMV...........................EKkipG....I.............YVLSL..EI-.............-.-..
d3hzoa1 V........PAFL...........................AA...G....Y.............RCITF..DNR.............G.I..
d3i1ia_ Igpg.....KAID...........................TN...Q....Y.............FVICT..DNL.............C.N..
d3k6ka_ T........TQLA...........................KQs..S....A.............TLWSL..DYR.............-.-..
d3kxpb_ M........IRLS...........................DR...-....F.............TTIAV..DQR.............G.H..
d3og9a_ A........EMIA...........................PS...-....H.............PILSI..RGRineqgvnryfklrG.L..
d3qpda_ -........----...........................--...-....-.............-----..---.............-.-..
d3qvmb_ L........PELE...........................KQ...-....F.............TVIVF..DYV.............G.S..
d3qyjb_ A........PLLA...........................NN...-....F.............TVVAT..DLR.............G.Y..
d3stvb_ V........ALMR...........................SS...G....H.............NVTAL..DL-.............-.-..
d3u0va_ I........KQVLnqdlt......................FQ...H....I.............KIIYP..TAP.............P.R..
d3vvma_ Vgpg.....KPVD...........................TD...L....W.............HVICV..NSL.............GsC..
d3wibb_ F........RRLH...........................GH...-....G.............RLLAV..DLI.............G.Y..
d3wj2a_ C........RFLA...........................KEs..G....V.............KIISI..EYR.............-.-..
d4dnqa_ L........PFFL...........................RD...-....Y.............RVVLY..DLV.............-.C..
d4ehba_ M........PELA...........................KR...-....F.............TVIAP..DLP.............G.L..
d4ffwa2 A........TYLA...........................STe..N....I.............IVASF..DGR.............G.S..
d4hs9a_ A........DALT...........................QD...G....H.............QVFTA..SL-.............-.-..
d4i3fa1 L........PFLA...........................EN...-....Y.............HCLAP..DIA.............G.F..
d4j7ab_ R........SELA...........................AT...G....L.............VVVGV..EFR.............N.A..
d4jeia_ -........----...........................--...-....-.............-----..---.............-.-..
d4kafa1 I........PHVA...........................PT...-....H.............RCIAP..DLI.............G.M..
d4ke6e_ A........EAYA...........................KA...G....Y.............TVCLP..RLK.............G.H..
d4l3wa_ -........----...........................--...-....-.............-----..---.............-.-..
d4lipd_ Q........EDLQ...........................QR...G....A.............TVYVA..NLS.............G.F..
d4lyea_ F........PIFA...........................RH...-....M.............RVIAY..DMV.............G.F..
d4mwsa_ A........----...........................--...-....-.............NVLYL..ESPa............G.V..
d4nmwa_ R........EELG...........................SH...-....F.............TLHLV..DLP.............G.Y..
d4nzzb_ I........DEFS...........................ND...-....F.............HTVAL..DLR.............G.Y..
d4pw0a_ I........TNGL...........................SK...G....R.............QLIIF..DNK.............G.V..
d4q34a_ Q........NIFL...........................RR...R....F.............CVYLV..DQP.............R.R..
d4rncb_ L........ADLA...........................AD...-....Y.............RLIAV..DLR.............G.H..
d4uhca1 R........EELC...........................DE...-....F.............RVIVP..DLR.............G.F..
d4updb_ -........----...........................--...-....F.............IFVAI..NYRvg...........G.F..
d4wy8a1 V........YELT...........................VRa..R....A.............AVIFV..NYS.............-.-..
d4x00b_ L........QDPR...........................LQ...H....Y.............RLITY..DLR.............G.H..
d4xvcb1 L........SHIA...........................RAa..G....C.............RVLGL..DYR.............-.-..
d4zv9e1 A........RRVA...........................KA...G....Y.............IALAP..DGL.............NsV..
d4zwna1 M........DHLS...........................LN...G....Y.............ESFTF..DQR.............G.A..
d5a62a_ I........QLLL...........................KS...G....F.............RVIAY..ELR.............G.H..
d5ah0a1 E........QELS...........................SY...G....Y.............TAYTA..TV-.............-.-..
d5dwda_ G........QFWR...........................DSfp.D....T.............MFVAP..NAP.............HvC..
d5egna_ T........FPFA...........................QT...-....N.............HVIVI..DHR.............G.H..
d5frda1 L........TAIG...........................G-...-....-.............--YAI..DLP.............N.H..
d5fv4a_ A........LAAH...........................EN...-....V.............VVVAI..QYRlgiw.........G.F..
d5h3ha_ K........NRLL...........................EE...G....Y.............RYIGV..DYR.............G.Y..
d5hk8a_ T........TLLD...........................AA...G....F.............KSTSV..DLT.............G.A..
d5jkja_ Igpg.....KAID...........................TD...R....F.............YVISV..DTL.............A.Nln
d5mifa_ I........TNLI...........................REs..G....A.............AVFFV..DYT.............-.-..
d5n4fa1 Il.......TFLQ...........................TY...G....A.............IFAVP..SIR.............G.G..
d5syna_ V........KYICphapripv...................TL...N....M.............KMVMP..SWF.............DlM..
d5uroa1 I........PYLM...........................SL...G....F.............QVVAP..NML.............G.Y..
d5w15a1 A........PWLA...........................RR...-....H.............RVFFY..DLL.............G.Y..
d5w1ua_ P........DFLV...........................QK...D....I.............VLVSF..NYRigal.........G.-..
d5w8oa_ Vgpg.....AAID...........................TR...R....W.............CAIAT..NVL.............GgC..
d5yhpa_ A........RRFN...........................PT...T....Y.............RIVLF..DQR.............G.S..
d6emia_ G........KFLA...........................RVe..R....V.............IVVSM..NYRvgal.........G.F..

           60                                                          70                           
            |                                                           |                           
d1a88a_ ....GRSDQPST..................................................GHDMDTY...AA..D...............
d1a8qa_ ....GHSTPVWD..................................................GYDFDTF...AD..D...............
d1ac5a_ ....GFSVEQNKdegkidknkf........................................DEDLEDV...TK..H...............
d1auoa_ ....---TRPVTinggyempswydikamsparsis...........................LEELEVS...AK..M...............
d1b6ga_ ....GKSDKPVDee................................................DYTFEFH...RN..F...............
d1brta_ ....GQSSQPTT..................................................GYDYDTF...AA..D...............
d1bu8a2 ....SRTEYTQA..................................................SYNTRVV...GA..E...............
d1c4xa_ ....GQSEYPETypgh..............................................IMSWVGMr..VE..Q...............
d1cexa_ ....--------..................................................-----AA...IR..E...............
d1cv2a_ ....GDSDKLDPsgpe..............................................RYAYAEH...RD..Y...............
d1dina_ ....QAPGTALDpqderqreqayklwq...................................AFDMEAG...VG..D...............
d1dwoa_ ....GIDPRQIEq.................................................INSFDEY...SE..P...............
d1dx4a_ ....--------..................................................-------...--..-...............
d1ehya_ ....GDSEKPDLndls..............................................KYSLDKA...AD..D...............
d1ei9a_ ....GKTLREDV..................................................ENSFFLN...VNs.Q...............
d1ek1a2 ....GDSSSPPEie................................................EYAMELL...CK..E...............
d1evqa_ ....-----LAP..................................................EHKFPAA...VE..D...............
d1ex9a_ ....--SQLDTS..................................................EVRGEQL...LQ..Q...............
d1f0na_ ....-----YSDwyspacgkagcq......................................TYKWETF...LTs.E...............
d1fj2a_ ....GLSPDSQEd.................................................ESGIKQA...AE..N...............
d1gkla_ ....--------..................................................-------...--..-...............
d1i6wa_ ....------DKtgtn..............................................YNNGPVL...SR..F...............
d1imja_ ....GHSKEAAA..................................................PAPIGEL...APgsF...............
d1iupa_ ....GFTDRPENy.................................................NYSKDSW...VD..H...............
d1ivya_ ....GFSYSDDKfyatndtev.........................................AQSNFEA...LQ..D...............
d1j1ia_ ....GKTAKPDI..................................................EYTQDRR...IR..H...............
d1jfra_ ....-----NTT..................................................LDQPDSR...GR..Q...............
d1ji3a_ ....-----PLSsnwdrvceayvqlvggtvdygaahaa........................KHGHARF...GR..T...............
d1jjfa_ ....-------Naagpgi............................................ADGYENF...TK..D...............
d1jkma_ ....WTAEGHHPfpsg..............................................VEDCLAA...VL..W...............
d1jmkc_ ....--------..................................................-IEEEDR...LD..R...............
d1ju3a2 ....FASEGEFVp.................................................HVDDEAD...AE..D...............
d1k4ya_ ....FSTGD--Ehsrg..............................................NWGHLDQ...VA..A...............
d1k8qa_ ....TWARRNLYyspdsvefw.........................................AFSFDEM...AKy.D...............
d1l7aa_ ....QRSEDTSIsphghalgwmtkgildkd................................TYYYRGV...YL..D...............
d1lgya_ ....--------..................................................LSSYEQV...VN..D...............
d1lnsa3 ....RSSDGFQTsgdyqq............................................IYSMTAV...ID..W...............
d1lzla_ ....-----LAP..................................................ETTFPGP...VN..D...............
d1m33a_ ....GRSRGFGA..................................................-LSLADM...AE..A...............
d1mnaa_ ....GTGTGTGTall...............................................PADLDTA...LDa.Q...............
d1mpxa2 ....YGSEGDYVmtrplrgpl.........................................NPSEVDH...AT..D...............
d1mtza_ ....GRSEEPDQs.................................................KFTIDYG...VE..E...............
d1n1ma2 ....GYQGDKIMhainr.............................................RLGTFE-...VE..D...............
d1p0ia_ ....LALPGNPEapgnmg............................................LFDQQLA...LQ..W...............
d1pjaa_ ....-----FDG..................................................RESLRPL...WE..Q...............
d1pv1a_ ....GDEVANDPegswdfgqgagfylnatqepyaq...........................HYQMYDY...IHk.E...............
d1q0ra_ ....GRSTTRDFaah...............................................PYGFGEL...AA..D...............
d1qe3a_ ....---LGPFGflhlssfdeaysd.....................................NLGLLDQ...AA..A...............
d1qfma2 ....-------Gi.................................................LANKQNC...FD..D...............
d1qlwa_ ....GRSATDISainavklgkap.......................................ASSLPDL...FA..Agheaawaifrfgpry
d1qo7a_ ....TFSSGPPLdk................................................DFGLMDN...AR..V...............
d1qoza_ ....--------..................................................VNGTNAA...AA..A...............
d1qtra_ ....GRSRPHASld................................................NNTTWHL...VA..D...............
d1r1da_ ....GVPPEELV..................................................HTGPDDW...WQ..D...............
d1r3da_ ....GTNPERHC..................................................-DNFAEA...VE..M...............
d1tcaa_ ....-----PFM..................................................LNDTQVN...TE..Y...............
d1thga_ ....---TGPFGflggdaitaegnt.....................................NAGLHDQ...RK..G...............
d1thta_ ....GLSSGSID..................................................EFTMTTG...KN..S...............
d1tiba_ ....-GFTSSWR..................................................--SVADT...LRq.K...............
d1ufoa_ ....GEREGPPPsskspryveevyrv....................................ALGFKEE...AR..R...............
d1ukca_ ....LASEKVRQngdlnag...........................................LLDQRKA...LR..W...............
d1uwca_ ....--------..................................................------V...QD..Q...............
d1uxoa_ ....-----NPL..................................................QPRLEDW...LD..T...............
d1vkha_ ....-LSPEITN..................................................PRNLYDA...VS..N...............
d1wht.1 ....GFSYTNTSsdiytsgd..........................................NRTAHDS...YA..F...............
d1wpxa1 ....GFSYSGSSg.................................................VSNTVAA...GK..D...............
d1xfda2 ....GFQGTKLLhevrr.............................................RLGLLEE...KD..Q...............
d1xkta_ ....---TRAAP..................................................LDSIHSL...AA..Y...............
d1zoib_ ....GRSSQVWD..................................................GHDMDHY...AD..D...............
d2b20a2 ....--------..................................................-------...--..-...............
d2b61a1 ....KGTTGPSSinpqtgkpygsqfp....................................NIVVQDI...VK..V...............
d2bcea_ ....GDSNLPGN..................................................-YGLWDQhmaIA..W...............
d2cbga_ ....--------..................................................-IEEDSR...IE..Q...............
d2d81a1 ....--------..................................................-------...--..-...............
d2dsta1 ....GRTEGPRM..................................................--APEEL...AH..-...............
d2fuka1 ....GTSAGSFDh.................................................GDGEQDD...LR..A...............
d2gzsa1 ....--------..................................................-------...--..-...............
d2h1ia1 ....VLENGMPRffrrlaegifd.......................................EEDLIFR...TK..E...............
d2hu7a2 ....GYGEEWRLkii...............................................GDPCGGE...LE..D...............
d2i3da1 ....GRSQGEFDh.................................................GAGELSD...AA..S...............
d2jbwa1 ....GEMFEYKRi.................................................AGDYEKY...TS..A...............
d2ocka_ ....GHSRPPDRdfp...............................................ADFFERD...AK..D...............
d2ogsa_ ....GDSFGEAYaqag..............................................NLGILDQ...VA..A...............
d2pbla1 ....-----ELCp.................................................EVRISEI...TQ..Q...............
d2psja_ ....GKSGKSGNg.................................................SYRLLDH...YK..Y...............
d2r8ba1 ....GAARFFRRtgegvydmvdl.......................................ERATGKM...AD..F...............
d2rhwa1 ....NKSDAVVMd.................................................EQRGLVN...AR..A...............
d2vata1 ....PFGSAGPCspdpdaegqrpygakfp.................................RTTIRDD...VR..I...............
d2vf2a_ ....GHSDKRAE..................................................HGQFNRY...AAm.A...............
d2xmza_ ....GEDQSSMDe.................................................TWNFDYI...TT..L...............
d2xt0a_ ....GRSDKPTDda................................................VYTFGFH...RR..S...............
d2xuah_ ....GHSEAPKG..................................................PYTIEQL...TG..D...............
d3ainb_ ....-----LAP..................................................ENKFPAA...VV..D...............
d3b5ea1 ....RWFERIDPtrfe..............................................QKSILAE...TA..A...............
d3bdia1 ....GRSASSEKygid..............................................RGDLKHA...AE..F...............
d3be8b1 ....-------Flstgdqaakg........................................NYGLLDQ...IQ..A...............
d3cn7c_ ....-------Sparaid............................................EDQLNAS...AD..Q...............
d3d2ci_ ....------DKtgtn..............................................YNNGPVL...SR..F...............
d3dlta_ ....GTVEPLDIlt................................................KGNPDIW...WA..E...............
d3fcyc_ ....GGQSQDVGgvtgntlnghi.......................................IRGLDDD...AD..N...............
d3foba_ ....GKSSQPWE..................................................GYEYDTF...TS..D...............
d3g7nb_ ....--------..................................................--VHDTI...IT..E...............
d3grob_ ....GKTLMEDV..................................................ENSFFLN...VNs.Q...............
d3hzoa1 ....GATENAEG..................................................-FTTQTM...VA..D...............
d3i1ia_ ....VQVKNPHVittgpksinpktgdeyamdfp.............................VFTFLDV...AR..M...............
d3k6ka_ ....-----LAP..................................................ENPFPAA...VD..D...............
d3kxpb_ ....GLSDKPET..................................................GYEANDY...AD..D...............
d3og9a_ ....GGFTKENFd.................................................LESLDEE...TD..W...............
d3qpda_ ....--------..................................................-------...IA..E...............
d3qvmb_ ....GQSDLESFstkr..............................................YSSLEGY...AK..D...............
d3qyjb_ ....GDSSRPASvphhi.............................................NYSKRVM...AQ..D...............
d3stvb_ ....GASGINPKqalq..............................................IPNFSDY...LS..P...............
d3u0va_ ....SYTPMKGGisnvwfdrfkitndcpeh................................LESIDVM...CQ..V...............
d3vvma_ ....KGSTGPAStdprtgepyrlsfp....................................ELSIEDI...AD..A...............
d3wibb_ ....GQSSKPDI..................................................EYTLENQ...QR..Y...............
d3wj2a_ ....-----LAP..................................................EHKFPDA...FN..D...............
d4dnqa_ ....AGSVNPDFfdfrr.............................................YTTLDPY...VD..D...............
d4ehba_ ....GQSEPPKT..................................................GYSGEQV...AV..Y...............
d4ffwa2 ....GYQGDKIMhaink.............................................RLGTLEV...ED..Q...............
d4hs9a_ ....--SAFNSN..................................................EVRGKQL...WQ..F...............
d4i3fa1 ....GLSQHNCPpngt..............................................SHWIDIW...VQ..Q...............
d4j7ab_ ....AGALGNHPfpag..............................................LHDCADA...AK..W...............
d4jeia_ ....--------..................................................--TYNQI...GP..K...............
d4kafa1 ....GKSDKPDL..................................................GYFFDDH...VR..F...............
d4ke6e_ ....GTHYEDME..................................................RTTFHDW...VA..S...............
d4l3wa_ ....--------..................................................----NQV...VK..D...............
d4lipd_ ....QSDDGPNG..................................................--RGEQL...LA..Y...............
d4lyea_ ....GQTDAPDPagf...............................................AYTQAAR...TD..H...............
d4mwsa_ ....GFSYSDDKfyatndtev.........................................AQSNFEA...LQ..D...............
d4nmwa_ ....GRSSGFGA..................................................-MTLEEM...TA..Q...............
d4nzzb_ ....NLSEKPSGle................................................SYEIDVL...VE..D...............
d4pw0a_ ....GLSSGTTP..................................................-DNVAAM...TA..D...............
d4q34a_ ....GNAGRGTEsvtispafdeevwfnrfrvgiwpdyfegvqfkrdketldqyfrqmtptigTTDFEVY...SD..A...............
d4rncb_ ....GYSDAPESg.................................................YDDSANW...AG..D...............
d4uhca1 ....GESQVIPG..................................................VATMEAM...AD..D...............
d4updb_ ....GFLGGKEIkadgss............................................NLGLLDQ...RI..A...............
d4wy8a1 ....-LSPEVRF..................................................PTALEEC...LD..A...............
d4x00b_ ....GLSGKPAEass...............................................YTDGRRW...AD..D...............
d4xvcb1 ....-----LAP..................................................ETPFPAP...VE..D...............
d4zv9e1 ....GGYPGNDDkgrelqq...........................................QVDPTKL...MN..D...............
d4zwna1 ....GVTSPGRSkg................................................VTDEYHV...FN..D...............
d5a62a_ ....HRTNMGKTg.................................................AYTMQDL...ID..D...............
d5ah0a1 ....----GPVSsnwdracelyayikggtvdyghahst........................Q------...--..-...............
d5dwda_ ....GGNPFGYEwfpldler..........................................DRTLARL...AGaeT...............
d5egna_ ....GRSDKPAT..................................................GYSIMEH...AD..D...............
d5frda1 ....GQSDTVEV..................................................-NSVDEY...AY..Y...............
d5fv4a_ ....FSTGD--Ehsrg..............................................NWGHLDQ...VA..A...............
d5h3ha_ ....GKSDAPAT..................................................GYDYTTM...AS..D...............
d5hk8a_ ....GISLIDSNi.................................................VFDSDQY...NR..P...............
d5jkja_ aydpH------Vittgptsinpdtgkpygldfp.............................VVTIRDF...VN..V...............
d5mifa_ ....-LTPKVAY..................................................PVPNEQC...YA..A...............
d5n4fa1 ....GEFGEEWHkggrretk..........................................VNTFDDF...IA..A...............
d5syna_ ....GLSPDAPEd.................................................EAGIKKA...AE..N...............
d5uroa1 ....AGTDAPRDls................................................QFTLKSV...SA..D...............
d5w15a1 ....GQSDMPDA..................................................DVSLGRQ...NV..L...............
d5w1ua_ ....-------Flccqseqdgvpg......................................NAGLKDQ...NL..A...............
d5w8oa_ ....RGSTGPGSlhpdgkawgsrfp.....................................AVTVRDQ...VR..A...............
d5yhpa_ ....GESTPASCle................................................DNTTQAL...VE..D...............
d6emia_ ....LALPGNPEapgnmg............................................LFDQQLA...LK..W...............

                                           80                                90        100       110
                                            |                                 |          |         |
d1a88a_ ..................................VAALTEAL.......................DLR.GAV.HIGHSTGGGEVARYVARAE
d1a8qa_ ..................................LNDLLTDL.......................DLR.DVT.LVAHSMGGGELARYVGRHG
d1ac5a_ ..................................FMDFLENYfkifpe.................DLTrKII.LSGESYAGQYIPFFANAIL
d1auoa_ ..................................VTDLIEAQkrtgi..................DAS.RIF.LAGFSQGGAVVFHTAFINW
d1b6ga_ ..................................LLALIERL.......................DLR.NIT.LVVQDWGGFLGLTLPMAD-
d1brta_ ..................................LNTVLETL.......................DLQ.DAV.LVGFSTGTGEVARYVSSYG
d1bu8a2 ..................................IAFLVQVLstemgy.................SPE.NVH.LIGHSLGAHVVGEAGRRL-
d1c4xa_ ..................................ILGLMNHF.......................GIE.KSH.IVGNSMGGAVTLQLVVEA-
d1cexa_ ..................................MLGLFQQAntkc...................PDA.TLI.AGGYSQGAALAAASIEDLD
d1cv2a_ ..................................LDALWEAL.......................DLGdRVV.LVVHDWGSALGFDWARRH-
d1dina_ ..................................LEAAIRYArhqpy..................SNG.KVG.LVGYCLGGALAFLVAAKGY
d1dwoa_ ..................................LLTFLEKLp......................QGE.KVI.IVGESCAGLNIAIAADRY-
d1dx4a_ ..................................--------.......................---.---.-------------------
d1ehya_ ..................................QAALLDAL.......................GIE.KAY.VVGHDFAAIVLHKFIRKY-
d1ei9a_ ..................................VTTVCQILakdpk..................LQQ.GYN.AMGFSQGGQFLRAVAQRC-
d1ek1a2 ..................................MVTFLDKL.......................GIP.QAV.FIGHDWAGVMVWNMALFY-
d1evqa_ ..................................AYDALQWIaeraadfhl..............DPA.RIA.VGGDSAGGNLAAVTSILA-
d1ex9a_ ..................................VEEIVALS.......................GQP.KVN.LIGHSHGGPTIRYVAAVR-
d1f0na_ ..................................LPQWLSANrav....................KPT.GSA.AIGLSMAGSSAMILAAYH-
d1fj2a_ ..................................IKALIDQEvkngi..................PSN.RII.LGGFSQGGALSLYTALTT-
d1gkla_ ..................................--------.......................---.---.-GGFAMGGLTTWYVMVNC-
d1i6wa_ ..................................VQKVLDET.......................GAK.KVD.IVAHSMGGANTLYYIKNLD
d1imja_ ..................................LAAVVDAL.......................ELG.PPV.VISPSLSGMYSLPFLTAP-
d1iupa_ ..................................IIGIMDAL.......................EIE.KAH.IVGNAFGGGLAIATALRY-
d1ivya_ ..................................FFRLFPEY.......................KNN.KLF.LTGESYAGIYIPTLAVLVM
d1j1ia_ ..................................LHDFIKAM.......................NFDgKVS.IVGNSMGGATGLGVSVLH-
d1jfra_ ..................................LLSALDYLtqrssvrtrv.............DAT.RLG.VMGHSMGGGGSLEAAKSR-
d1ji3a_ ..................................YPGLLPELk......................RGG.RIH.IIAHSQGGQTARMLVSLLE
d1jjfa_ ..................................---LLNSLipyiesnysvyt...........DRE.HRA.IAGLSMGGGQSFNIGLTN-
d1jkma_ ..................................VDEHRESL.......................GLS.GVV.VQGESGGGNLAIATTLLAK
d1jmkc_ ..................................YADLIQKLq......................PEG.PLT.LFGYSAGCSLAFEAAKKLE
d1ju3a2 ..................................TLSWILEQaw.....................CDG.NVG.MFGVSYLGVTQWQAAVSG-
d1k4ya_ ..................................LRWVQDNIanfgg..................DPG.SVT.IFGESAGGQSVSILLLSPL
d1k8qa_ ..................................LPATIDFIlkkt...................GQD.KLH.YVGHSQGTTIGFIAFSTN-
d1l7aa_ ..................................AVRALEVIssfdev.................DET.RIG.VTGGSQGGGLTIAAAAL--
d1lgya_ ..................................YFPVVQEQltah...................PTY.KVI.VTGHSLGGAQALLAGMDLY
d1lnsa3 ..................................LNGRARAYtsrkktheikasw..........ANG.KVA.MTGKSYLGTMAYGAATTGV
d1lzla_ ..................................CYAALLYIhahaeelgi..............DPS.RIA.VGGQSAGGGLAAGTVLKAR
d1m33a_ ..................................VLQQA---.......................-PD.KAI.WLGWSLGGLVASQIALTH-
d1mnaa_ ..................................ARAILRAA.......................GDA.PVV.LLGHSGGALLAHELAFRLE
d1mpxa2 ..................................AWDTIDWLvknvse.................SNG.KVG.MIGSSYEGFTVVMALTNP-
d1mtza_ ..................................AEALRSKLf......................GNE.KVF.LMGSSYGGALALAYAVKY-
d1n1ma2 ..................................QIEAARQFskmgfv.................DNK.RIA.IWGWSYGGYVTSMVLGSG-
d1p0ia_ ..................................VQKNIAAFgg.....................NPK.SVT.LFGESAGAASVSLHLLSPG
d1pjaa_ ..................................VQGFREAVvpimak.................APQ.GVH.LICYSQGGLVCRALLSVM-
d1pv1a_ ..................................LPQTLDSHfnkngdvkld.............FLD.NVA.ITGHSMGGYGAICGYLKGY
d1q0ra_ ..................................AVAVLDGW.......................GVD.RAH.VVGLSMGATITQVIALDH-
d1qe3a_ ..................................LKWVRENIsafgg..................DPD.NVT.VFGESAGGMSIAALLAMPA
d1qfma2 ..................................FQCAAEYLikegyt.................SPK.RLT.INGGSNGGLLVATCANQR-
d1qlwa_ pdafkdtqfpvqaqaelwqqmvpdwlgsmptpnpTVANLSKLai.....................KLD.GTV.LLSHSQSGIYPFQTAAMN-
d1qo7a_ ..................................VDQLMKDL.......................GFGsGYI.IQGGDIGSFVGRLLGVGF-
d1qoza_ ..................................INNFHNSC.......................PDT.QLV.LVGYSQGAQIFDN------
d1qtra_ ..................................IERLREMA.......................GVE.QWL.VFGGSWGSTLALAYAQTH-
d1r1da_ ..................................VMNGYQFLknk....................GYE.KIA.VAGLSLGGVFSLKLGYTV-
d1r3da_ ..................................IEQTVQAHvt.....................SEV.PVI.LVGYSLGGRLIMHGLAQGA
d1tcaa_ ..................................MVNAITALyags...................GNN.KLP.VLTWSQGGLVAQWGLTFF-
d1thga_ ..................................LEWVSDNIanfgg..................DPD.KVM.IFGESAGAMSVAHQLIAYG
d1thta_ ..................................LCTVYHWLqtk....................GTQ.NIG.LIAASLSARVAYEVISDLE
d1tiba_ ..................................VEDAVREH.......................PDY.RVV.FTGHSLGGALATVAGADLR
d1ufoa_ ..................................VAEEAERR.......................FGL.PLF.LAGGSLGAFVAHLLLAEGF
d1ukca_ ..................................VKQYIEQFgg.....................DPD.HIV.IHGVSAGAGSVAYHLSAY-
d1uwca_ ..................................VESLVKQQasqy...................PDY.ALT.VTGHSLGASMAALTAAQLS
d1uxoa_ ..................................LSLYQHTL.......................-HE.NTY.LVAHSLGCPAILRFLEHLQ
d1vkha_ ..................................ITRLVKEK.......................GLT.NIN.MVGHSVGATFIWQILAALK
d1wht.1 ..................................LAKWFERFphy....................KYR.DFY.IAGESYAGHYVPELSQLVH
d1wpxa1 ..................................VYNFLELFfdqfpeyvn..............KGQ.DFH.IAGESYAGHYIPVFASEIL
d1xfda2 ..................................MEAVRTMLkeqyi..................DRT.RVA.VFGKDYGGYLSTYILPAK-
d1xkta_ ..................................YIDCIRQVq......................PEG.PYR.VAGYSYGACVAFEMCSQLQ
d1zoib_ ..................................VAAVVAHL.......................GIQ.GAV.HVGHSTGGGEVVRYMARH-
d2b20a2 ..................................-------Fsd.....................RAD.RTV.VAGQSFGGLSALYAGLHW-
d2b61a1 ..................................QKALLEHL.......................GIS.HLKaIIGGSFGGMQANQWAIDY-
d2bcea_ ..................................VKRNIEAFgg.....................DPD.QIT.LFGESAGGASVSLQTLSPY
d2cbga_ ..................................YVSRITEIq......................PEG.PYV.LLGYSAGGNLAFEVVQAM-
d2d81a1 ..................................--------.......................NPN.SVS.VSGLASGGYMAAQLGVAY-
d2dsta1 ..................................--------.......................---.---.-------------------
d2fuka1 ..................................VAEWVRAQr......................PTD.TLW.LAGFSFGAYVSLRAAAALE
d2gzsa1 ..................................--------.......................DRQ.RRG.LWGHSYGGLFVLDSWLS--
d2h1ia1 ..................................LNEFLDEAakeykf.................DRN.NIV.AIGYSNGANIAASLLFHY-
d2hu7a2 ..................................VSAAARWAresg...................LAS.ELY.IMGYSYGGYMTLCALTMK-
d2i3da1 ..................................ALDWVQSLhp.....................DSK.SCW.VAGYSFGAWIGMQLLMRR-
d2jbwa1 ..................................VVDLLTKLeai....................RND.AIG.VLGRSLGGNYALKSAACE-
d2ocka_ ..................................AVDLMKAL.......................KFK.KVS.LLGWSNGGITALIAAAKY-
d2ogsa_ ..................................LRWVKENIaafgg..................DPD.NIT.IFGESAGAASVGVLLSLPE
d2pbla1 ..................................ISQAVTAAake....................IDG.PIV.LAGHSAGGHLVARMLDPEV
d2psja_ ..................................LTAWFELLn......................LPK.KII.FVGHDWGAALAFHYAYEH-
d2r8ba1 ..................................IKANREHY.......................QAG.PVI.GLGFSNGANILANVLIEQ-
d2rhwa1 ..................................VKGLMDAL.......................DID.RAH.LVGNAMGGATALNFALEY-
d2vata1 ..................................HRQVLDRL.......................GVR.QIAaVVGASMGGMHTLEWAFFG-
d2vf2a_ ..................................LKGLFDQL.......................GLG.RVP.LVGNSLGGGTAVRFALDY-
d2xmza_ ..................................LDRILDKY.......................KDK.SIT.LFGYSMGGRVALYYAING-
d2xt0a_ ..................................LLAFLDAL.......................QLE.RVT.LVCQDWGGILGLTLPVDR-
d2xuah_ ..................................VLGLMDTL.......................KIA.RAN.FCGLSMGGLTGVALAARH-
d3ainb_ ..................................SFDALKWVynnsekfn...............GKY.GIA.VGGDSAGGNLAAVTAILSK
d3b5ea1 ..................................FAAFTNEAakrhgl.................NLD.HAT.FLGYSNGANLVSSLMLLH-
d3bdia1 ..................................IRDYLKAN.......................GVA.RSV.IMGASMGGGMVIMTTLQY-
d3be8b1 ..................................LRWIEENVgafgg..................DPK.RVT.IFGSGAGASCVSLLTLSHY
d3cn7c_ ..................................VIALIDEQrakgi..................AAE.RII.LAGFSQGGAVVLHTAFRRY
d3d2ci_ ..................................VQKVLDET.......................GAK.KVD.IVAHSMGGANTLYYIKYLD
d3dlta_ ..................................SSAAVAHMta.....................KYA.KVF.VFGLSLGGIFAMKALETL-
d3fcyc_ ..................................MLFRHIFLdtaqlagivmnmpev........DED.RVG.VMGPSQGGGLSLACAALE-
d3foba_ ..................................LHQLLEQL.......................ELQ.NVT.LVGFSMGGGEVARYISTYG
d3g7nb_ ..................................VKALIAKY.......................PDY.TLE.AVGHSLGGALTSIAHVALA
d3grob_ ..................................VTTVCQALakdpk..................LQQ.GYN.AMGFSQGGQFLRAVAQRC-
d3hzoa1 ..................................TAALIETL.......................DIA.PAR.VVGVSMGAFIAQELMVVA-
d3i1ia_ ..................................QCELIKDM.......................GIA.RLHaVMGPSAGGMIAQQWAVHY-
d3k6ka_ ..................................CVAAYRALlktag..................SAD.RII.IAGDSAGGGLTTASMLKA-
d3kxpb_ ..................................IAGLIRTL.......................ARG.HAI.LVGHSLGARNSVTAAAKY-
d3og9a_ ..................................LTDEVSLLaekhdl.................DVH.KMI.AIGYSNGANVALNMFLRG-
d3qpda_ ..................................AQGLFEQAvskc...................PDT.QIV.AGGYSQGTAVMNGAIKRLS
d3qvmb_ ..................................VEEILVAL.......................DLV.NVS.IIGHSVSSIIAGIASTHV-
d3qyjb_ ..................................QVEVMSKL.......................GYE.QFY.VVGHDRGARVAHRLALDH-
d3stvb_ ..................................LMEFMASLp......................ANE.KII.LVGHALGGLAISKAMETF-
d3u0va_ ..................................LTDLIDEEvksgi..................KKN.RIL.IGGFSMGGCMAMHLAYRN-
d3vvma_ ..................................AAHTVRAL.......................GIS.RLAcVVGASMGGMSALALLARH-
d3wibb_ ..................................VDAWFDAL.......................DLR.NVT.LVLQDWGAAFGLNWASRN-
d3wj2a_ ..................................AYDSFHYIakkkkdf................GIEgRIG.VAGDSAGANLAAALCLKCR
d4dnqa_ ..................................LLHILDAL.......................GID.CCA.YVGHAVSAMIGILASIRR-
d4ehba_ ..................................LHKLARQFs......................PDR.PFD.LVAHSIGIWNTYPMVVKN-
d4ffwa2 ..................................IEAARQFLkmgfv..................DSK.RVA.IWGWSYGGYVTSMVLGSG-
d4hs9a_ ..................................VQTILQET.......................QTK.KVN.FIGHSQGPLACRYVAANY-
d4i3fa1 ..................................QIDLLDAK.......................GIE.QTH.IVGNSMGGGVTLHLLNRH-
d4j7ab_ ..................................VASNREAL.......................GIS.TLI.MSGESGGGNLSLATTMLAK
d4jeia_ ..................................LDSVIEQY.......................PDY.QIA.VTGHSLGGAAALLFGINLK
d4kafa1 ..................................MDAFIEAL.......................GLE.EVV.LVIHDWGSALGFHWAKRN-
d4ke6e_ ..................................VEEGYGWLkq.....................RCQ.TIF.VTGLSMGGTLTLYLAEHH-
d4l3wa_ ..................................YFPVVQDQltay...................PDY.KVI.VTGHSLGGAQALLAGMDL-
d4lipd_ ..................................VKTVLAAT.......................GAT.KVN.LVGHSQGGLTSRYVAAVA-
d4lyea_ ..................................LISFIKAL.......................GLS.KIC.LIGNAMGGTTACGAALKA-
d4mwsa_ ..................................FFRLFPEY.......................KNN.KLF.LTGESYAGIYIPTLAVLVM
d4nmwa_ ..................................VAKNA---.......................-PD.QAI.WLGWSLGGLVASQMALTH-
d4nzzb_ ..................................IRQVIEGL.......................GYS.SCT.LVVHDWGAGIGWTFAYRY-
d4pw0a_ ..................................ALEFITAL.......................GIR.YFD.VLGFSLGGFIVQYMAHIQ-
d4q34a_ ..................................YAALFDKI.......................GPG.--V.FITHSQGGPVGWNTLLKT-
d4rncb_ ..................................VAAVLAAE.......................GVTeNAI.LLGWSYGGLVICDYLAAHG
d4uhca1 ..................................LAGLCNHL.......................GLTgKIV.LGGLSMGGYVAFAFARKY-
d4updb_ ..................................LEWVADNIasfgg..................DPS.KVT.IWGESAGSISVFDQMALYG
d4wy8a1 ..................................VVWVAKEEnaksinv................DPT.KLV.VAGDSAGGNLSAVVCIRA-
d4x00b_ ..................................LAAIIEST.......................HAR.KPV.LVGWSLGGAVISNYLAAY-
d4xvcb1 ..................................TVAAYRWLlahgy..................DPS.RIA.LGGDSAGGGLVVAALVALR
d4zv9e1 ..................................FFAAIEFMqrypq..................ATG.KVG.ITGFCYGGGVSNAAAVAY-
d4zwna1 ..................................LEHFVEKNlsecka.................KGI.PLF.MWGHSMGGGICLNYACQGK
d5a62a_ ..................................LRRLLEHL.......................NIG.KCT.IIGHSIGGIISSMYAAQH-
d5ah0a1 ..................................-------KghsrygrtypglypewgnlttegKVN.KIH.LVAHSMGGQTVRTLVQLL-
d5dwda_ ..................................AHPVLDAFladlwaqtgl.............GPA.DTI.LVGFSQGAMMALYTGLRL-
d5egna_ ..................................VVAVLDAL.......................KVD.RAV.FVGNSIGGMIAMQLNLDH-
d5frda1 ..................................ASESLKKT.......................V-G.KAV.VVGHSLGGAVAQKLYLRN-
d5fv4a_ ..................................LHWVQENIanfgg..................DPG.SVT.IFGESAGGESVSVLVLSPL
d5h3ha_ ..................................INEVIQQL.......................KLT.NVT.LLGFSMGGGIALKYLLNH-
d5hk8a_ ..................................LFSLLSDLp......................PHH.KVI.LVGHSIGGGSVTEALCKF-
d5jkja_ ..................................QKALLESL.......................GIS.KLYaVIGPSMGSMQAIDWASAY-
d5mifa_ ..................................VQWLLEHGeklgv..................DPT.NMG.FGGDSAGGELSSSVSLLSI
d5n4fa1 ..................................AQFLVKNKya.....................APG.KVA.INGASNGGLLVMGSIVRA-
d5syna_ ..................................IKALIEHEmkngi..................PAN.RIV.LGGFSQGGALSLYTALTC-
d5uroa1 ..................................IAELARSFvg.....................QDG.QIV.LGGHDWGGAVVWRTAYYH-
d5w15a1 ..................................FGALLDEW.......................KIS.RPR.VLAHDYGGATVLRAHFLD-
d5w1ua_ ..................................IRWVLENIaafgg..................DPK.RVT.LVGHSAGAASVQYHLISDA
d5w8oa_ ..................................DLAALNAM.......................GIH.QVAaVVGGSMGGARALEWVIGH-
d5yhpa_ ..................................IEKIREFL.......................QVGaAWH.VFGGSWGSTLALAYAQAH-
d6emia_ ..................................VQDNIAAFgg.....................DPN.RVT.LFGESAGAASVSLHLLSPG

d1a88a_ ....PGR......................VAKAVLVSAVP....................................................
d1a8qa_ ....TGR......................LRSAVLLSAIP....................................................
d1ac5a_ ....-NHnkfskidgdtyd..........LKALLIGNGWI....................................................
d1auoa_ ....QGP......................LGGVIALSTYA....................................................
d1b6ga_ ....PSR......................FKRLIIMNACL....................................................
d1brta_ ....TAR......................IAKVAFLASLEp...................................................
d1bu8a2 ....EGH......................VGRITGLDPAE....................................................
d1c4xa_ ....PER......................FDKVALMGSVG....................................................
d1cexa_ .saiRDK......................IAGTVLFGYT-....................................................
d1cv2a_ ....RER......................VQGIAYMEAIA....................................................
d1dina_ ....---......................VDRAVGYYGVG....................................................
d1dwoa_ ....VDK......................IAAGVFHNSLLpdtvhspsytvekllesfpdwrdtey..........................
d1dx4a_ ....---......................----------M....................................................
d1ehya_ ....SDR......................VIKAAIFDPIQpdfg................................................
d1ei9a_ ....PSPp.....................MVNLISVGGQH....................................................
d1ek1a2 ....PER......................VRAVASLNTPF....................................................
d1evqa_ ....KERggpa..................LAFQLLIYPST....................................................
d1ex9a_ ....PDL......................IASATSVGAPH....................................................
d1f0na_ ....PQQ......................FIYAGSLSALLdpsqgmgpsliglamgdag.................................
d1fj2a_ ....QQK......................LAGVTALSCWL....................................................
d1gkla_ ....LDY......................VAYFMPLSGDY....................................................
d1i6wa_ ...gGNK......................VANVVTLGGANrlttgkalpgt.........................................
d1imja_ ....GSQ......................LPGFVPVAPIC....................................................
d1iupa_ ....SER......................VDRMVLMGAAG....................................................
d1ivya_ ..qdPSMn.....................LQGLAVGNGLSsyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlq
d1j1ia_ ....SEL......................VNALVLMGSAG....................................................
d1jfra_ ....TS-......................LKAAIPLTGW-....................................................
d1ji3a_ ngsqEEReyakahnvslsplfegghhf..VLSVTTIATPHdgttlvnmvdftdr......................................
d1jjfa_ ....LDK......................FAYIGPISAAP....................................................
d1jkma_ ...rRGR......................LDAIDGVYASI....................................................
d1jmkc_ ..gqGRI......................VQRIIMVDSYKkqgvsdldgrtv........................................
d1ju3a2 ....---......................VGGLKAIAPSMasadlyrapwygp.......................................
d1k4ya_ ...tKNL......................FHRAISESGVA....................................................
d1k8qa_ ....PKLakr...................IKTFYALAPVAtv..................................................
d1l7aa_ ....SDI......................PKAAVADYPYL....................................................
d1lgya_ ....---......................-----------....................................................
d1lnsa3 ..egLEL......................ILAEAGIS---....................................................
d1lzla_ ....---......................DEGVVPVAFQF....................................................
d1m33a_ ....PER......................VRALVTVASSP....................................................
d1mnaa_ .rahGAP......................PAGIVLVDPYP....................................................
d1mpxa2 ....HPA......................LKVAVPESPMI....................................................
d1mtza_ ....QDH......................LKGLIVSGGLSsvpltvkem...........................................
d1n1ma2 ....SGV......................FKCGIAVAPVS....................................................
d1p0ia_ ...sHSL......................FTRAILQSGSF....................................................
d1pjaa_ ....DDHn.....................VDSFISLSSPQ....................................................
d1pv1a_ ...sGKR......................YKSCSAFAPIV....................................................
d1q0ra_ ....HDR......................LSSLTMLLGGGldidfdaniervmrg.....................................
d1qe3a_ ...aKGL......................FQKAIMESGASrtmtkeqaastaaaflqvl.................................
d1qfma2 ....PDL......................FGCVIAQVGVM....................................................
d1qlwa_ ....PKG......................ITAIVSVEPGE....................................................
d1qo7a_ ....DA-......................CKAVHLNLCAMrappegpsieslsaaekegiarmekf..........................
d1qoza_ ....---......................-----------....................................................
d1qtra_ ....PER......................VSEMVLRGIFT....................................................
d1r1da_ ....P--......................IEGIVTMCAPM....................................................
d1r3da_ ....---......................FSRLNLRGAII....................................................
d1tcaa_ ....PSIrsk...................VDRLMAFAPDYkgtvlag.............................................
d1thga_ ...gD-Ntyngkkl...............FHSAILQSGGPlpyhdsssvgpdisynr...................................
d1thta_ ....---......................LSFLITAVGVV....................................................
d1tiba_ ....---......................-----------....................................................
d1ufoa_ ...rPRG......................VLAFIGSGFPM....................................................
d1ukca_ ....GGKdegl..................FIGAIVESSFWptqrtvsemefqferfvndt................................
d1uwca_ ....-AT......................-----------....................................................
d1uxoa_ ...lRAA......................LGGIILVSGFA....................................................
d1vkha_ ....-DPqekmseaqlqmlgllqi.....VKRVFLLDGIY....................................................
d1wht.1 ....-RSknpvin................LKGFMVGNGLI....................................................
d1wpxa1 ..shKDRnfn...................LTSVLIGNGLTdpltqynyyepmacgeggepsvlpseecsamedslerclgliescydsq...
d1xfda2 ....GEN......................QGQTFTCGSAL....................................................
d1xkta_ aqqsP-Apt....................HNSLFLFDGSPtyvlaytqsyrak.......................................
d1zoib_ ....PEDk.....................VAKAVLIAAVP....................................................
d2b20a2 ....PER......................FGCVLSQSGSY....................................................
d2b61a1 ....PDF......................MDNIVNLCSSIyfsaeaigfnhvmrqavindpnfngg..........................
d2bcea_ ...nKGL......................IKRAISQSGVG....................................................
d2cbga_ ....EQKgle...................VSDFIIVDAYK....................................................
d2d81a1 ....SDVfn....................VGFGVFAGGPY....................................................
d2dsta1 ....---......................-----------....................................................
d2fuka1 ....---......................PQVLISIAPPA....................................................
d2gzsa1 ....SSY......................FRSYYSASPSL....................................................
d2h1ia1 ....ENA......................LKGAVLHHPMV....................................................
d2hu7a2 ....PGL......................FKAGVAGASVV....................................................
d2i3da1 ....PE-......................IEGFMSIAPQP....................................................
d2jbwa1 ....PR-......................LAACISWGGFS....................................................
d2ocka_ ....PSY......................IHKMVIWGANA....................................................
d2ogsa_ ...aSGL......................FRRAMLQSGSGslllrs..............................................
d2pbla1 ...lPEAvgar..................IRNVVPISPLS....................................................
d2psja_ ....QDR......................IKAIVHMESVVdvieswdewpdieedial..................................
d2r8ba1 ....PEL......................FDAAVLMHPLI....................................................
d2rhwa1 ....PDR......................IGKLILMGPGG....................................................
d2vata1 ....PEY......................VRKIVPIATSCrqsgwcaawfetqrqciyddpkyldgeydvddqpvrgletarkianl.....
d2vf2a_ ....PAR......................AGRLVLMGPGG....................................................
d2xmza_ ....HIP......................ISNLILESTSP....................................................
d2xt0a_ ....PQL......................VDRLIVMNTAL....................................................
d2xuah_ ....ADR......................IERVALCNTAA....................................................
d3ainb_ ....-KEnik...................LKYQVLIYPAV....................................................
d3b5ea1 ....PGI......................VRLAALLRPMP....................................................
d3bdia1 ....PDI......................VDGIIAVAPAW....................................................
d3be8b1 ...sEGL......................FQKAIIQSGTAlsswavnyqpakyt......................................
d3cn7c_ ....AQP......................LGGVLALSTYA....................................................
d3d2ci_ ...gGNK......................VANVVTLGGAN....................................................
d3dlta_ ....PGI......................TAGGVFSSPIL....................................................
d3fcyc_ ....PR-......................VRKVVSEYPFL....................................................
d3foba_ ....TDR......................IEKVVFAGAVP....................................................
d3g7nb_ .qnfPDK......................-----------....................................................
d3grob_ ....PSPp.....................MINLISVGGQH....................................................
d3hzoa1 ....PEL......................VSSAVLMATRG....................................................
d3i1ia_ ....PHM......................VERMIGVITNPqnpiitsvnvaqnaieairldpswkg..........................
d3k6ka_ ....KEDglpm..................PAGLVMLSPFV....................................................
d3kxpb_ ....PDL......................VRSVVAIDFTP....................................................
d3og9a_ ....KIN......................FDKIIAFHGMQ....................................................
d3qpda_ .advQDK......................IKGVVLFGYTR....................................................
d3qvmb_ ....GDR......................ISDITMICPSP....................................................
d3qyjb_ ....PHR......................VKKLALLDIAPthkmyrtt............................................
d3stvb_ ....PEK......................ISVAVFLSGLMpgpnidattvctkagsavlgqldncvtye.......................
d3u0va_ ....HQD......................VAGVFALSSFL....................................................
d3vvma_ ....PEL......................ARTHISLSGAVhalpfsiavrslqreairsdpgwlqg..........................
d3wibb_ ....PDR......................VRAVAFFEPVL....................................................
d3wj2a_ .dgkTEM......................PAVQVLFYPSLapdnf...............................................
d4dnqa_ ....PEL......................FSKLILIGASP....................................................
d4ehba_ ....QAD......................IARLVYMEAPIpdariyrfpa..........................................
d4ffwa2 ....SGV......................FKCGIAVAPVS....................................................
d4hs9a_ ....PDS......................VASVTSINGVN....................................................
d4i3fa1 ....PER......................FKKAVLMGPVG....................................................
d4j7ab_ ....-KEgwlee.................IAGVYAQCPYI....................................................
d4jeia_ ....---......................-----------....................................................
d4kafa1 ....PER......................IKGIAFMEFIR....................................................
d4ke6e_ ....PD-......................ICGIVPINAAVd...................................................
d4l3wa_ ....YQR......................-----------....................................................
d4lipd_ ....PDL......................VASVTTIGTPH....................................................
d4lyea_ ....PEL......................IDRLVLMGAAV....................................................
d4mwsa_ ..qdPSMn.....................LQGLAVGNGLSsyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlq
d4nmwa_ ....PER......................VQALVTVASSP....................................................
d4nzzb_ ....PEY......................VQKLIAFNGPH....................................................
d4pw0a_ ....PDM......................IRKIIIVGAAP....................................................
d4q34a_ ....RN-......................IKAIASYEPGG....................................................
d4rncb_ ....TGA......................VAGAVLVGAIT....................................................
d4uhca1 ....RDR......................LAGLILCDTRA....................................................
d4updb_ ...gNNKykgkal................FRGGIMNSGSV....................................................
d4wy8a1 ....KQLglni..................IKGQVLIYPVT....................................................
d4x00b_ ....GDKg.....................IAGAVYVDGVI....................................................
d4xvcb1 .yigEPL......................PAAGVCLSPWI....................................................
d4zv9e1 ....PE-......................LACAVPFYGRQ....................................................
d4zwna1 ...hKNE......................ISGYIGSGPLI....................................................
d5a62a_ ....PGK......................VDAIIMINGSP....................................................
d5ah0a1 ....KEGseeernttpsqlsslfaggkswVHSITTIASPH....................................................
d5dwda_ ....PEP......................LKAIIAFSGLI....................................................
d5egna_ ....PQRv.....................IGNLILSSGTG....................................................
d5frda1 ....PEI......................CLALVLVGTGA....................................................
d5fv4a_ ...aKNL......................FHRAISESGVA....................................................
d5h3ha_ ....GESn.....................VSKLILAGAAA....................................................
d5hk8a_ ....TDK......................ISMAIYLAASMvqpgsi..............................................
d5jkja_ ....PGW......................VERMISVIGAGqsdawttaalehwatpitldknwnngayskeqa...................
d5mifa_ ....-KRktpl..................PKFQVLIYPATdlace...............................................
d5n4fa1 ....PEGt.....................FGAAVPEGGVA....................................................
d5syna_ ....PHP......................LAGIVALSCWL....................................................
d5uroa1 ....PEL......................VKAVFSVCTPLhplsaeykpledivaaghmlnfkyqlqlkg......................
d5w15a1 ....GIA......................YSDLTLVNPVA....................................................
d5w1ua_ ...sKDL......................FQRAIVMSGSTynswsltrqrnwve......................................
d5w8oa_ ....PET......................VRAGLILAVGAratadqigtqstqvaaikadpnwqngd.........................
d5yhpa_ ....PAR......................VKSLTLRGIFTlrkkeldffyqgpgssfvfpe...............................
d6emia_ ....-SHpl....................FTRAILQSGSAnapw................................................

                                               130       140       150       160           170      
                                                 |         |         |         |             |      
d1a8qa_ ....................................PVMIKSDKNPDGVPDEVFDALKNGVLTERSQFWKD----Taeg.FFSANRPGNKVT
d1ac5a_ ....................................----------------------------------------....------------
d1auoa_ ....................................PTFGD-----------------------------------....------------
d1bu8a2 ....................................PCFQGLPEEVRLDPSDAMFVDVI-----------------....------------
d1c4xa_ ....................................--------APMNARPPELARLLAFYADPRLTPYRELIHSFvy..DPENFPGMEEIV
d1cexa_ ....................................----------------------------------------....------------
d1cv2a_ ....................................---MPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQ....VLPGLILRPLSE
d1dina_ ....................................--------------------------------LE------....------------
d1dwoa_ ....................................F---------------TFTNITGET---------------....------------
d1dx4a_ ....................................----------------------------------------....------------
d1ek1a2 ....................................--MPPDPDVSPMKVIRSIPVFNYQLYFQEPGVAEAELEKN....MSRTFKSFFRAS
d1evqa_ ....................................------------------GYDPAHPPASIEENAEGYLLTGgm..MLWFRDQYLNSL
d1ex9a_ ....................................KGSDTADFLR------------------------------....------------
d1f0na_ ....................................G---------------------------------------....------------
d1fj2a_ ....................................PLRASFPQGPIGGANR------------------------....------------
d1gkla_ ....................................--------WYGNSPQDKANSIAEAINRSGLSKREYFVFAA....TGSEDIAYANMN
d1i6wa_ ....................................D---------------PNQ---------------------....------------
d1imja_ ....................................----------------------------------------....--TDK-------
d1iupa_ ....................................------------TRFDVTEGLNAVWGYTPSIENMRNLLDIf...AYDRSLVTDELA
d1ivya_ evarivgnsglniynlyapcaggvpshfryekdtvvV---------------------------------------....------------
d1j1ia_ ....................................-----------LVVEIHEDLRPIINYDFTREGMVHLVKAL....TNDGFKIDDAMI
d1jfra_ ....................................----------------------------------------....------------
d1ji3a_ ....................................F---------------------------------------....------------
d1jjfa_ ....................................NTYPNERLFP-------------DGGKAARE---------....------------
d1jkma_ ....................................PYISGGYAWDHERRLTELPSLVENDGYFIENGGMALLVRA....YDP---------
d1jmkc_ ....................................E----------------------------------SDVEA....LMNVNRDNEALN
d1k4ya_ ....................................----------------------------------------....------------
d1l7aa_ ....................................----------------------------------------....SNFERAIDVALE
d1lgya_ ....................................----------------------------------------....------------
d1lnsa3 ....................................-----------SWYNYYRENGLVRSPGGFPGEDLDVLAALt...YSRNLDGADFLK
d1lzla_ ....................................-------LEIPELDDRLETVSMTNFVDTPLWHRPNAILSW....KYYLGESYSGPE
d1m33a_ ....................................--CFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQ....TMGTETARQDAR
d1mnaa_ ....................................PGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARF....------------
d1n1ma2 ....................................--------------------------------RWEYYDSV....YTERYMGLPTPE
d1p0ia_ ....................................----NAPW--------------------------------....------------
d1pv1a_ ....................................--NPSNVPWGQKAFKGYLGEEKAQWEAYDPC---------....------------
d1qe3a_ ....................................G---------------------------------------....------------
d1qfma2 ....................................------DMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYS....------------
d1qlwa_ ....................................----------------------------------------....------------
d1qoza_ ....................................----------------------------------------....------------
d1r1da_ ....................................---------------------YIKSEETMYEGVLE-----....YAREYKKREGKS
d1r3da_ ....................................------EGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEH....VLSDWYQQAVFS
d1tcaa_ ....................................P---------------------------------------....------------
d1thga_ ....................................F---------------------------------------....------------
d1thta_ ....................................------------NLRDTLEKALGFDYLSLPIDELPNDLDF....EGHKLGSEVFVR
d1tiba_ ....................................----------------------------------------....------------
d1ufoa_ ....................................--------KLPQGQVVEDPGVLALYQAPPATRGEAYG---....------------
d1ukca_ ....................................G---------------------------------------....------------
d1uwca_ ....................................----------------------------------------....------------
d1uxoa_ ....................................---------KSLPTLQMLDEFTQGSFDHQKIIES------....------------
d1vkha_ ....................................-------------------------------SLKELLIEY....PEYDCFTRLAFP
d1wht.1 ....................................------DDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDs...FIHPSPACDA--
d1wpxa1 ....................................S---------------------------------------....------------
d1xfda2 ....................................------------------------SPITDFKLYASAFSER....YLGLHGLDNRAY
d1xkta_ ....................................L---------------------------------------....------------
d2b20a2 ....................................-------WWPHRGGQQEG----------------------....------------
d2bcea_ ....................................----LCPWAIQQDPLFWAKRIAEK----------------....------------
d2cbga_ ....................................----------------------------------------....------------
d2d81a1 ....................................----------------------------------------....--D-------CA
d2dsta1 ....................................----------------------------------------....------------
d2fuka1 ....................................G---------------------------------------....------------
d2gzsa1 ....................................----------------------------------------....------------
d2h1ia1 ....................................PRRG------------------------------------....------------
d2hu7a2 ....................................---------DWEEMYELSDAAFRNFIEQLTGGSREIMRSR....------------
d2i3da1 ....................................----------------------------------------....------------
d2jbwa1 ....................................-----DLDYWDLETPLTKESWKYVSKVDTLEEARLHVHAA....L-----------
d2ocka_ ....................................------------------------YVTDEDSMIYEGIRDV....SKWSERTRKPLE
d2ogsa_ ....................................PETAMAMTERILDKAGIRPGDRERLLSIPAEELLRAA---....------------
d2pbla1 ....................................-------DLRPLLRTSMNEKFKMDADAAIAE---------....------------
d2psja_ ....................................I----------------------KSEEGEKMVLENNFFVEt...VLPSKIMRKLEP
d2r8ba1 ....................................----------------------------------------....------------
d2rhwa1 ....................................----LGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVF....LYDQSLITEELL
d2vf2a_ ....................................----LSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMv...YDKNLITPELVD
d2xmza_ ....................................GIKEEANQLERRLVDDARAKVLDIAGIELFVNDWEKL---....--PLFQSQLELP
d2xuah_ ....................................-RIGSPEVWVPRAVKARTEGMHALADAVLPRWFTADYMER....-----------E
d3ainb_ ....................................------------------------SFDLITKSLYDNGEGF....FLTREHIDWFGQ
d3b5ea1 ....................................----------------------------------------....--VL--------
d3bdia1 ....................................----------------------------------------....------------
d3be8b1 ....................................R---------------------------------------....------------
d3cn7c_ ....................................----------------------------------------....--PTFDDLALDE
d3d2ci_ ....................................RLTTDKAPPG------------------------------....------------
d3dlta_ ....................................-------PGKHHLVPGFLKYAEYMNRLAGKSDESTQILAY....LPGQLAAIDQFA
d3fcyc_ ....................................--------------SDYKRVWDLDLAKNAYQEITDYFRLF....DPRHERENEVFT
d3g7nb_ ....................................----------------------------------------....------------
d3hzoa1 ....................................----RLDRARQFFNKAEAELYDSGVQLPPTYDARARLLEN....FSRKTLNDDVAV
d3i1ia_ ....................................G---------KYGEEQPMKGLQLAN---------------....--RMMFMNAFDE
d3kxpb_ ....................................-------YIETEALDALEARVNAGSQLFEDIKAVEAYLAG....RYPNIPADAIRI
d3og9a_ ....................................----------------------------------------....--LE--------
d3qpda_ ....................................----------------------------------------....------------
d3qvmb_ ....................................--------CFMNFPPDYVGGFERDDLEELINLMDKNYIGWan..YLAPLVMGASHS
d3u0va_ ....................................NK------------ASAVY---------------------....------------
d3wibb_ ....................................-----RNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFlte.LFPWFFLTPLAP
d3wj2a_ ....................................SRSFIEYSDNYVLTGKMIRYFGNMYSKNMQDLINPYFSPL....------------
d4dnqa_ ....................................-RFLNDEDYHGGFEQGEIEKVFSAMEANYEAWVNGFA---....--PLAVGADVPA
d4ehba_ ....................................FTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKS....--HASNTEVFSE
d4ffwa2 ....................................--------------------------------RWEYYDSV....YTERYMGLPTPE
d4hs9a_ ....................................HGSEIADLYRRIIRKDSIPE--------------------....------------
d4i3fa1 ....................................---------APFAPTEGLTKGWEFYKDPSKEALEYLITKF....LFDPSLLGNDIA
d4j7ab_ ....................................------SGLYASKPEELPSLLENDAYFLDMKTMGAMVKPY....------------
d4jeia_ ....................................----------------------------------------....------------
d4kafa1 ....................................---PIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEg...TLPMGVVRPLTE
d4ke6e_ ....................................IPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELA------....------------
d4l3wa_ ....................................----------------------------------------....------------
d4lipd_ ....................................---------RGSEFADFVQGVLAYDPTGLSSTVIAAFVNV....FGILTSSSNNTN
d4lyea_ ....................................-------NISPDDMVANRDDLAAVMSYDGSEEGMRKIIAA....LTHSYQPTDDIV
d4mwsa_ ...........evarivgnsglniynlyapcaggvpS---------------------------------------....------------
d4nmwa_ ....................................--CFSAREGWPGIKPEILGGFQQQLSDDFQRTVERFLALQ....--TLGTETARQD
d4pw0a_ ....................................-----QGVKVLHTFPDLIARAMQLEPKERFLFIFFEQSEH....SRSKGLATLGRL
d4q34a_ ....................................AVPFPEGQLPEEAKFITLSKKMEGIEVPMSVFMEYT----....------------
d4rncb_ ....................................------SIGRGEKGGKVGSAMRSAVPGAMSEDPREAIRALga..FGNALTGPPEGK
d4uhca1 ....................................---RPDSPEAKENRRRVAERVRREGPGFIAEEMIPR----....--LCCESTFRNH
d4updb_ ....................................----------------------------------------....------------
d4wy8a1 ....................................------DDNFETDSYKQFAENYYLTRKLMVWFFDHYIPDK....KDRQSIFACPLK
d4xvcb1 ....................................DMEATGESFTTNATMDP-----------------------....----SVNKERVM
d4zv9e1 ....................................----------------------------------------....------------
d4zwna1 ....................................------ILHPHTMYNKPTQIIAPLLAKFSPRVRIDTG---....---LDLKGITSD
d5a62a_ ....................................------KKFQEKDLEKHFRTREVAITQGMKALAEHKLVS-....--LDEARDLFAD
d5ah0a1 ....................................DGTTLADGINIFGDFAKNLVASLASFTGAGEKL-------....------------
d5dwda_ ....................................---------------------------VAPEKLEAEIAS-....------------
d5egna_ ....................................LGEGMPPEAGAAFQNDYIGAFGGLLEGAVSARSKRE----....-------RPEIL
d5frda1 ....................................-------------RLRVLPEILEGLKKEPEKAVDLMLSMA....FASKGEEYEKKR
d5fv4a_ ....................................----------------------------------------....------------
d5h3ha_ ....................................PVFTQRDGYPYGMTKDEVDALIEDTKQDRPSMLKGF----....--GEIFFAKEHP
d5jkja_ ....................................PLNGLAASLMLITQNALTPSFFNQTGNTLGYKNVESA---....PLNDIRQSHSIV
d5mifa_ ....................................S---------------------------------------....------------
d5n4fa1 ....................................------DLLKFHKFTGGQAWISEYGNPSIPEEFDYIYPLS....PVHNVRTDKVMP
d5syna_ ....................................PLHRAFPQA-------------------------------....------------
d5w15a1 ....................................-------IAPQGSPFVRHVAQHEAAFTGLPAYAHHALVSA....YIGQAVAQPLSD
d5w1ua_ ....................................K---------------------------------------....------------
d5yhpa_ ....................................YWE-------------------EYLDPIPVAERGDMVKAY....YERLTGSDEKVR
d6emia_ ....................................A---------------------------------------....------------

                                                                                180       190       
                                                                                  |         |       
d1a88a_ QGL.......................................................................IDHWWLQGMMG.AAN..A
d1a8qa_ QGN.......................................................................KDAFWYMAMAQ.TIE..G
d1ac5a_ ---.......................................................................-----------.---..-
d1auoa_ ---.......................................................................-----------.---..-
d1b6ga_ SAY.......................................................................AAPFPDTSYQA.GVR..K
d1brta_ EEA.......................................................................VRNSWNTAASG.GFF..A
d1bu8a2 ---.......................................................................-----------.---..-
d1c4xa_ KSR.......................................................................FEVANDPEVRR.IQE..V
d1cexa_ ---.......................................................................-----------.---..-
d1cv2a_ AEM.......................................................................AAYREPFLAAGeARR..P
d1dina_ ---.......................................................................-----------.---..-
d1dwoa_ --Ittmklgfvllrenlftkctdgeyelakmvmrkgslf...................................Q----------.---..-
d1dx4a_ ---.......................................................................-----------.---..-
d1ehya_ EEL.......................................................................EVHVDNCMKPD.NIH..G
d1ei9a_ RNH.......................................................................SIFLADINQER.GVNe.S
d1ek1a2 DETgfiavhkateiggilvntpedpnlskitteee.......................................IEFYIQQFKKT.GFR..G
d1evqa_ EEL.......................................................................THPWFSPVLYP.DLS..G
d1ex9a_ ---.......................................................................-----------.---..-
d1f0na_ ---.......................................................................-----------.---..-
d1fj2a_ ---.......................................................................-----------.---..-
d1gkla_ PQI.......................................................................EAM--------.---..-
d1i6wa_ ---.......................................................................-----------.---..-
d1imja_ ---.......................................................................-----------.---..-
d1iupa_ RLR.......................................................................YEASIQPGFQE.SFS..S
d1ivya_ --QdlgniftrlplkrmwhqallrsgdkvrmdppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyR----------.---..-
d1j1ia_ NSR.......................................................................YTYATDEATRK.AYV..A
d1jfra_ ---.......................................................................-----------.---..-
d1ji3a_ ---.......................................................................-----------.---..-
d1jjfa_ ---.......................................................................-----------.---..-
d1jkma_ ---.......................................................................-----------.---..-
d1jmkc_ SEA.......................................................................VKHGLKQKTHA.F--..-
d1ju3a2 PLA.......................................................................EQPLLGRLIPW.VID..Q
d1k4ya_ ---.......................................................................-----------.---..-
d1k8qa_ NALfiicgfdtmnlnmsrldvylshnpagtsvqnvlhws...................................QAVKSGKFQAF.DWG..S
d1l7aa_ QPY.......................................................................LEINSFFRRNG.SPE..T
d1lgya_ ---.......................................................................-----------.---..-
d1lnsa3 GNA.......................................................................EYEKRLAEMTA.ALD..R
d1lzla_ DPD.......................................................................VSIYAAPSRAT.DLT..G
d1m33a_ ALK.......................................................................KTVLALPMPEV.DVLn.G
d1mnaa_ ---.......................................................................-----------.---..-
d1mpxa2 GDFak.....................................................................AAGLEQLPWWH.KLT..E
d1mtza_ SLE.......................................................................YAERRNVYRIM.NGP..N
d1n1ma2 DNL.......................................................................D----------.---..-
d1p0ia_ ---.......................................................................-----------.---..-
d1pjaa_ SSF.......................................................................LALINGERDHP.NAT..V
d1pv1a_ ---.......................................................................-----------.---..-
d1q0ra_ ARW.......................................................................EERAIDHAGGV.LAE..P
d1qe3a_ ---.......................................................................-----------.---..-
d1qfma2 ---.......................................................................-----------.---..-
d1qlwa_ ---.......................................................................-----------.---..-
d1qo7a_ EMV.......................................................................SLYWLTESFPR.AIH..T
d1qoza_ ---.......................................................................-----------.---..-
d1qtra_ QLEaaklwsvwegetvtllpsresasfg..............................................EDDFALAFARI.ENH..Y
d1r1da_ EEQ.......................................................................IEQEMERFKQT.PMK..T
d1r3da_ SLN.......................................................................HEQRQTLIAQR.SAN..L
d1tcaa_ ---.......................................................................-----------.---..-
d1thga_ ---.......................................................................-----------.---..-
d1thta_ DCF.......................................................................EHHWDTLD---.---..-
d1tiba_ ---.......................................................................-----------.---..-
d1ufoa_ ---.......................................................................-----------.---..-
d1ukca_ ---.......................................................................-----------.---..-
d1uwca_ ---.......................................................................-----------.---..-
d1uxoa_ ---.......................................................................-----------.---..-
d1vkha_ DGI.......................................................................QMYEEEPSRVM.P--..-
d1wht.1 --Atdvataeqgnidmyslytpvcnixsydpcterystayynrrdvqmalhanvtgamnyt.............W----------.---..-
d1wpxa1 --Vwscvpatiycnnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgae..........VDHYESC----.NFD..I
d1xfda2 EMT.......................................................................-----------.---..-
d1xkta_ ---.......................................................................-----------.---..-
d1zoib_ EGI.......................................................................IGNWWRQGMIG.SAK..A
d2b20a2 ---.......................................................................-----------.---..-
d2b61a1 SYL.......................................................................SYQGKKFLERF.DAN..S
d2bcea_ ---.......................................................................-----------.---..-
d2cbga_ ---.......................................................................-----------.---..-
d2d81a1 RNQ.......................................................................YYTSCMYNGYP.SIT..T
d2dsta1 ---.......................................................................-----------.---..-
d2fuka1 ---.......................................................................-----------.---..-
d2gzsa1 ---.......................................................................-----------.---..-
d2h1ia1 ---.......................................................................-----------.---..-
d2hu7a2 ---.......................................................................-----------.---..-
d2i3da1 ---.......................................................................-----------.---..-
d2jbwa1 ---.......................................................................-----------.---..-
d2ocka_ ALY.......................................................................GYDYFARTCEK.WVD..G
d2ogsa_ ---.......................................................................-----------.---..-
d2pbla1 ---.......................................................................-----------.---..-
d2psja_ EEF.......................................................................AAYLEPFKEKGeVRR..P
d2r8ba1 ---.......................................................................-----------.---..-
d2rhwa1 QGR.......................................................................WEAIQRQPEHL.KNF..L
d2vata1 SYL.......................................................................RYQAQKFAASF.DAN..C
d2vf2a_ QRF.......................................................................ALASTPESLTA.TRA..M
d2xmza_ VEI.......................................................................QHQIRQQRLSQ.SPH..K
d2xt0a_ AGV.......................................................................RRFPAIVPITP.DME..G
d2xuah_ PVV.......................................................................LAMIRDVFVHT.DKE..G
d3ainb_ QYL.......................................................................RSFADLLDFRF.S--..-
d3b5ea1 ---.......................................................................-----------.---..-
d3bdia1 ---.......................................................................-----------.---..-
d3be8b1 ---.......................................................................-----------.---..-
d3cn7c_ RHK.......................................................................-----------.---..-
d3d2ci_ ---.......................................................................-----------.---..-
d3dlta_ T--.......................................................................-----------.---..-
d3fcyc_ KLG.......................................................................YI---------.---..-
d3foba_ ESF.......................................................................RLYNWDIAAGA.SPK..G
d3g7nb_ ---.......................................................................-----------.---..-
d3grob_ RNH.......................................................................SIFLADINQER.GI-..-
d3hzoa1 GDW.......................................................................IAM-FSMWPIK.STP..G
d3i1ia_ HFYettyprnsievepyekvssltsfekeinkltyrsie...................................LVDANSWMYTA.KAV..L
d3k6ka_ PE-.......................................................................-----------.---..-
d3kxpb_ RAE.......................................................................SGYQPVDGGLR.PLA..S
d3og9a_ ---.......................................................................-----------.---..-
d3qpda_ ---.......................................................................-----------.---..-
d3qvmb_ SEL.......................................................................IGELSGSFCTT.DPI..V
d3qyjb_ EYI.......................................................................RCFSQPAVIHA.TCE..D
d3stvb_ SSK.......................................................................RYG--------.---..-
d3u0va_ ---.......................................................................-----------.---..-
d3vvma_ SYL.......................................................................DFHAQRFADRF.DPN..S
d3wibb_ EDL.......................................................................RQYQTPFPTPH.SRK..A
d3wj2a_ ---.......................................................................-----------.---..-
d4dnqa_ AVR.......................................................................EFSRTLFNMRP.DIT..L
d4ehba_ RLL.......................................................................DLYARSYAKPH.SLN..A
d4ffwa2 DNL.......................................................................D----------.---..-
d4hs9a_ ---.......................................................................-----------.---..-
d4i3fa1 SIA.......................................................................AQRFDNVMKDE.VRL..Q
d4j7ab_ ---.......................................................................-----------.---..-
d4jeia_ ---.......................................................................-----------.---..-
d4kafa1 VEM.......................................................................DHYREPFLNPV.DRE..P
d4ke6e_ ---.......................................................................-------YEKT.PTA..S
d4l3wa_ ---.......................................................................-----------.---..-
d4lipd_ Q--.......................................................................-----------.---..-
d4lyea_ HYR.......................................................................HEASLRPTTTA.AYK..A
d4mwsa_ --Hfrsgdkvrmdppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqy...................R----------.---..-
d4nmwa_ ART.......................................................................LKSVVLAQPMP.DVE..V
d4nzzb_ GYLtadd...................................................................VQAYMNSWENG.SVL..S
d4pw0a_ YER.......................................................................TTDRDQDASAQ.AIG..A
d4q34a_ ---.......................................................................-----------.---..-
d4rncb_ GAA.......................................................................SQALFGYSLST.RPR..V
d4uhca1 PEV.......................................................................IEKIRQMILSA.PPE..G
d4updb_ ---.......................................................................-----------.---..-
d4wy8a1 ASI.......................................................................DDLRV------.---..-
d4x00b_ AAL.......................................................................ASWDMQRAVRS.MTV..-
d4xvcb1 SIA.......................................................................ALYLGGKNPQA.PLA..S
d4zv9e1 ---.......................................................................-----------.---..-
d4zwna1 KAY.......................................................................RAFLGSDPMSV.PLY..G
d5a62a_ KRH.......................................................................ADFFREVFTKT.SVE..G
d5ah0a1 ---.......................................................................-----------.---..-
d5dwda_ ---.......................................................................-----------.---..-
d5egna_ AVM.......................................................................KAHFSVPSNFP.KHV..F
d5frda1 REF.......................................................................LDRVDVLHLDL.SLC..D
d5fv4a_ ---.......................................................................-----------.---..-
d5h3ha_ EPL.......................................................................QQWFHNLSVDA.SSH..G
d5hk8a_ SSK.......................................................................LLRPAPMRAFQ.DLD..-
d5jkja_ NWL.......................................................................RERAKTRAKSM.DAN..H
d5mifa_ ---.......................................................................-----------.---..-
d5n4fa1 ATL.......................................................................ITVNIGDGRVV.PMH..S
d5syna_ ---.......................................................................-----------.---..-
d5uroa1 QEL.......................................................................EYYVEQYALQE.APElrG
d5w15a1 DVL.......................................................................SIYRAPWLTPA.GQA..A
d5w1ua_ ---.......................................................................-----------.---..-
d5w8oa_ SYL.......................................................................EYQGRKLVDRF.DAG..T
d5yhpa_ AEAgrawsrwematsr..........................................................LHVDPDYISKA.DAP..G
d6emia_ ---.......................................................................-----------.---..-

           200                    210               220                  230                        
             |                      |                 |                    |                        
d1a88a_ HYECIAAFS.............ETDFTDDLKRI......DVP.VL.VAHGT...........DDQVVP........................
d1a8qa_ GVRCVDAFG.............YTDFTEDLKKF......DIP.TL.VVHGD...........DDQVVP........................
d1ac5a_ ---------.............-----------......---.--.-----...........------........................
d1auoa_ ---------.............--ELELSASQQ......RIP.AL.CLHGQ...........YDDVVQ........................
d1b6ga_ FPKMVAQRDqacidis......TEAISFWQNDW......NGQ.TF.MAIGM...........KDKLLG........................
d1brta_ AAAAPTTWY.............T-DFRADIPRI......DVP.AL.ILHGT...........GDRTLP........................
d1bu8a2 ---------.............-----------......---.--.-----...........------........................
d1c4xa_ MFESMKAGMes...........LVIPPATLGRL......PHD.VL.VFHGR...........QDRIVP........................
d1cexa_ ---------.............-----------......---.--.-----...........------........................
d1cv2a_ TLSWPRQIPiagtpadvvai..ARDYAGWLSES......PIP.KL.FINAE...........PGAL-T........................
d1dina_ ---------.............--KQLNKVPEV......KHP.AL.FHMGG...........QDHFVP........................
d1dwoa_ ---------.............--NVLAQRPKFtekgygSIK.KV.YIWTD...........QDKIFL........................
d1dx4a_ ---------.............-----------......---.--.-----...........------........................
d1ehya_ GFNYYRANIrp...........DAALWTDLDHTms....DLP.VT.MIWGL...........GDTCVP........................
d1ei9a_ YKKNLMALK.............-----------......--K.FV.MVKFL...........NDTIVD........................
d1ek1a2 PLNWYRNTErnw..........KWSCKGLGRKI......LVP.AL.MVTAE...........KDIVLR........................
d1evqa_ LPPAYIATA.............QYDPLRDVGKL......Y--.--.-----...........------........................
d1ex9a_ ---------.............-----------......---.--.-----...........------........................
d1f0na_ ---------.............-----------......---.--.-----...........------........................
d1fj2a_ ---------.............-----------......DIS.IL.QCHGD...........CDPLVP........................
d1gkla_ -----KALP.............H----------......---.--.-----...........------........................
d1i6wa_ ---------.............-----------......KIL.YT.SIYSS...........ADMI--........................
d1imja_ ---------.............--INAANYASV......KTP.AL.IVYGD...........QDPMGQ........................
d1iupa_ MFPEPRQRWida..........LASSDEDIKTL......PNE.TL.IIHGR...........EDQVVP........................
d1ivya_ --------Rlyrsm........NSQYLKLLSSQ......KYQ.IL.LYNGD...........VDMACNfmgdewfvdslnqkmevqrrpwlv
d1j1ia_ TMQWIREQGg............LFYDPEFIRKV......QVP.TL.VVQGK...........DDKVVP........................
d1jfra_ ---------.............--NTDKTWPEL......RTP.TL.VVGAD...........GDTVAP........................
d1ji3a_ ---------.............-----------......---.--.-----...........------........................
d1jjfa_ ---------.............-----------......KLK.LLfIACGT...........NDSLIG........................
d1jkma_ ---------.............-----------......---.--.-----...........------........................
d1jmkc_ ---------.............-----------......---.--.-----...........------........................
d1ju3a2 VVDHPDNDEswq..........SISLFERLGGL......ATP.AL.ITAGW...........YDGFVG........................
d1k4ya_ ---------.............-----------......---.--.-----...........------........................
d1k8qa_ PVQNMMHYHq............SMPPYYNLTDM......HVP.IA.VWNGG...........NDLLAD........................
d1l7aa_ EVQAMKTLS.............YFDIMNLADRV......KVP.VL.MSIGL...........IDKVTP........................
d1lgya_ ---------.............-----------......---.--.-----...........------........................
d1lnsa3 KSGDYNQFWh............DRNYLINTDKV......KAD.VL.IVHGL...........QDWNVT........................
d1lzla_ ---------.............-----------......LPP.TY.LSTME...........LDPL-R........................
d1m33a_ GLEILKTV-.............--DLRQPLQNV......SMP.FL.RLYGY...........LDGLVP........................
d1mnaa_ ---------.............--LAGPRPGRS......SAP.VL.LVRAS...........EPLGDW........................
d1mpxa2 HAAYDAFWQ.............EQALDKVMARTpl....KVP.TM.WLQGL...........WDQ---........................
d1mtza_ EFTITGTIK.............DWDITDKISAI......KIP.TL.ITVGE...........YDEV-T........................
d1n1ma2 ------HYR.............NSTVMSRAENFk.....QVE.YL.LIHGT...........ADDNVH........................
d1p0ia_ ---------.............-----------......---.--.-----...........------........................
d1pjaa_ WRKNFLRV-.............-----------......-GH.LV.LIGGP...........DDGVIT........................
d1pv1a_ ---------.............--LLIKNIRHVg.....DDR.IL.IHVGD...........SDPFLE........................
d1q0ra_ YAHYSLTLP.............PPSRAAELREV......TVP.TL.VIQAE...........HDPIAP........................
d1qe3a_ ---------.............-----------......---.--.-----...........------........................
d1qfma2 --------Pl............HNVKLPEADDI......QYPsML.LLTAD...........HDDRVV........................
d1qlwa_ ---------.............-CPKPEDVKPLt.....SIP.VL.VVFGD...........H-----........................
d1qo7a_ YRETTPTAS.............APNGATMLQKElyi...HKP.FG.FSFFP...........KDLCPV........................
d1qoza_ ---------.............-----------......---.--.-----...........------........................
d1qtra_ FTHLGFLES.............DDQLLRNVPLIr.....HIP.AV.IVHGR...........YDMACQ........................
d1r1da_ LKALQELIA.............--DVRAHLDLV......YAP.TF.VVQAR...........HDEMIN........................
d1r3da_ GSSVAHMLLatslak.......QPYLLPALQAL......KLP.IH.YVCGE...........QDSK--........................
d1tcaa_ ---------.............-----------......---.--.-----...........------........................
d1thga_ ---------.............-----------......---.--.-----...........------........................
d1thta_ ---------.............--STLDKVANT......SVP.LI.AFTAN...........NDDWVK........................
d1tiba_ ---------.............-----------......---.--.-----...........------........................
d1ufoa_ ---------.............-----------......GVP.LL.HLHGS...........RDHIVP........................
d1ukca_ ---------.............-----------......---.--.-----...........------........................
d1uwca_ ---------.............-----------......---.--.-----...........------........................
d1uxoa_ ---------.............-----------......AKH.RA.VIASK...........DDQIVP........................
d1vkha_ ---------.............--YVKKALSRF......SID.MH.LVHSY...........SDELLT........................
d1wht.1 --------AtcsdtinthwhdaPRSMLPIYRELiaa...GLR.IW.VFSGD...........TDAVVPltatrysigalglptttswypwyd
d1wpxa1 NRNFLFAGDwmkp.........YHTAVTDLLNQ......DLP.IL.VYAGD...........KDFICN........................
d1xfda2 ---------.............--KVAHRVSALe.....EQQ.FL.IIHPT...........ADEKIH........................
d1xkta_ ---------.............-----------......---.--.-----...........------........................
d1zoib_ HYDGIVAFS.............QTDFTEDLKGI......QQP.VL.VMHGD...........DDQIVP........................
d2b20a2 ---------.............-----------......---.--.-----...........------........................
d2b61a1 YLHLLRALDmydpslg......YENVKEALSRI......KAR.YT.LVSVT...........TDQLFK........................
d2bcea_ ---------.............-----------......---.--.-----...........------........................
d2cbga_ ---------.............-----------......---.--.-----...........------........................
d2d81a1 PTANMKSWS.............G-NQIASVANLg.....QRK.IY.MWTGS...........SDTTVG........................
d2dsta1 ---------.............-----------......---.--.-----...........------........................
d2fuka1 ---------.............----RWDFSDVqp....PAQ.WL.VIQGD...........ADEIVD........................
d2gzsa1 ---------.............-----------......---.--.-----...........------........................
d2h1ia1 ---------.............-----MQLANLa.....GKS.VF.IAAGT...........NDPICS........................
d2hu7a2 ---------.............--SPINHVDRI......KEP.LA.LIHPQ...........NDSRTP........................
d2i3da1 ---------.............NTYDFSFLAPC......PSS.GL.IINGD...........ADKVAP........................
d2jbwa1 ---------.............--ETRDVLSQI......ACP.TY.ILHGV...........HDEV-P........................
d2ocka_ IRQFKHLPD.............GNICRHLLPRV......QCP.AL.IVHGE...........KDPLVP........................
d2ogsa_ ---------.............-----------......---.--.-----...........------........................
d2pbla1 ---------.............--SPVEMQNRY......DAK.VT.VWVGG...........AERPAF........................
d2psja_ TLSWPREIPlvkggkpdvvqi.VRNYNAYLRASd.....DLP.KL.FIES-...........-DPGFF........................
d2r8ba1 ---------.............--PFEPKISPAkp....TRR.VL.ITAGE...........RDPICP........................
d2rhwa1 ISAQKAPLS.............TWDVTARLGEI......KAK.TF.ITWGR...........DDRFVP........................
d2vata1 YIAMTLKFDthdisrgr.....AGSIPEALAMI......TQP.AL.IICAR...........SDGLYS........................
d2vf2a_ GKSFAGADFe............AGMMWREVYRL......RQP.VL.LIWGR...........EDRVNP........................
d2xmza_ MAKALRDYGtgq..........MPNLWPRLKEI......KVP.TL.ILAGE...........YDEK-F........................
d2xt0a_ AEIGRQAMS.............-----FWSTQW......SGP.TF.MAVGA...........QDPVLG........................
d2xuah_ YASNCEAID.............AADLRPEAPGI......KVP.AL.VISGT...........HDLAAT........................
d3ainb_ ---------.............--PILADLND-......LPP.AL.IITAE...........HDPLRD........................
d3b5ea1 ---------.............--DHVPATDLA......GIR.TL.IIAGA...........ADETYG........................
d3bdia1 ---------.............VESLKGDMKKI......RQK.TL.LVWGS...........KDHVVP........................
d3be8b1 ---------.............-----------......---.--.-----...........------........................
d3cn7c_ ---------.............-----------......RIP.VL.HLHGS...........QDDVVD........................
d3d2ci_ ---------.............------TDPNQ......KIL.YT.SIYSS...........DDMI--........................
d3dlta_ ---------.............--TVAADLNLV......KQP.TF.IGQAG...........QDELVD........................
d3fcyc_ ---------.............--DVKNLAKRI......KGD.VL.MCVGL...........MDQVCP........................
d3foba_ TLDCITAFS.............KTDFRKDLEKF......NIP.TL.IIHGD...........SDATVP........................
d3g7nb_ ---------.............-----------......---.--.-----...........------........................
d3grob_ ---------.............-----------......---.--.-----...........------........................
d3hzoa1 LRCQLDCAP.............QTNRLPAYRNI......AAP.VL.VIGFA...........DDVVTP........................
d3i1ia_ LHDIAHG--.............FSSLEEALSNV......EAN.VL.MIPCK...........QDLLQP........................
d3k6ka_ ---------.............-----------......---.ML.IHVGS...........EEALLS........................
d3kxpb_ SAAMAQTARgl...........RSDLVPAYRDV......TKP.VL.IVRGE...........SSKLVS........................
d3og9a_ ---------.............--DFEQTVQLD......DKH.VF.LSYAP...........NDMIVP........................
d3qpda_ ---------.............-----------......---.--.-----...........------........................
d3qvmb_ AKTFAKATF.............FSDYRSLLEDI......STP.AL.IFQSA...........KDSLAS........................
d3qyjb_ YRAAATIDL.............EHDELDMKQKI......SCP.VL.VLWGE...........KGIIGR........................
d3stvb_ ---------.............-----------......SVK.RV.FIVAT...........ENDALK........................
d3u0va_ ---------.............--QALQKSNGV......LPE.LF.QCHGT...........ADELVL........................
d3vvma_ YLYLSHAMDqfdlgdgggg...GGGAPGALSRM......RVErAL.VMGAR...........TDILFP........................
d3wibb_ ILAGPRNLPvdgepastvaf..LEQAVNWLNTS......DTP.KL.LLTFK...........PGFLLT........................
d3wj2a_ ---------.............---VADDFSN-......LPP.AI.MVTNE...........YDPLRD........................
d4dnqa_ FVSRTVFNS.............--DMRGVLGLV......KVP.CH.IFQTA...........RDHSVP........................
d4ehba_ SFEYYRALNesv..........RQNAELAKTRL......QMP.TM.TLAGG...........GHGGMG........................
d4ffwa2 ------HYR.............NSTVMSRAENFk.....QVE.YL.LIHGT...........ADDNVH........................
d4hs9a_ ---------.............-----------......---.--.-----...........------........................
d4i3fa1 FEAMFSGGTkkgida.......FVLSDDELNNI......SHQ.ML.VTHAR...........EDFFIP........................
d4j7ab_ ---------.............-----------......---.--.-----...........------........................
d4jeia_ ---------.............-----------......---.--.-----...........------........................
d4kafa1 LWRFPNELPiagepanival..VEEYMDWLHQS......PVP.KL.LFWGT...........PGVLIP........................
d4ke6e_ LLQLARLMA.............--QTKAKLDRI......VCP.AL.IFVSD...........ENHVVP........................
d4l3wa_ ---------.............-----------......---.--.-----...........------........................
d4lipd_ ---------.............-----------......---.--.-----...........------........................
d4lyea_ TMGWAKQNG.............LYYSPEQLASL......TMP.VL.VLGGK...........NDVMVP........................
d4mwsa_ --------Rlyrsm........NSQYLKLLSSQ......KYQ.IL.LYNGD...........VDMACNfmgdewfvdslnqkmevqrrpwlv
d4nmwa_ LNGGLEILK.............TVDLREALKNV......NMP.FL.RLYGY...........LDGLVP........................
d4nzzb_ MLSYYRNLKifteedlr.....RKSLFPLEEEVl.....NIP.VQ.IIWGN...........QDPTFM........................
d4pw0a_ QLTAITNWG.............KKTPSFEITSI......QHP.VF.VVQGS...........NDEMMD........................
d4q34a_ ---------.............-----------......KVP.IV.IYYGDnlpetderpelYEWTRR........................
d4rncb_ RAALFNRAV.............--GHDELLRNL......DIP.VL.VLHGT...........DDSVVD........................
d4uhca1 VAAAALGMAe............RPDSTDLLPAL......SCP.TL.VLVGQ...........FDAISP........................
d4updb_ ---------.............-----------......---.--.-----...........------........................
d4wy8a1 ---------.............-----------......LPR.AL.VITAE...........ADVLRE........................
d4x00b_ ---------.............--EAAKGLSKA......EVP.LL.LLYGA...........QDALVK........................
d4xvcb1 ---------.............--PLYADLQG-......LPP.LL.VQVGG...........IETLLD........................
d4zv9e1 ---------.............--APTADVAKI......EAP.LL.LHFAE...........LDTRIN........................
d4zwna1 SFRQIHDFMqrgaklykne...NNYIQKNFAK-......DKP.VI.IMHGQ...........DDTIND........................
d5a62a_ FVAATVALYti...........PGNVVQGLRAS......GCK.VF.AIVGS...........DDDV-F........................
d5ah0a1 ---------.............-----------......---.--.-----...........------........................
d5dwda_ ---------.............-----------......KPP.VL.LIHGD...........LDDVVP........................
d5egna_ DAA-----Tadpngvf......AWNIKDRLSSI......QAP.TL.VVAGE...........EDLVTT........................
d5frda1 RFDLLE---.............--DYRNGKLKI......GVP.TL.VIVGE...........EDKLTP........................
d5fv4a_ ---------.............-----------......---.--.-----...........------........................
d5h3ha_ TIQSAIALR.............DEDLRDGLPKI......TVD.TL.IMHGK...........KDQVCP........................
d5hk8a_ ---------.............--KLPPNPEAE......KVP.RV.YIKTA...........KDNLFD........................
d5jkja_ LLYLVRACQlfvagh.......QGNLEQGLASI......KAK.TL.FIPAQ...........TDLLLM........................
d5mifa_ ---------.............-----------......---.--.-----...........------........................
d5n4fa1 F--------.............-----------......---.--.-----...........------........................
d5syna_ ---------.............-----ANGSAK......DLA.IL.QCHGE...........LDPMVP........................
d5uroa1 PLNWYRTRElnakd........EMDRAKNGPPLrf....EMP.AL.FVAAS...........KDNALP........................
d5w15a1 FYRQIAQMRqry..........IEDAEARYAPP......DFP.VR.IVWGE...........DDRWIP........................
d5w1ua_ ---------.............-----------......---.--.-----...........------........................
d5w8oa_ YVTLTDSLSshdvgrg......RGGVEAALRSC......EVP.VV.VGGFT...........SDRLYP........................
d5yhpa_ FADAFARIEshyfvnggfmpegELLKPENIAKIs.....HIP.AV.IVQGR...........YDMVCP........................
d6emia_ ---------.............-----------......---.--.-----...........------........................

                     240                                                        250                 
                       |                                                          |                 
d1a88a_ .....YAD.AAPKSAELL...............................A.................NAT.LKSYE.....GL.PHGMLS..
d1a8qa_ .....IDA.TGRKSAQII...............................P.................NAE.LKVYE.....GS.SHGIAMvp
d1ac5a_ .....---.---------...............................-.................---.-----.....--.------..
d1auoa_ .....NAM.-GRSAFEHL...............................Ksrgv.............TVT.WQEY-.....PM.GHEVLP..
d1b6ga_ .....PDV.-MYPMKALI...............................Ng................CPE.PLEIA.....DA.GHFVQE..
d1brta_ .....IEN.TARVFHKAL...............................P.................SAE.YVEVE.....GA.PHGLLW..
d1bu8a2 .....---.---------...............................-.................---.-----.....--.------..
d1c4xa_ .....LDT.-SLYLTKHL...............................K.................HAE.LVVLD.....RC.GHWAQL..
d1cexa_ .....---.---------...............................-.................---.-----.....--.------..
d1cv2a_ .....TGR.-MRDFCRTW...............................P.................NQT.EITVA.....G-.AHFIQE..
d1dina_ .....APS.-RQLITEGF...............................Ganp..............LLQ.VHWYE.....EA.GHSFAR..
d1dwoa_ .....PDF.-QRWQIANY...............................K.................PDK.VYQVQ.....GG.DHKLQL..
d1dx4a_ .....---.---------...............................-.................---.-----.....--.------..
d1ehya_ .....YAP.LIEFVPKYY...............................S.................NYT.METIE.....DC.GHFLMV..
d1ei9a_ .....P--.---------...............................-.................---.-----.....--.------..
d1ek1a2 .....PEM.-SKNMEKWI...............................P.................FLK.RGHIE.....DC.GHWTQI..
d1evqa_ .....---.-A-------...............................-.................---.-----.....--.------..
d1ex9a_ .....---.---------...............................-.................---.-----.....--.------..
d1f0na_ .....---.---------...............................-.................---.-----.....--.------..
d1fj2a_ .....LMF.-GSLTVEKL...............................Ktlvnpa...........NVT.FKTYE.....GM.MHSSCQ..
d1gkla_ .....---.-FDYTSDFS...............................Kg................NFY.FLVAP.....GA.THW---..
d1i6wa_ .....---.-VMNYLSRL...............................D.................GAR.NVQIH.....GV.GHIGL-..
d1imja_ .....T--.-SFEHLKQL...............................P.................NHR.VLIMK.....GA.GHPCYL..
d1iupa_ .....LSS.-SLRLGELI...............................D.................RAQ.LHVFG.....RC.GHWTQI..
d1ivya_ kygdsGEQ.-IAGFVKEF...............................S.................HIA.FLTIK.....GA.GHMVPT..
d1j1ia_ .....VET.-AYKFLDLI...............................D.................DSW.GYIIP.....HC.GHWAMI..
d1jfra_ .....VAT.HSKPFYESL...............................Pgsl..............DKA.YLELR.....GA.SHFTPN..
d1ji3a_ .....---.---------...............................-.................---.-----.....--.------..
d1jjfa_ .....FGQ.RVHEYCVAN...............................Ni................NHV.YWLIQ.....GG.GHDFNV..
d1jkma_ .....---.---------...............................-.................---.-----.....--.------..
d1jmkc_ .....---.---------...............................-.................---.-----.....--.------..
d1ju3a2 .....ESL.RTFVAVKDN...............................A.................DAR.LV---.....--.------..
d1k4ya_ .....---.---------...............................-.................---.-----.....--.------..
d1k8qa_ .....PHD.-VDLLLSKL...............................Pn................LIY.HRKIP.....PY.NHLDFIwa
d1l7aa_ .....PST.-VFAAYNHL...............................Et................KKE.LKVYR.....YF.GHEY--..
d1lgya_ .....---.---------...............................-.................---.-----.....--.------..
d1lnsa3 .....PEQ.-AYNFWKAL...............................Peg...............HAK.HAFLH.....RG.AHIYMN..
d1lzla_ .....DEG.-IEYALRLL...............................Qagv..............SVE.LHSFP.....GT.FHGSAL..
d1m33a_ .....RKV.-VPMLDKLW...............................P.................HSE.SYIFA.....KA.AHAPFI..
d1mnaa_ .....QEE.-RGDWRAHW...............................Dl................PHT.VADVP.....G-.DHFTMMr.
d1mpxa2 .....---.---------...............................-.................---.-----.....--.------..
d1mtza_ .....PNV.-ARVIHEKI...............................A.................GSE.LHVFR.....DC.SHLTMW..
d1n1ma2 .....FQQ.-SAQISKAL...............................Vdvgv.............DFQ.AMWYT.....DE.DHGIAS..
d1p0ia_ .....---.---------...............................-.................---.-----.....--.------..
d1pjaa_ .....PWQ.---------...............................-.................---.-----.....--.------..
d1pv1a_ .....EHL.KPELLLEAV...............................Katswqd...........YVE.IKKVH.....GF.DHSYYF..
d1q0ra_ .....APH.-GKHLAGLI...............................P.................TAR.LAEIP.....GM.GHALPS..
d1qe3a_ .....---.---------...............................-.................---.-----.....--.------..
d1qfma2 .....PLH.-SLKFIATL...............................Q.................---.-----.....--.------..
d1qlwa_ .....---.-IEEFPRWA...............................PrlkachafidalnaaggKGQ.LMSLPalgvhGN.SHMMMQ..
d1qo7a_ .....---.-PRSWIATT...............................Gn................LVF.FRDHA.....EG.GHFAAL..
d1qoza_ .....---.---------...............................-.................---.-----.....--.------..
d1qtra_ .....VQN.-AWDLAKAW...............................P.................EAE.LHIVE.....GA.GHS---..
d1r1da_ .....PDS.-ANIIYNEI...............................Esp...............VKQ.IKWYE.....QS.GHVITL..
d1r3da_ .....---.-FQQLAESS...............................G.................-LS.YSQVA.....QA.GHNVHH..
d1tcaa_ .....---.---------...............................-.................---.-----.....--.------..
d1thga_ .....---.---------...............................-.................---.-----.....--.------..
d1thta_ .....QEE.-VYDMLAHI...............................Rtg...............HCK.LYSLL.....GS.SHDL--..
d1tiba_ .....---.---------...............................-.................---.-----.....--.------..
d1ufoa_ .....LAR.-MEKTLEAL...............................Rphypeg...........RLA.RFVEE.....GA.GHTLT-..
d1ukca_ .....---.---------...............................-.................---.-----.....--.------..
d1uwca_ .....---.---------...............................-.................---.-----.....--.------..
d1uxoa_ .....FSF.-SKDLAQQI...............................D.................-AA.LYEVQ.....HG.GHFLED..
d1vkha_ .....LRQ.-TNCLISCL...............................Q.................---.-----.....--.------..
d1wht.1 .....DQE.-VGGWSQVY...............................K.................GLT.LVSVR.....GA.GHEVPL..
d1wpxa1 .....WLG.-NKAWTDVLpwkydeefasqkvrnwtasitdevagevksyK.................HFT.YLRVF.....NG.GHMVPF..
d1xfda2 .....FQH.TAELITQLI...............................Rgka..............NYS.LQIYP.....DE.SHYFTS..
d1xkta_ .....---.---------...............................-.................---.-----.....--.------..
d1zoib_ .....YEN.SGVLSAKLL...............................P.................NGA.LKTYK.....GY.PHGMPT..
d2b20a2 .....---.---------...............................-.................---.-----.....--.------..
d2b61a1 .....PID.-LYKSKQLL...............................Eqsgv.............DLH.FYEFPs....DY.GHDAFL..
d2bcea_ .....---.---------...............................-.................---.-----.....--.------..
d2cbga_ .....---.---------...............................-.................---.-----.....--.------..
d2d81a1 .....PNV.-MNQLKAQL...............................Gnfdnsa...........NVS.YVTTT.....GA.VHTFPT..
d2dsta1 .....---.---------...............................-.................---.-----.....--.------..
d2fuka1 .....PQA.-VYDWLETL...............................Eq................QPT.LVRMP.....DT.SHFFHR..
d2gzsa1 .....---.---------...............................-.................---.-----.....--.------..
d2h1ia1 .....SAE.-SEELKVLL...............................Enana.............NVT.MHWE-.....NR.GHQLTM..
d2hu7a2 .....LKP.LLRLMGELL...............................Argk..............TFE.AHIIP.....DA.GHAIN-..
d2i3da1 .....EKD.-VNGLVEKL...............................Ktqkgi............LIT.HRTLP.....GA.NHFFN-..
d2jbwa1 .....LSF.-VDTVLELV...............................Pae...............HLN.LVVEK.....DG.DHCCHNlg
d2ocka_ .....RFH.-ADFIHKHV...............................K.................GSR.LHLMP.....EG.KHNLHL..
d2ogsa_ .....---.---------...............................-.................---.-----.....--.------..
d2pbla1 .....LDQ.-AIWLVEAW...............................-.................---.-----.....DA.DHVIAF..
d2psja_ .....SNA.-IVEGAKKF...............................P.................NTE.FVKVK.....G-.LHFLQE..
d2r8ba1 .....VQL.-TKALEESL...............................Kaqgg.............TVE.TVWHP.....G-.GHEIR-..
d2rhwa1 .....LDH.-GLKLLWNI...............................D.................DAR.LHVFS.....KC.GHWAQW..
d2vata1 .....FDE.-HVEMGRSI...............................P.................NSR.LCVVDt....NE.GHDFFV..
d2vf2a_ .....LDG.-ALVALKTI...............................P.................RAQ.LHVFG.....QC.GHWVQV..
d2xmza_ .....VQI.-AKKMANLI...............................P.................NSK.CKLIS.....AT.GHTIHV..
d2xt0a_ .....PEV.-MGMLRQAI...............................Rg................CPE.PMIVE.....AG.GHFVQE..
d2xuah_ .....PAQ.-GRELAQAI...............................A.................GAR.YVEL-.....DA.SHISNI..
d3ainb_ .....Q--.-GEAYAN--...............................-.................---.-----.....--.------..
d3b5ea1 .....PF-.-VPALVTLL...............................Srhga.............EVD.ARIIP.....S-.GHDIGD..
d3bdia1 .....IAL.-SKEYASII...............................S.................GSR.LEIVE.....GS.GHPVYI..
d3be8b1 .....---.---------...............................-.................---.-----.....--.------..
d3cn7c_ .....PAL.-GRAAHDAL...............................Qaq...............GVE.VGWHDy....PM.GHEVSL..
d3d2ci_ .....---.-VMNYLSRL...............................D.................GAR.NVQIH.....GV.GHMGLL..
d3dlta_ .....GRL.-AYQLRDAL...............................Inaa..............RVD.FHWYD.....DA.KHVITV..
d3fcyc_ .....PST.-VFAAYNNI...............................Qs................KKD.IKVYP.....DY.GHEPMR..
d3foba_ .....FEY.SGKLTHEAI...............................P.................NSK.VALIK.....GG.PHGLNA..
d3g7nb_ .....---.---------...............................-.................---.-----.....--.------..
d3grob_ .....---.---------...............................-.................---.-----.....--.------..
d3hzoa1 .....PYL.-GREVADAL...............................P.................NGR.YLQIP.....DA.GHLGFF..
d3i1ia_ .....SRY.-NYKMVDLL...............................Qkqgk.............YAE.VYEIE.....SInGHMAGV..
d3k6ka_ .....D--.-STTLAERA...............................Gaagv.............SVE.LKIWP.....DM.PHVFQMyg
d3kxpb_ .....AAA.-LAKTSRLR...............................P.................DLP.VVVVP.....GA.DHYVNE..
d3og9a_ .....QKN.-FGDLKGDL...............................Eds...............GCQ.LEIYE.....SSlGHQLTQ..
d3qpda_ .....---.---------...............................-.................---.-----.....--.------..
d3qvmb_ .....PEV.-GQYMAENI...............................P.................NSQ.LELIQ.....AE.GHCLHM..
d3qyjb_ .....KYD.VLATWRERA...............................I.................DVS.GQSLP.....-C.GHFLPE..
d3stvb_ .....KEF.-LKLMIEKN...............................P.................PDE.VKEIE.....GS.DHVTMM..
d3u0va_ .....HSW.-AEETNSML...............................Kslgv.............TTK.FHSFP.....NV.YHELS-..
d3vvma_ .....LSQ.-QQEIADGL...............................Sagga.............DVS.FLPVDt....PA.GHDAFL..
d3wibb_ .....DAI.-LKWSQVTI...............................R.................NLE.IEAAG.....AG.IHFVQE..
d3wj2a_ .....PEE.---------...............................-.................---.-----.....--.------..
d4dnqa_ .....ASV.-ATYLKNHL...............................Gg................KNT.VHWLN.....IE.GHLPHL..
d4ehba_ .....TFQ.-LEQMKAYA...............................E.................DVE.GHVLP.....GC.GHWLPE..
d4ffwa2 .....FQQ.-SAQISKAL...............................Vdagv.............DFQ.AMWYT.....DE.DHGIAS..
d4hs9a_ .....---.---------...............................-.................---.-----.....--.------..
d4i3fa1 .....LNN.-AYYLIDRI...............................P.................NAQ.LHVFD.....HC.GHWVQI..
d4j7ab_ .....---.---------...............................-.................---.-----.....--.------..
d4jeia_ .....---.---------...............................-.................---.-----.....--.------..
d4kafa1 .....PAE.-AARLAKSL...............................P.................NCK.AVDIG.....PG.LNLLQE..
d4ke6e_ .....PGN.-ADIIFQGI...............................Sst...............EKE.IVRLR.....NS.YHVATL..
d4l3wa_ .....---.---------...............................-.................---.-----.....--.------..
d4lipd_ .....---.---------...............................-.................---.-----.....--.------..
d4lyea_ .....VRK.-VIDQILAI...............................P.................QAI.GHVFP.....NC.GHWVMI..
d4mwsa_ kygdsGEQ.-IAGFVKEF...............................S.................HIA.FLTIK.....GA.GHMVPT..
d4nmwa_ .....RKI.-VPLLDTLW...............................P.................HST.SQIMA.....KA.AHAPFI..
d4nzzb_ .....PEN.-LDGIEEYV...............................P.................NIS.VHRLA.....EA.SHAPQH..
d4pw0a_ .....TYN.-SYELFKQL...............................P.................DAI.LSLYP.....DA.AHGSFY..
d4q34a_ .....LRL.-MKIWAKML...............................Ndqgg.............DVT.VIHLPevglhGN.THFPMS..
d4rncb_ .....VSA.-GKHAEELI...............................P.................KSQ.ASYWV.....GC.NHGPFV..
d4uhca1 .....PEE.-MEAMARTI...............................P.................QSQ.FVVIP.....DA.GHLPPM..
d4updb_ .....---.---------...............................-.................---.-----.....--.------..
d4wy8a1 .....EGEaYARKLIEAG...............................N.................DVT.AVRYL.....GI.IHGIFN..
d4x00b_ .....AKP.SIARAKSLN...............................P.................RIR.SELYA.....DS.GHAPFL..
d4xvcb1 .....DAR.-ALTTRAKA...............................Agv...............DAD.LEVWD.....DM.PHVWQH..
d4zv9e1 .....EGW.PAYEAALKA...............................Nnk...............VYE.AYIYP.....GV.NHGFHN..
d4zwna1 .....PKG.-SEKFIRDC...............................Psa...............DKE.LKLYP.....GA.RHSIFS..
d5a62a_ .....MRL.-IKETKEEI...............................P.................EME.LRVLQ.....GS.DHWVVI..
d5ah0a1 .....---.---------...............................-.................---.-----.....--.------..
d5dwda_ .....VIG.-SETALPKL...............................Idlgi.............DAR.LHISQ.....GS.GHTIAQ..
d5egna_ .....VAN.-NQLLADNI...............................P.................GAE.LRVIN.....DV.GHFYQL..
d5frda1 .....LKY.-HEFFHKHI...............................P.................NSE.LVVIP.....GA.SHMVML..
d5fv4a_ .....---.---------...............................-.................---.-----.....--.------..
d5h3ha_ .....FEF.-AEVMHENI...............................A.................GSR.LEVFE.....ES.GHGMFL..
d5hk8a_ .....SVR.-QDLLVENW...............................P.................PSQ.LYVLE.....DS.DHSAFF..
d5jkja_ .....PYL.-SQSAHQGL...............................Tsmnn.............DST.LVTLN.....GKlGHDEGV..
d5mifa_ .....---.---------...............................-.................---.-----.....--.------..
d5n4fa1 .....---.---------...............................-.................---.-----.....--.------..
d5syna_ .....VRF.-GALTAEKL...............................Rsvvtpa...........RVQ.FKTYP.....GV.MHSSCP..
d5uroa1 .....PAM.-SKGMDAFY...............................K.................DLT.RAEV-.....DA.THWALT..
d5w15a1 .....LEQ.-GQALADRI...............................A.................NGK.LIRVP.....RA.GHLVQE..
d5w1ua_ .....---.---------...............................-.................---.-----.....--.------..
d5w8oa_ .....LRL.-QEELAELM...............................P.................GCRgLNVVE.....SIyGHDGFL..
d5yhpa_ .....ITT.-AYELTKLW...............................P.................EAK.FVVIP.....DA.GHSAIE..
d6emia_ .....---.---------...............................-.................---.-----.....--.------..

         260                270                                                                     
           |                  |                                                                     
d1a88a_ ...T.HP........EVLNPDLLAFVK-s...............................................................
d1a8qa_ ...G.DK........EKFNRDLLEFLNK................................................................
d1ac5a_ ...-.--........-------------dpntqslsylpfamekklidesnpnfkhltnahencqnlinsastdeaahfsyqecenilnlll
d1auoa_ ...Q.EI........HDI----------gawlaarlg.......................................................
d1b6ga_ ...F.GE........QVAREALKHF---aete............................................................
d1brta_ ...T.HA........EEVNTALLAFLA-k...............................................................
d1bu8a2 ...-.--........-------------htdsapiipylgfgmsqkvghldffpnggkempgcqknilstivdingiwegtqnfvacnhlrs
d1c4xa_ ...E.RW........DAMGPMLMEHF--ra..............................................................
d1cexa_ ...-.--........-------------knlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdargpapefliekvravrgs.
d1cv2a_ ...D.SP........DEIGAAIAAFVR-rlrpa...........................................................
d1dina_ ...T.--........-------------sssgyvasaaalanertldflaplqs......................................
d1dwoa_ ...T.KT........EEVAHILQE----vadaya..........................................................
d1dx4a_ ...-.--........-------------napwshmtsekaveigkalindcncnasmlktnpahvmscmrsvdaktisvqqwnsysgilsfp
d1ehya_ ...E.KP........EIAIDRIKTA---fr..............................................................
d1ei9a_ ...-.--........-------------vdsewfgfyrsgqaketiplqestlytqdrlglkamdkagqlvflalegdhlqlseewfyahii
d1ek1a2 ...E.KP........TEVNQILIKWLQ-te..............................................................
d1evqa_ ...-.--........-------------ealnkagvkveienfedlihgfaqfyslspgatkalvriaeklrdala................
d1ex9a_ ...-.--........-------------qippgsageavlsglvnslgalisflssgstgtqnslgsleslnsegaarfnakypqgiptsac
d1f0na_ ...-.--........-------------ykaadmwgpssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrssn
d1fj2a_ ...Q.EM........MDVKQ--------fidkllppi.......................................................
d1gkla_ ...-.--........-------------wgyvrhyiydalpyffhelehhhhhh......................................
d1i6wa_ ...-.--........-------------lyssqvnslikeglngggqntn..........................................
d1imja_ ...D.KP........EEWHTGLLDFLQ-gl..............................................................
d1iupa_ ...E.QT........DRFNRLVVEFFN-ea..............................................................
d1ivya_ ...D.KP........LAAFTMFSRFLN-kqpy............................................................
d1j1ia_ ...E.HP........EDFANATLSFLS-lr..............................................................
d1jfra_ ...T.SD........TTIAKYSISWLKRfidsdtryeqflcpiprpsltiaeyrgtcphts...............................
d1ji3a_ ...-.--........-------------fdlqkavleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtarydl
d1jjfa_ ...W.KP........GL-----------wnflqmadeagltrd.................................................
d1jkma_ ...-.--........-------------tgehaedpiawpyfasedelrglppfvvavneldplrdegiafarrlaragvdvaarvniglvh
d1jmkc_ ...-.--........-------------ysyyvnlistgqvkadidlltsgadfdipewlasweeattgayrmkrgfgthaemlqgetldrn
d1ju3a2 ...-.--........-------------vgpwshsnltgrnadrkfgiaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidew
d1k4ya_ ...-.--........-------------llsslfrkntkslaekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpken
d1k8qa_ ..mD.AP........QAVYNEIVS----mmgtd...........................................................
d1l7aa_ ...-.--........-------------ipafqteklaffkqilkg..............................................
d1lgya_ ...-.--........-------------qreprlspknlsiftvggprvgnptfayyvestgipfqrtvhkrdivphvppqsfgflhpgves
d1lnsa3 ...SwQS........IDFSETIN-----ayfvaklldrdlnlnlppvilqenskdqvwtmmndf............................
d1lzla_ ...V.AT........AA-----------vsergaaealtairrglrs.............................................
d1m33a_ ...S.HP........AEFCHLLV-----alkqrvgs........................................................
d1mnaa_ ...D.HA........PAVAEAVLSWLD-a...............................................................
d1mpxa2 ...-.--........-------------edmwgaihsyaameprdkrntlnylvmgpwrhsqvnydgsalgalnfegdtarqfrhdvlrpff
d1mtza_ ...E.DR........EGYNKLLSDFI--lkhl............................................................
d1n1ma2 ...StAH........QHIYTHMSHFIK-qcfs............................................................
d1p0ia_ ...-.--........-------------avtslyearnrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvd
d1pjaa_ ...-.--........-------------ssffgfydanetvlemeeqlvylrdsfglktllargaivrcpmagishtawhsnrtlyetciep
d1pv1a_ ...-.--........-------------vstfvpehaefharnlgli.............................................
d1q0ra_ ...S.VH........GPLAEVILA----htrsaa..........................................................
d1qe3a_ ...-.--........-------------inesqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgipl
d1qfma2 ...-.--........-------------yivgrsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip...........
d1qlwa_ ...DrNN........LQVADLILDWI--grnta...........................................................
d1qo7a_ ...E.RP........RELKTDLTAFVE-qvw.............................................................
d1qoza_ ...-.--........-------------alcgggdpgegitntavpltagavsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcp
d1qtra_ ...-.--........-------------ydepgilhqlmiatdrfagk............................................
d1r1da_ ...DqEK........DQLHEDIYAFLE-sldw............................................................
d1r3da_ ...E.QP........QAFAKIVQAMI--hsiid...........................................................
d1tcaa_ ...-.--........-------------ldalavsapsvwqqttgsalttalrnaggltqivpttnlysatdeivqpqvsnspldssylfng
d1thga_ ...-.--........-------------aqyagcdtsasandtleclrsksssvlhdaqnsydlkdlfgllpqflgfgprpdgniipdaaye
d1thta_ ...-.--........-------------genlvvlrnfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpema..
d1tiba_ ...-.--........-------------gngydidvfsygaprvgnrafaefltvqtggtlyrithtndivprlpprefgyshsspeywiks
d1ufoa_ ...-.--........-------------plmarvglaflehwlear..............................................
d1ukca_ ...-.--........-------------cssardsleclreqdiatiqkgntgspfpggsssplpdwyflpvtdgslvpdelynafdagnfi
d1uwca_ ...-.--........-------------ydnvrlytfgeprsgnqafasymndafqvsspettqyfrvthsndgipnlppaeqgyahggvey
d1uxoa_ ...E.--........-------------gftslpivydvltsyfsk..............................................
d1vkha_ ...-.--........-------------dyqlsfklylddlglhndvykngkvakyifdnic..............................
d1wht.1 ...H.RP........RQALVLFQYFLQ-gkpmpgq.........................................................
d1wpxa1 ...D.VP........ENALSMVNEWI--hggfsl..........................................................
d1xfda2 ...SsLK........QHLYRSIINFF--vecfri..........................................................
d1xkta_ ...-.--........-------------tpgceaeaeteaicffvqqftdmehnrvleallplkgleervaaavdliikshqgldrqelsfa
d1zoib_ ...T.HA........DVINADLLAFIR-................................................................
d2b20a2 ...-.--........-------------vlleklkagevsaeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgg
d2b61a1 ...V.DY........DQFEKRIRD----glagn...........................................................
d2bcea_ ...-.--........-------------vgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddpvnlyana
d2cbga_ ...-.--........-------------kdqsitadtenddsaaylpeavretvmqkkrcyqeywaqlinegriksnihfieagiqtetsga
d2d81a1 ...-.--........-------------dfngagdnscslstspyisncnydgagaalkwiygslnarntgtlsgsvlsfaqsgsygangmd
d2dsta1 ...-.--........-------------fvagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlssklsyg.........
d2fuka1 ...-.--........-------------klidlrgalqhgvrrwlpatp...........................................
d2gzsa1 ...-.--........-------------grgydallsrvtaveplqfctkhlaimegsatqgdnrethavgvlskihttltilkdkgvnavf
d2h1ia1 ...G.--........-------------evekakewydkaf...................................................
d2hu7a2 ...-.--........-------------tmedavkillpavfflatqrer..........................................
d2i3da1 ...-.--........-------------gkvdelmgecedyldrrlngelvpep......................................
d2jbwa1 ...I.--........-------------rprlemadwlydvlvagkkvaptmkgwpleh.................................
d2ocka_ ...R.FA........DEFNKLAEDFLQ-................................................................
d2ogsa_ ...-.--........-------------lslgpgvmygpvvdgrvlrrhpiealrygaasgipiligvtkdeynlftltdpswtklgekell
d2pbla1 ...E.K-........-------------hhfnviepladpesdlvavita..........................................
d2psja_ ...D.AP........DEMGKYIKSFVE-rvlkne..........................................................
d2r8ba1 ...-.--........-------------sgeidavrgflaayg.................................................
d2rhwa1 ...E.HA........DEFNRLVIDFLR-ha..............................................................
d2vata1 ...M.EA........DKVNDAVRGFLDQ................................................................
d2vf2a_ ...E.KF........DEFNKLTIEFL--ggg.............................................................
d2xmza_ ...E.DS........DEFDTMILGFLK-eeqn............................................................
d2xt0a_ ...H.GE........P------------iaraalaafgq.....................................................
d2xuah_ ...E.RA........DAFTKTVVDFL--te..............................................................
d3ainb_ ...-.--........-------------kllqsgvqvtsvgfnnvihgfvsffpfieqgrdaigligyvlrkvfygk...............
d3b5ea1 ...P.D-........-------------aaivrqwlagp.....................................................
d3bdia1 ...E.KP........EEFVRITVDFLR-nl..............................................................
d3be8b1 ...-.--........-------------iladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpvidgdvipddpqilmeqgef
d3cn7c_ ...E.EI........HDIGAWLRK----rl..............................................................
d3d2ci_ ...-.--........-------------yssqvyslikeglngggqntn...........................................
d3dlta_ ...NsAH........HALEEDVIAFMQ-qe..............................................................
d3fcyc_ ...G.FG........DL-----------amqfmlelys......................................................
d3foba_ ...T.HA........KEFNEALLLFLK-d...............................................................
d3g7nb_ ...-.--........-------------slvsnalnafpignqawadfgtaqagtfnrgnnvldgvpnmyssplvnfkhygteyyssgteas
d3grob_ ...-.--........-------------nesykknlmalkkfvmvkflndsivdpvdsewfgfyrsgqaketiplqetslytqdrlglkemd
d3hzoa1 ...E.RP........EAVNTAMLKFF--asvk............................................................
d3i1ia_ ...F.DI........HLFEKKVYEFLNRkvssf...........................................................
d3k6ka_ kfvN.AA........DISIKEI------chwisaris.......................................................
d3kxpb_ ...V.SP........EITLKAITNFID-a...............................................................
d3og9a_ ...E.EV........-------------laakkwltetk.....................................................
d3qpda_ ...-.--........-------------naqergqianfpkdkvkvycavgdlvclgtlivapphfsylsdtgdasdfllsql.........
d3qvmb_ ...T.DA........GLITPLLIHFIQ-nnqt............................................................
d3qyjb_ ...E.AP........EETYQAIYNFL--th..............................................................
d3stvb_ ...S.KP........QQLFTTLLSI---ankyk...........................................................
d3u0va_ ...-.--........-------------kteldilklwiltklp................................................
d3vvma_ ...V.DI........ERFGPPVAKFL--aiva............................................................
d3wibb_ ...E.QP........ETIARLLDAWL--tria............................................................
d3wj2a_ ...-.--........-------------tyvkklreagvravgirgigmihgsatdfevsdgarnivkmvariipdyl..............
d4dnqa_ ...S.AP........TLLAQELRRAL--s...............................................................
d4ehba_ ...E.CA........APMNRLVIDFLS-rgr.............................................................
d4ffwa2 ...StAH........QHIYSHMSHFLQ-qcfs............................................................
d4hs9a_ ...-.--........-------------yivekvlnafgtiistfsghrgdpqdaiaalesltteqvtefnnkypqalpktpcgegdeivng
d4i3fa1 ...E.KK........KAFNNLTKLFFD-gmfdd...........................................................
d4j7ab_ ...-.--........-------------dptgenasnplawpyhasledlaglpphvisvneldplrdeglahyrkllkagvstvgrtvhgt
d4jeia_ ...-.--........-------------vnghdplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
d4kafa1 ...D.NP........DLIGSEIARWLS-tl..............................................................
d4ke6e_ ...DyDQ........PMIIERSLEFF--akha............................................................
d4l3wa_ ...-.--........-------------ekrlspknlsiytvgcprvgnnafayyvdstgipfhrtvhkrdivphvppqafgylhpgveswi
d4lipd_ ...-.--........-------------dalaalktlttaqaatynqnypsaglgapgscqtgaptetvggnthllyswagtaiqptisvfg
d4lyea_ ...E.YP........EEFCTQTLHFF--gkl.............................................................
d4mwsa_ ...D.KP........LAAFTMFSRFLN-kqpy............................................................
d4nmwa_ ...S.HP........AAFCQALM-----tlkssl..........................................................
d4nzzb_ ...E.KP........QEVNNVMWNFLNK................................................................
d4pw0a_ ...Q.YP........ELFVSQTEYFLD-sy..............................................................
d4q34a_ ...DlNN........IEVADLLSEWL--htkald..........................................................
d4rncb_ ...E.DP........TRFVSEVRTFIS-slg.............................................................
d4uhca1 ...E.QP........ERVTQAIREWLRKvhtea...........................................................
d4updb_ ...-.--........-------------vpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyssialsylp
d4wy8a1 ...L.ATlsptg...SEILDHIVAWLQ-ktwk............................................................
d4x00b_ ...E.EP........ERFNRDLSDFV--rmalsr..........................................................
d4xvcb1 ...F.APilpeg...KQAIARIGEFLR-kqig............................................................
d4zv9e1 ...D.STprydksaaDLAWQRTLKWF--dkyl............................................................
d4zwna1 ...L.ET........DKVFNTVF-----ndmkqwldkhttte..................................................
d5a62a_ ...E.KP........KEMYDILMGFL--aivtkdv.........................................................
d5ah0a1 ...-.--........-------------iydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdlstdgarvlnqwvkaqsdiyyf
d5dwda_ ...D.GL........DTATAFLREI---l...............................................................
d5egna_ ...E.RP........SEFNELLRGFV--a...............................................................
d5frda1 ...E.KH........VEFNEALEKFLKKvgva............................................................
d5fv4a_ ...-.--........-------------ftaglvrkdmkaaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpres
d5h3ha_ ...D.ER........EKFTETLVSYVK-s...............................................................
d5hk8a_ ...S.VP........TTLFAYLLR----avsfl...........................................................
d5jkja_ ...T.NV........SAQAQAIRQFLE-nd..............................................................
d5mifa_ ...-.--........-------------atfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaevdpirq
d5n4fa1 ...-.--........-------------kfiatlqhnvpqnphpllikidkswlghgmgkptdknvkdaadkwgfiaralglel........
d5syna_ ...Q.EM........AAVKEFL------ekllppv.........................................................
d5uroa1 ...Q.AG........DEVNRVIGEWLNKal..............................................................
d5w15a1 ...D.AP........EAIVAAVLD----r...............................................................
d5w1ua_ ...-.--........-------------lakaigwdgqggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmip
d5w8oa_ ...I.ET........EAVGKLIRQTL--elas............................................................
d5yhpa_ ...A.G-........-------------tekalveateefakla................................................
d6emia_ ...-.--........-------------vmspeearnrtlnlakllgcsreneteiikclrnkdpqeildneafvvpystplsvnfgptvdg

d1a88a_ ............................................................................................
d1a8qa_ ............................................................................................
d1ac5a_ sytressqkgtadclnmynfnlkdsypscgmnwpkdisfvskffstpgvidslhldsdkidhwkectnsvgtklsnpiskpsihllpglles
d1auoa_ ............................................................................................
d1b6ga_ ............................................................................................
d1brta_ ............................................................................................
d1bu8a2 ykyyassilnpdgflgypcssyekfqqndcfpcpeegcpkmghyadqfegktatveqtvylntgdsgnft......................
d1c4xa_ ............................................................................................
d1cexa_ ............................................................................................
d1cv2a_ ............................................................................................
d1dina_ ............................................................................................
d1dwoa_ ............................................................................................
d1dx4a_ saptidgaflpadpmtlmktadlkdydilmgnvrdegtyfllydfidyfdkddatalprdkyleimnnifgkatqaereaiifqytswegnp
d1ehya_ ............................................................................................
d1ei9a_ pfle........................................................................................
d1ek1a2 ............................................................................................
d1evqa_ ............................................................................................
d1ex9a_ gegaykvngvsyyswsgsspltnfldpsdaflgassltfkngtandglvgtcsshlgmvirdnyrmnhldevnqvfgltslfetspvsvyrq
d1f0na_ lkfqdaynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag............................................
d1fj2a_ ............................................................................................
d1gkla_ ............................................................................................
d1i6wa_ ............................................................................................
d1imja_ ............................................................................................
d1iupa_ ............................................................................................
d1ivya_ ............................................................................................
d1j1ia_ ............................................................................................
d1jfra_ ............................................................................................
d1ji3a_ svsgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgsyrnptlgidshwlendgivntismngpkrgsndri
d1jjfa_ ............................................................................................
d1jkma_ gadvifrhwlpaalestvrdvagfaadrarlr............................................................
d1jmkc_ agilleflntqt................................................................................
d1ju3a2 rdetdw......................................................................................
d1k4ya_ taflttvidgvllpkapaeilaekkynmlpymvginqqefgwiipmqmlgyplsegkldqktatellwksypivnvskeltpvatekylggt
d1k8qa_ ............................................................................................
d1l7aa_ ............................................................................................
d1lgya_ wiksgtsnvqictseietkdcsnsivpftsildhlsyfdinegscl..............................................
d1lnsa3 ............................................................................................
d1lzla_ ............................................................................................
d1m33a_ ............................................................................................
d1mnaa_ ............................................................................................
d1mpxa2 dqylvdgapkadtppvfiyntgenhwdrlkaw............................................................
d1mtza_ ............................................................................................
d1n1ma2 ............................................................................................
d1p0ia_ gdfltdmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvsefgkesilfhytdwvddqrpenyre
d1pjaa_ wls.........................................................................................
d1pv1a_ ............................................................................................
d1q0ra_ ............................................................................................
d1qe3a_ ligttrdegylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdllfwrpavayasaqshyapvwmyrfdwhpekppy
d1qfma2 ............................................................................................
d1qlwa_ ............................................................................................
d1qo7a_ ............................................................................................
d1qoza_ saskiksycdaadpycctgndpnvhqgygqeygqqalafinsqls...............................................
d1qtra_ ............................................................................................
d1r1da_ ............................................................................................
d1r3da_ ............................................................................................
d1tcaa_ knvqaqavcgplfvidhagsltsqfsyvvgrsalrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmp
d1thga_ lfrsgryakvpyisgnqedegtafapvalnatttphvkkwlqyifydaseasidrvlslypqtlsvgspfrtgilnaltpqfkrvaailsdm
d1thta_ ............................................................................................
d1tiba_ gtlvpvtrndivkiegidatggnnqpnipdipahlwyfgligtcl...............................................
d1ufoa_ ............................................................................................
d1ukca_ kvpvlvgddtdegsnfaynasssadvsrffknnypnltsqqlneinqvyprgkllprhaayfgassaaygdatftcpgnhvassaarylpns
d1uwca_ wsvdpysaqntfvctgdevqcceaqggqgvndahttyfgmtsgactwv............................................
d1uxoa_ ............................................................................................
d1vkha_ ............................................................................................
d1wht.1 ............................................................................................
d1wpxa1 ............................................................................................
d1xfda2 ............................................................................................
d1xkta_ arsfyyklraaeqytpkakyygnvmllraktggaygedlgadynlsqvcdgkvsvhviegdhrtllegsglesiisiihssla.........
d1zoib_ ............................................................................................
d2b20a2 lmqglidlwqplfh..............................................................................
d2b61a1 ............................................................................................
d2bcea_ advdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrgaqatyevytepwaqdssqetrkktmvdletdilfliptki
d2cbga_ mvlqkwqdaaeegyaeytgygahkdmlegefaeknaniilnildki..............................................
d2d81a1 ttgylyvpqscasgatvcslhvalhgclqsyssigsrfiqntgynkwadtnnmiilypqaipdytihaiwnggvlsnpngcwdwvgwygsna
d2dsta1 ............................................................................................
d2fuka1 ............................................................................................
d2gzsa1 wdfpnlghgpmfnasfrqalldisge..................................................................
d2h1ia1 ............................................................................................
d2hu7a2 ............................................................................................
d2i3da1 ............................................................................................
d2jbwa1 ............................................................................................
d2ocka_ ............................................................................................
d2ogsa_ drinrevgpvpeeairyyketaepsaptwqtwlrimtyrvfvegmlrtadaqaaqgadvymyrfdyetpvfggqlkaahalelpfvfhnlhq
d2pbla1 ............................................................................................
d2psja_ ............................................................................................
d2r8ba1 ............................................................................................
d2rhwa1 ............................................................................................
d2vata1 ............................................................................................
d2vf2a_ ............................................................................................
d2xmza_ ............................................................................................
d2xt0a_ ............................................................................................
d2xuah_ ............................................................................................
d3ainb_ ............................................................................................
d3b5ea1 ............................................................................................
d3bdia1 ............................................................................................
d3be8b1 lnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfvdnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwvapav
d3cn7c_ ............................................................................................
d3d2ci_ ............................................................................................
d3dlta_ ............................................................................................
d3fcyc_ ............................................................................................
d3foba_ ............................................................................................
d3g7nb_ tvkcegqrdkscsagngmyavtpghiasfgvvmltagcgyl...................................................
d3grob_ nagqlvflategdhlqlseewfyahiipfl..............................................................
d3hzoa1 ............................................................................................
d3i1ia_ ............................................................................................
d3k6ka_ ............................................................................................
d3kxpb_ ............................................................................................
d3og9a_ ............................................................................................
d3qpda_ ............................................................................................
d3qvmb_ ............................................................................................
d3qyjb_ ............................................................................................
d3stvb_ ............................................................................................
d3u0va_ ............................................................................................
d3vvma_ ............................................................................................
d3wibb_ ............................................................................................
d3wj2a_ ............................................................................................
d4dnqa_ ............................................................................................
d4ehba_ ............................................................................................
d4ffwa2 ............................................................................................
d4hs9a_ vhyycfgsyiqeliagengnlldpthaamrvlntlftekqndglvgrcsmrlgklikddyaqdhfdmvnqvaglvsynenivaiytlhakyl
d4i3fa1 ............................................................................................
d4j7ab_ chaadcsfvdvipdvyfatvrdisafaysra.............................................................
d4jeia_ yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg................................
d4kafa1 ............................................................................................
d4ke6e_ ............................................................................................
d4l3wa_ kedpadvqictsnietkqcsnsivpftsiadhltyfginegscl................................................
d4lipd_ vtgatdtstiplvdpanaldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrganaedpvavirthanr
d4lyea_ ............................................................................................
d4mwsa_ ............................................................................................
d4nmwa_ ............................................................................................
d4nzzb_ ............................................................................................
d4pw0a_ ............................................................................................
d4q34a_ ............................................................................................
d4rncb_ ............................................................................................
d4uhca1 ............................................................................................
d4updb_ rpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqyfqdlyfynatkeqltafvntyptditagspfntgifnel
d4wy8a1 ............................................................................................
d4x00b_ ............................................................................................
d4xvcb1 ............................................................................................
d4zv9e1 ............................................................................................
d4zwna1 ............................................................................................
d5a62a_ ............................................................................................
d5ah0a1 systcatvpsiltsnelphviymtpllypfgrfigsytrneqgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmpll
d5dwda_ ............................................................................................
d5egna_ ............................................................................................
d5frda1 ............................................................................................
d5fv4a_ hpflttvvdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllwksypianipeeltpvatdkylggtd
d5h3ha_ ............................................................................................
d5hk8a_ ............................................................................................
d5jkja_ ............................................................................................
d5mifa_ qgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligykfkkalh....................................
d5n4fa1 ............................................................................................
d5syna_ ............................................................................................
d5uroa1 ............................................................................................
d5w15a1 ............................................................................................
d5w1ua_ kepfemartawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekriefaaklkqryypdsspsmennlgyvhmmsd
d5w8oa_ ............................................................................................
d5yhpa_ ............................................................................................
d6emia_ dfltdmpdtllelgqfkktqilvgvnkdegtaflvygapgfskdndsiitrkefqeglkvffpnvsefgkesilfhytdwededrpenyrda

d1a88a_ ............................................................................................
d1a8qa_ ............................................................................................
d1ac5a_ gieivlfngdkdlicnnkgvldtidnlkwggikgfsddavsfdwihkskstddseefsgyvkydrnltfvsvynashmvpfdkslvsrgivd
d1auoa_ ............................................................................................
d1b6ga_ ............................................................................................
d1brta_ ............................................................................................
d1bu8a2 ............................................................................................
d1c4xa_ ............................................................................................
d1cexa_ ............................................................................................
d1cv2a_ ............................................................................................
d1dina_ ............................................................................................
d1dwoa_ ............................................................................................
d1dx4a_ gyqnqqqigravgdhfftcptneyaqalaergasvhyyyfthrtstslwgewmgvlhgdeieyffgqplnnslqyrpverelgkrmlsavie
d1ehya_ ............................................................................................
d1ei9a_ ............................................................................................
d1ek1a2 ............................................................................................
d1evqa_ ............................................................................................
d1ex9a_ hanrlknasl..................................................................................
d1f0na_ ............................................................................................
d1fj2a_ ............................................................................................
d1gkla_ ............................................................................................
d1i6wa_ ............................................................................................
d1imja_ ............................................................................................
d1iupa_ ............................................................................................
d1ivya_ ............................................................................................
d1j1ia_ ............................................................................................
d1jfra_ ............................................................................................
d1ji3a_ vpydgtlkkgvwndmgtynvdhleiigvdpnpsfdirafylrlaeqlaslqp........................................
d1jjfa_ ............................................................................................
d1jkma_ ............................................................................................
d1jmkc_ ............................................................................................
d1ju3a2 ............................................................................................
d1k4ya_ ddpvkkkdlfldmladllfgvpsvnvarhhrdagaptymyeyryrpsfssdmrpktvigdhgdeifsvlgapflkegateeeiklskmvmky
d1k8qa_ ............................................................................................
d1l7aa_ ............................................................................................
d1lgya_ ............................................................................................
d1lnsa3 ............................................................................................
d1lzla_ ............................................................................................
d1m33a_ ............................................................................................
d1mnaa_ ............................................................................................
d1mpxa2 ............................................................................................
d1mtza_ ............................................................................................
d1n1ma2 ............................................................................................
d1p0ia_ algdvvgdynficpaleftkkfsewgnnaffyyfehrssklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygn
d1pjaa_ ............................................................................................
d1pv1a_ ............................................................................................
d1q0ra_ ............................................................................................
d1qe3a_ nkafhalelpfvfgnldglermakaeitdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrqklf..
d1qfma2 ............................................................................................
d1qlwa_ ............................................................................................
d1qo7a_ ............................................................................................
d1qoza_ ............................................................................................
d1qtra_ ............................................................................................
d1r1da_ ............................................................................................
d1r3da_ ............................................................................................
d1tcaa_ yarpfavgkrtcsgivtp..........................................................................
d1thga_ lfqsprrvmlsatkdvnrwtylsthlhnlvpflgtfhgnelifqfnvnigpansylryfisfanhhdpnvgtnllqwdqytdegkemleihm
d1thta_ ............................................................................................
d1tiba_ ............................................................................................
d1ufoa_ ............................................................................................
d1ukca_ vwnyrvniidesniaggigvphtfelpaifgagstgtlssdssyltynaaiipvtmhyfisfvqtlnpntyryatapewntwgngqrlrlqt
d1uwca_ ............................................................................................
d1uxoa_ ............................................................................................
d1vkha_ ............................................................................................
d1wht.1 ............................................................................................
d1wpxa1 ............................................................................................
d1xfda2 ............................................................................................
d1xkta_ ............................................................................................
d1zoib_ ............................................................................................
d2b20a2 ............................................................................................
d2b61a1 ............................................................................................
d2bcea_ avaqhkshaksantytylfsqpsrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntghstvpanwdpy
d2cbga_ ............................................................................................
d2d81a1 dqiggvqmaaivgqvkqivsgfq.....................................................................
d2dsta1 ............................................................................................
d2fuka1 ............................................................................................
d2gzsa1 ............................................................................................
d2h1ia1 ............................................................................................
d2hu7a2 ............................................................................................
d2i3da1 ............................................................................................
d2jbwa1 ............................................................................................
d2ocka_ ............................................................................................
d2ogsa_ pgvanfvgnrpereaianemhyawlsfartgdpngahlpeawpaytnerkaafvfsaashveddpfgreraawq..................
d2pbla1 ............................................................................................
d2psja_ ............................................................................................
d2r8ba1 ............................................................................................
d2rhwa1 ............................................................................................
d2vata1 ............................................................................................
d2vf2a_ ............................................................................................
d2xmza_ ............................................................................................
d2xt0a_ ............................................................................................
d2xuah_ ............................................................................................
d3ainb_ ............................................................................................
d3b5ea1 ............................................................................................
d3bdia1 ............................................................................................
d3be8b1 atadlhaqygsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavvmtywtnfaktgdpnqpvpqdtkf
d3cn7c_ ............................................................................................
d3d2ci_ ............................................................................................
d3dlta_ ............................................................................................
d3fcyc_ ............................................................................................
d3foba_ ............................................................................................
d3g7nb_ ............................................................................................
d3grob_ ............................................................................................
d3hzoa1 ............................................................................................
d3i1ia_ ............................................................................................
d3k6ka_ ............................................................................................
d3kxpb_ ............................................................................................
d3og9a_ ............................................................................................
d3qpda_ ............................................................................................
d3qvmb_ ............................................................................................
d3qyjb_ ............................................................................................
d3stvb_ ............................................................................................
d3u0va_ ............................................................................................
d3vvma_ ............................................................................................
d3wibb_ ............................................................................................
d3wj2a_ ............................................................................................
d4dnqa_ ............................................................................................
d4ehba_ ............................................................................................
d4ffwa2 ............................................................................................
d4hs9a_ askql.......................................................................................
d4i3fa1 ............................................................................................
d4j7ab_ ............................................................................................
d4jeia_ ............................................................................................
d4kafa1 ............................................................................................
d4ke6e_ ............................................................................................
d4l3wa_ ............................................................................................
d4lipd_ lklagv......................................................................................
d4lyea_ ............................................................................................
d4mwsa_ ............................................................................................
d4nmwa_ ............................................................................................
d4nzzb_ ............................................................................................
d4pw0a_ ............................................................................................
d4q34a_ ............................................................................................
d4rncb_ ............................................................................................
d4uhca1 ............................................................................................
d4updb_ ypgfkrlaailgdmtftlarraflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinfvttgdpnkgaa
d4wy8a1 ............................................................................................
d4x00b_ ............................................................................................
d4xvcb1 ............................................................................................
d4zv9e1 ............................................................................................
d4zwna1 ............................................................................................
d5a62a_ ............................................................................................
d5ah0a1 dtidhmdacgigtnaltlswykglaeklsqlti...........................................................
d5dwda_ ............................................................................................
d5egna_ ............................................................................................
d5frda1 ............................................................................................
d5fv4a_ dpvkkkdlfldlmgdvvfgvpsvtvarqhrdagaptymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfw
d5h3ha_ ............................................................................................
d5hk8a_ ............................................................................................
d5jkja_ ............................................................................................
d5mifa_ ............................................................................................
d5n4fa1 ............................................................................................
d5syna_ ............................................................................................
d5uroa1 ............................................................................................
d5w15a1 ............................................................................................
d5w1ua_ rvfwhglhrtilaraarsrartfvyricldsefynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvingd
d5w8oa_ ............................................................................................
d5yhpa_ ............................................................................................
d6emia_ laevvgdyfficpalefakkyaehgnnayfyyfehrssklpwpewmgvmhgyeiefvfglplerrlnytkeeeilsreimrrwanfakygnp

d1a88a_ ........................................................................................
d1a8qa_ ........................................................................................
d1ac5a_ iysndvmiidnngknvmitt....................................................................
d1auoa_ ........................................................................................
d1b6ga_ ........................................................................................
d1brta_ ........................................................................................
d1bu8a2 ........................................................................................
d1c4xa_ ........................................................................................
d1cexa_ ........................................................................................
d1cv2a_ ........................................................................................
d1dina_ ........................................................................................
d1dwoa_ ........................................................................................
d1dx4a_ faktgnpaqdgeewpnfskedpvyyifstddkieklargplaarcsfwndylpkvrsw..............................
d1ehya_ ........................................................................................
d1ei9a_ ........................................................................................
d1ek1a2 ........................................................................................
d1evqa_ ........................................................................................
d1ex9a_ ........................................................................................
d1f0na_ ........................................................................................
d1fj2a_ ........................................................................................
d1gkla_ ........................................................................................
d1i6wa_ ........................................................................................
d1imja_ ........................................................................................
d1iupa_ ........................................................................................
d1ivya_ ........................................................................................
d1j1ia_ ........................................................................................
d1jfra_ ........................................................................................
d1ji3a_ ........................................................................................
d1jjfa_ ........................................................................................
d1jkma_ ........................................................................................
d1jmkc_ ........................................................................................
d1ju3a2 ........................................................................................
d1k4ya_ wanfarngnpngeglpqwpaydykegylqigattqaaqklkdkevafwtelwakeaar..............................
d1k8qa_ ........................................................................................
d1l7aa_ ........................................................................................
d1lgya_ ........................................................................................
d1lnsa3 ........................................................................................
d1lzla_ ........................................................................................
d1m33a_ ........................................................................................
d1mnaa_ ........................................................................................
d1mpxa2 ........................................................................................
d1mtza_ ........................................................................................
d1n1ma2 ........................................................................................
d1p0ia_ pqetqnqstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv......................................
d1pjaa_ ........................................................................................
d1pv1a_ ........................................................................................
d1q0ra_ ........................................................................................
d1qe3a_ ........................................................................................
d1qfma2 ........................................................................................
d1qlwa_ ........................................................................................
d1qo7a_ ........................................................................................
d1qoza_ ........................................................................................
d1qtra_ ........................................................................................
d1r1da_ ........................................................................................
d1r3da_ ........................................................................................
d1tcaa_ ........................................................................................
d1thga_ tdnvmrtddyriegisnfetdvnlyg..............................................................
d1thta_ ........................................................................................
d1tiba_ ........................................................................................
d1ufoa_ ........................................................................................
d1ukca_ ndtameavpesslqdcafwksltvpmev............................................................
d1uwca_ ........................................................................................
d1uxoa_ ........................................................................................
d1vkha_ ........................................................................................
d1wht.1 ........................................................................................
d1wpxa1 ........................................................................................
d1xfda2 ........................................................................................
d1xkta_ ........................................................................................
d1zoib_ ........................................................................................
d2b20a2 ........................................................................................
d2b61a1 ........................................................................................
d2bcea_ tleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptvtsagasllppednsqaspvppadnsgaptepsagdsevaqmpvvigf
d2cbga_ ........................................................................................
d2d81a1 ........................................................................................
d2dsta1 ........................................................................................
d2fuka1 ........................................................................................
d2gzsa1 ........................................................................................
d2h1ia1 ........................................................................................
d2hu7a2 ........................................................................................
d2i3da1 ........................................................................................
d2jbwa1 ........................................................................................
d2ocka_ ........................................................................................
d2ogsa_ ........................................................................................
d2pbla1 ........................................................................................
d2psja_ ........................................................................................
d2r8ba1 ........................................................................................
d2rhwa1 ........................................................................................
d2vata1 ........................................................................................
d2vf2a_ ........................................................................................
d2xmza_ ........................................................................................
d2xt0a_ ........................................................................................
d2xuah_ ........................................................................................
d3ainb_ ........................................................................................
d3b5ea1 ........................................................................................
d3bdia1 ........................................................................................
d3be8b1 ihtkpnrfeevawsrynpkdqlylhiglkprvrdhyratkvafwlelvphl.....................................
d3cn7c_ ........................................................................................
d3d2ci_ ........................................................................................
d3dlta_ ........................................................................................
d3fcyc_ ........................................................................................
d3foba_ ........................................................................................
d3g7nb_ ........................................................................................
d3grob_ ........................................................................................
d3hzoa1 ........................................................................................
d3i1ia_ ........................................................................................
d3k6ka_ ........................................................................................
d3kxpb_ ........................................................................................
d3og9a_ ........................................................................................
d3qpda_ ........................................................................................
d3qvmb_ ........................................................................................
d3qyjb_ ........................................................................................
d3stvb_ ........................................................................................
d3u0va_ ........................................................................................
d3vvma_ ........................................................................................
d3wibb_ ........................................................................................
d3wj2a_ ........................................................................................
d4dnqa_ ........................................................................................
d4ehba_ ........................................................................................
d4ffwa2 ........................................................................................
d4hs9a_ ........................................................................................
d4i3fa1 ........................................................................................
d4j7ab_ ........................................................................................
d4jeia_ ........................................................................................
d4kafa1 ........................................................................................
d4ke6e_ ........................................................................................
d4l3wa_ ........................................................................................
d4lipd_ ........................................................................................
d4lyea_ ........................................................................................
d4mwsa_ ........................................................................................
d4nmwa_ ........................................................................................
d4nzzb_ ........................................................................................
d4pw0a_ ........................................................................................
d4q34a_ ........................................................................................
d4rncb_ ........................................................................................
d4uhca1 ........................................................................................
d4updb_ vdiqwpqwsakknilqiyatkavivadnfraksyeylynnwgifri..........................................
d4wy8a1 ........................................................................................
d4x00b_ ........................................................................................
d4xvcb1 ........................................................................................
d4zv9e1 ........................................................................................
d4zwna1 ........................................................................................
d5a62a_ ........................................................................................
d5ah0a1 ........................................................................................
d5dwda_ ........................................................................................
d5egna_ ........................................................................................
d5frda1 ........................................................................................
d5fv4a_ anfarsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk...................................
d5h3ha_ ........................................................................................
d5hk8a_ ........................................................................................
d5jkja_ ........................................................................................
d5mifa_ ........................................................................................
d5n4fa1 ........................................................................................
d5syna_ ........................................................................................
d5uroa1 ........................................................................................
d5w15a1 ........................................................................................
d5w1ua_ pncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf...............................
d5w8oa_ ........................................................................................
d5yhpa_ ........................................................................................
d6emia_ netqnnstqwpvfkpteqkyltlntessrimtklraqhcrfwnsffpkv.......................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045736 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma arthritidis 158L3-1
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Elusimicrobium minutum Pei191
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   syncytium symbiont of Diaphorina citri
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Candidatus Zinderia insecticola CARI
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Neorickettsia sennetsu str. Miyayama
NoYes   Neorickettsia risticii str. Illinois
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Ehrlichia chaffeensis str. Arkansas
NoYes   Ehrlichia canis str. Jake
NoYes   Ehrlichia ruminantium str. Gardel
NoYes   Anaplasma phagocytophilum HZ
NoYes   Anaplasma marginale str. Florida
NoYes   Anaplasma centrale str. Israel
NoYes   Orientia tsutsugamushi str. Boryong
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Candidatus Hodgkinia cicadicola Dsem
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1