SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Phosphofructokinase alignments

These alignments are sequences aligned to the 0047912 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                            10         20        30        40        50        60   
                                             |          |         |         |         |         |   
d1kzha_                ...........sl--FKQERQKYIPKLPNI.LKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESS
ENSP00000309438      ............k-----------------.----------------------------------------------
ENSP00000352842      ............k-----------------.----------------------------------------------
ENSP00000449426      ............k-----------------.----------------------------------------------
ENSP00000309438      .............-----------------.----------------------------------------------
ENSP00000352842      .............-----------------.----------------------------------------------
ENSP00000449426      .............-----------------.----------------------------------------------
ENSP00000269848      ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEATQLRGGSFENNWNIY-------KLLAHQKP
ENSP00000448177      ............g---NQAVRLPLMECVQV.TKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSP00000345771      ............g---NQAVRLPLMECVQV.TKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSP00000269848      .......klrasg-----------------.----------------------------------------------
ENSP00000370517      ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSP00000370465      ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSP00000370517      ..........gag-----------------.----------------------------------------------
ENSP00000345771      ............g-----------------.----------------------------------------------
ENSP00000448177      ............k-----------------.----------------------------------------------
ENSP00000370465      ...........al-----------------.----------------------------------------------
ENSP00000385880      .............-----------------.----------------------------------------------
ENSP00000387871      ............d-----------------.----------------------------------------------
ENSP00000446519      ............k-----------------.----------------------------------------------
ENSP00000408858      .............-----------------.----------------------------------------------
ENSP00000476311      .............-----------------.----------------------------------------------
ENSP00000446805      ............k-----------------.----------------------------------------------
ENSP00000449269      ............k-----------------.----------------------------------------------
ENSP00000450369      ............k-----------------.----------------------------------------------
ENSP00000448253      ............k-----------------.----------------------------------------------
ENSP00000370462      .............-----------------.----------------------------------------------
ENSP00000446829      ............g-----------------.----------------------------------------------
ENSP00000477128      .............-----------------.----------------------------------------------
ENSP00000449835      ............k-----------------.----------------------------------------------
ENSP00000446945      ............k-----------------.----------------------------------------------
ENSP00000450091      .............-----------------.----------------------------------------------
ENSP00000408858      ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSP00000448940      ............g-----------------.----------------------------------------------
ENSP00000448315      ............k-----------------.----------------------------------------------
ENSP00000447997      ............g-----------------.----------------------------------------------
ENSP00000448018      ............g-----------------.----------------------------------------------
ENSP00000449622      ............g-----------------.----------------------------------------------
ENSP00000410275      .............-----------------.----------------------------------------------
ENSPTRP00000056036   ............k-----------------.----------------------------------------------
ENSPTRP00000056036   .............-----------------.----------------------------------------------
ENSPTRP00000040215   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEATQLRGGSFENNWNIY-------KLLAHQKP
ENSPTRP00000003790   ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSPTRP00000040215   .............-----------------.----------------------------------------------
ENSPTRP00000003790   .............-----------------.----------------------------------------------
ENSGGOP00000019823   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEATQLRGGSFENNWNIY-------KLLAHQKP
ENSGGOP00000005577   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEATQLRGGSFENNWNIY-------KLLAHQKP
ENSGGOP00000006327   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSGGOP00000019823   .......klrasg-----------------.----------------------------------------------
ENSGGOP00000006327   ............g-----------------.----------------------------------------------
ENSGGOP00000005577   .............-----------------.----------------------------------------------
ENSGGOP00000028061   ............l-----------------.----------------------------------------------
ENSPPYP00000002366   ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSPPYP00000012821   .......klrasg-----------------.----------------------------------------------
ENSPPYP00000005085   ............l-----------------.TKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSPPYP00000005084   .............-----------------.----------------------------------------------
ENSPPYP00000002366   ............n-----------------.----------------------------------------------
ENSPPYP00000005085   .............-----------------.----------------------------------------------
ENSPPYP00000005084   ...amdekkfdel-----------------.-----------------KLRGRSFMNNWEVYKLLAH------VRPP
ENSPPYP00000012821   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEAIQLRGGSFENNWNIY-------KLLAHQKP
ENSNLEP00000021734   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSNLEP00000013514   ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSNLEP00000002654   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEAIQLRGGSFENNWNIY-------KLLAHQKP
ENSNLEP00000002654   .......klrasg-----------------.----------------------------------------------
ENSNLEP00000021734   ............k-----------------.----------------------------------------------
ENSNLEP00000013514   ..........gag-----------------.----------------------------------------------
hFl_ENSPANP00000012758 ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEAIQLRGGSFENNWNIY-------KLLAHQKP
hFl_ENSPANP00000007750 ............g---NQAVRLPLMECVQV.TKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
hFl_ENSPANP00000012758 .......klrasg-----------------.----------------------------------------------
hFl_ENSPANP00000019805 ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
hFl_ENSPANP00000019805 ..........gag-----------------.----------------------------------------------
hFl_ENSPANP00000007750 ............g-----------------.----------------------------------------------
ENSMMUP00000005582   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEAIQLRGGSFENNWNIY-------KLLAHQKP
ENSMMUP00000002742   ............g---NQAVRLPLMECVQV.TKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSMMUP00000002741   ............g---NQAVRLPLMECVQV.TKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSMMUP00000039868   ............g---NQAVRLPLMECVQV.TKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPP------
ENSMMUP00000005583   ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSMMUP00000006549   ............n--GNHAVRLPLMECVQM.TQDVQKAMDERRFQDAVRLRGRSFAGNLNTY---KRLAIKLPDDQ-
ENSMMUP00000039868   ............g-----------------.----------------------------------------------
ENSMMUP00000002741   ............k-----------------.----------------------------------------------
ENSMMUP00000006549   ..........gag-----------------.----------------------------------------------
ENSMMUP00000002742   ............k-----------------.----------------------------------------------
ENSMMUP00000005583   ............w-----------------.----------------------------------------------
ENSMMUP00000028989   .............-----------------.----------------------------------------------
ENSCJAP00000023021   ............g---NQSVRLPLMECVQM.TKEVQKAMDDKRFDEAIQLRGRSFENNWNIY-------KLLAHQKL
ENSCJAP00000023045   ............g-----------------.----------------------------------------------
ENSCJAP00000037952   ............g---NHAVRLPLMECVQM.TQDVQKAMDERRFQDAVQLRGKSFEGNLNTY---KRLAIKLPDDQ-
ENSCJAP00000037952   ..........gag-----------------.----------------------------------------------
ENSCJAP00000023025   ..........pkt-----------------.----------------------------------------------
ENSCJAP00000023021   .............-----------------.----------------------------------------------
ENSCJAP00000032497   .............-----------------.----------------------------------------------
ENSCJAP00000023045   .............-----------------.----------------------------------------------
ENSCJAP00000043656   .............-----------------.----------------------------------------------
ENSCJAP00000023045   ......ahvrppv-----------------.----------------------------------------------
ENSOGAP00000004926   ............g---NQAVRLPLMECVQV.TKDVTKAMEDKKFDEAMKLRGRSFMNNWEVYKLLAHVRPPV-----
ENSOGAP00000012192   ...........ag-----------------.----------------------------------------------
ENSOGAP00000012192   ............g---NHAVRLPLVECVQM.TQDVQKAMNEGRFKDAVQLRGRSFQNNLNTY---KRLAMKLPDDE-
ENSOGAP00000004926   ............k-----------------.----------------------------------------------
ENSOGAP00000018319   ............g---NQSVRLPLMECVQM.TKEVQKAMDNKRFDEAIQLRGRSFENNWNIY-------KLLAHQKL
ENSOGAP00000018319   .............-----------------.----------------------------------------------
ENSMICP00000005735   ..........nhp------VLLPLMECVQM.TQDVQKAMDEGRFQDAVRLRGRSFEGNLKTY---KSLAIKLPDDQ-
ENSMICP00000008274   ............g---NQAVRLPLMECVQV.TKDVTKAMEEKKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKTV-
ENSMICP00000008274   ........gigka-----------------.----------------------------------------------
ENSMICP00000005735   .............-----------------.----------------------------------------------
ENSRNOP00000013374   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVR------PP
ENSRNOP00000001625   ............g---NQSVRLPLMECVQV.TKDVQKAMDEKRFDEAIQLRGRSFENNWKIY-------KLLAHQKV
ENSRNOP00000023252   .......pkyleh-----------------.----------------------------------------------
ENSRNOP00000013374   ............k-----------------.----------------------------------------------
ENSRNOP00000001625   .........klrm-----------------.----------------------------------------------
ENSRNOP00000023252   ............g---NQAVRLPLMECVQM.TQDVQKAMDERRFDEAVKLRGRSFEGNLNTY-----KRLAIKEPDD
ENSMUSP00000020522   ............g---NQSVRLPLMECVQV.TKDVQKAMDEERFDEAIQLRGRSFENNWKIY-------KLLAHQKV
ENSMUSP00000059801   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVR------PP
ENSMUSP00000132803   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVR------PP
ENSMUSP00000021614   ............g---NQAVRLPLMECVQM.TQDVQKAMDERRFKEAVKLRGRRFEGNLNTY---KRLAIKLPDEKI
ENSMUSP00000117030   ........aypky-----------------.--------------------------------------------LE
ENSMUSP00000021614   ........aypky-----------------.--------------------------------------------LE
ENSMUSP00000117030   ............g---NQAVRLPLMECVQM.TQDVQKAMDERRFKEAVKLRGRRFEGNLNTY---KRLAIKLPDEKI
ENSMUSP00000020522   .........klrm-----------------.----------------------------------------------
ENSMUSP00000059801   ............k-----------------.----------------------------------------------
ENSMUSP00000132803   ............k-----------------.----------------------------------------------
ENSMUSP00000115313   .............-----------------.----------------------------------------------
ENSMUSP00000123662   .............-----------------.----------------------------------------------
ENSMUSP00000114439   .....siqrglvl-----------------.----------------------------------------------
ENSDORP00000006665   .........gagr-----------------.----------------------------------------------
ENSDORP00000006665   ............g---NQAVRLPLVECVQM.TQDVQKAMDERRFKDAVQLRGRSFEGNLKTY---KRLAIKLPDDQ-
ENSDORP00000000082   ............k-----------------.----------------------------------------------
ENSDORP00000006568   ............g---NQSVRLPLMECVQV.TKEVQKAMDDKRFDEAIQLRGRSFENNWNIY-------KLLAHQKI
ENSDORP00000000082   ...........xx----------------X.TKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLAHVR------PP
ENSDORP00000006568   .............-----------------.----------------------------------------------
ENSDORP00000000082   .............-----------------.----------------------------------------------
ENSSTOP00000022581   ............g---NQPVRLPLMECVQV.TKEVQKAMDDRRFDEAIQLRGRSFENNWNIY-------KLLAHQKL
ENSSTOP00000001736   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLAHVRPP------
ENSSTOP00000005651   ........pryle-----------------.----------------------------------------------
ENSSTOP00000022581   .........klrm-----------------.----------------------------------------------
ENSSTOP00000005651   ............n----QAVRLPLVECVQMkTQDVQKAMDERRFKDAVRLRGRSFEGNLNIY---KRLAIKLPDDQ-
ENSSTOP00000001736   .............-----------------.----------------------------------------------
HGL_H00000345771     ............g---NQAVRLPLMECVQV.TKDVTKAMDDKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPV-----
HGL_H00000384038     ............g---NQSVRLPLLGCVQV.TKDVQKAMDDKRFDEAIQLRGRSFENNWNIY-------KLLAHQKV
HGL_H00000345771     ............k-----------------.----------------------------------------------
HGL_H00000370517     .........lsga-----------------.----------------------------------------------
HGL_H00000370517     ............n--GNHAVRLPLMECVQM.TQDVQKAMDGGRFKDAVKLRGRSFEGNLKTY---KRLAIKLPDDQ-
HGL_H00000384038     .............-----------------.----------------------------------------------
HGL_H00000370517     ............x-----------------.----------------------------------------------
HGL_H00000370517     .............-----------------.----------------------------------------------
ENSCPOP00000020281   ............g---NQSVRLPLMECVQV.TKDVQKAMDDRRFEEAIQLRGRSFENNWNIY-------KLLAHQKV
ENSCPOP00000007508   ............g---NQAVRLPLMECVQV.TKDVTKAMDDKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPV-----
ENSCPOP00000001292   ............n--GNHAVRLPLMECVQM.TQDVQKAMDEGRFKDAVKLRGRSFEGNLRTY---KRLAIKLPDDQ-
ENSCPOP00000001292   ..........gag-----------------.----------------------------------------------
ENSCPOP00000007508   ............g-----------------.----------------------------------------------
ENSCPOP00000020281   .............-----------------.----------------------------------------------
ENSOCUP00000014991   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLAHIRPPAP----
ENSOCUP00000009500   ..........gag-----------------.----------------------------------------------
ENSOCUP00000026775   ..........gag-----------------.----------------------------------------------
ENSOCUP00000009500   ............g---NHAVRLPLVECVQM.TQEVQKAMDERRFKDAVQLRGRSFENNLNTY---KRLAIKLPDDK-
ENSOCUP00000014991   ............k-----------------.----------------------------------------------
ENSOCUP00000017314   .............-----------------.----------------------------------------------
ENSOCUP00000026775   .............-----------------.----------------------------------------------
ENSOCUP00000026775   ............g---NHAVRLPLVECVQM.TQEVQKAMDERRFKDAVQLRGRSFENNLNTY---KRLAIKLPDDK-
ENSOPRP00000013455   ............v--------LPLMECVQV.TKDVTKAMDEKKFDEAMKLRGRSFMNNWEVYKLLAHVRPP------
ENSOPRP00000002617   ..........gag-----------------.----------------------------------------------
ENSOPRP00000013455   ............g-----------------.----------------------------------------------
ENSOPRP00000001668   .............-----------------.----------------------------------------------
ENSOPRP00000001668   ...........xq-----------------.----------------------------------------------
ENSOPRP00000002617   ............g---NQAVRLPLMECVQM.TQDVQKAMDERRFKDAVQLRGRSFETNLNTY---KRLAIKLPDDQ-
ENSOPRP00000002617   ............v-----------------.----------------------------------------------
ENSTBEP00000004211   ............g-----------------.----------------------------------------------
ENSTBEP00000007887   ............g---NHAVRLPLMECVQM.TQDVQKAMDERRFKDAVQLRGRSFEGNLNTY---KRLAIKLPDDQ-
ENSTBEP00000014699   .............-----------------.----------------------------------------------
ENSTBEP00000004211   ............g---NQAVRLPLMECVQV.TKDVTKAMDEKKFDEAMKLRGRSFMNNWEVYKLLAHVR------PP
ENSTBEP00000014699   ............s-----------------.----------------------------------------------
ENSTBEP00000007887   ............x-----------------.----------------------------------------------
ENSTBEP00000014699   ........niykl-----------------.----------------------------------------LAHQKL
ENSSSCP00000022897   ........klrts-----------------.----------------------------------------------
ENSSSCP00000021675   ............k-----------------.----------------------------------------------
ENSSSCP00000022897   ............g---NQSVRLPLMECVQM.TKEVQKAMDEKRFDEAIQLRGRSFENNWNIY-------KLLAHQKI
ENSSSCP00000021675   ............g---NQAVRLPLMECVQV.TKDVTKAMNEKRFDEAMKLRGRSFMNNWEVYKLLAH------VRPP
ENSSSCP00000024482   .............-----------------.----------------------------------------------
ENSSSCP00000011907   .............-----------------.----------------------------------------------
ENSSSCP00000024482   ...........ls-----------PDVSVK.TQDVQKAMDEGRFKEAVKLRGRSFESNLNTY-----KRLAMKLPDS
ENSBTAP00000051545   ............g---NQSVRLPLMECVQM.TKEVQKAMDEKRFDEAIQLRGGSFENNWNIY-------KLLSHQKI
ENSBTAP00000000359   ............g---NQAVRLPLMECVQV.TKDVTRAMDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPK-----
ENSBTAP00000003472   ...........ag-----------------.----------------------------------------------
ENSBTAP00000003472   ............g---NQAVRLPLMECVQM.TQEVQKAMDERRFKDAVRLRGRSFENNLNTY-----KRLAIKLPDS
ENSBTAP00000000359   ............k-----------------.----------------------------------------------
ENSBTAP00000051545   ........rttga-----------------.----------------------------------------------
tfI_ENSOARP00000012730 ............g---NQSVRLPLMECVQL.TKEVQKAMDEKRFDEAIQLRGRSFENNWNIY-------KLLAHQKI
tfI_ENSOARP00000020732 ............g-----------------.----------------------------------------------
tfI_ENSOARP00000020732 ............g---NQAVRLPLMECVQV.TKDVTRAMDERRFDEAMKLRGRSFMNNWEVY--KLLAHVRPPKSKQ
tfI_ENSOARP00000012730 .............-----------------.----------------------------------------------
tfI_ENSOARP00000014794 ............g---NQAVRLPLMECVQM.TQEVQKAMDERRFKDAVQLRGRSFENNLNTY---KRLAIKLPDSEI
tfI_ENSOARP00000014794 ...........ag-----------------.----------------------------------------------
ENSVPAP00000011298   .............-----------------.----------------------------------------------
ENSVPAP00000011298   ............e-----------------.----------------------------------------------
ENSVPAP00000011298   .....ilahvrpp-----------------.----------------------------------------------
ENSTTRP00000014670   ............g---NQAVRLPLMECVQV.TKDVTKAMEEKRFDEALKLRGRSFMNNWEVYKLLAHVRPPV-----
ENSTTRP00000014670   wimtheehhaakt-----------------.----------------------------------------------
ENSTTRP00000013840   ............g---NQSVRLPLMECVQM.TKEVQKAMDEKRFEEAIQLRGRSFENNWNIY-------KLLAHQKI
ENSTTRP00000014340   ...........ag-----------------.----------------------------------------------
ENSTTRP00000013840   .............-----------------.----------------------------------------------
ENSTTRP00000014340   ............t-----------------.----------------------------------------------
ENSTTRP00000014340   ............g---NQAVRLPLMECVQM.TQEVQKAMDERRFKDAVQLRGRSFENNLNTY---K--RLAIKLPDS
ENSTTRP00000013840   ...........xl-----------------.----------------------------------------------
Mpf_ENSMPUP00000010015 ............g---NQSVRLPLMECVQV.TKEVQKAMDEKRFDEAIQLRGRSFENNWNIY-------KLLAHQKL
Mpf_ENSMPUP00000000438 ............g---NQAVRLPLMECVQV.TKDVTKAMNDRKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVT----
Mpf_ENSMPUP00000016124 .........sgag-----------------.----------------------------------------------
Mpf_ENSMPUP00000016124 ............g---NQAVRLPLVECVQM.TQDVQKAMDERRFKDAVQLRGRSFETNLNTY---KRLAIKLPDDQI
Mpf_ENSMPUP00000000438 ............k-----------------.----------------------------------------------
Mpf_ENSMPUP00000010015 .............-----------------.----------------------------------------------


                            70        80        90       100       110          120       130       
                             |         |         |         |         |            |         |       
d1kzha_                LSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLEN..D.KIELTESLINSYRNTGGFD
ENSP00000309438      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000352842      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000449426      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000309438      --------VAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000352842      --------VAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000449426      --------VAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000269848      PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSP00000448177      VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000345771      VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000269848      ----AGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI
ENSP00000370517      -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSP00000370465      -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSP00000370517      ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IAEADWESVSSILQVGGTI
ENSP00000345771      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000448177      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000370465      ------------------------------------------------------..-.--------------VGGTI
ENSP00000385880      --------------------MNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IAEADWESVSSILQVGGTI
ENSP00000387871      -------------------------------------GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSP00000446519      -------AIAVLTSGGDAQGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSP00000408858      ------------------------------------------------------..-.-------------------
ENSP00000476311      ------------------------------------------------------..-.-------------------
ENSP00000446805      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000449269      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000450369      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000448253      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000370462      ------------------------------------------------------..-.-------------------
ENSP00000446829      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000477128      --------------------MNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IAEADWESVSSILQVGGTI
ENSP00000449835      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000446945      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSP00000450091      ------------------------------------------------------..-.-------------------
ENSP00000408858      -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..-.-------------------
ENSP00000448940      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSM--------
ENSP00000448315      -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMML------
ENSP00000447997      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVS---------
ENSP00000448018      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATW-------------
ENSP00000449622      ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDG..-.-------------------
ENSP00000410275      ------------------------------------------------------..-.-------------------
ENSPTRP00000056036   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSPTRP00000056036   --------VAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSPTRP00000040215   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSPTRP00000003790   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSPTRP00000040215   -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI
ENSPTRP00000003790   --------------------MNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IAEADWESVSSILQVGGTI
ENSGGOP00000019823   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSGGOP00000005577   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSGGOP00000006327   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSGGOP00000019823   ----AGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI
ENSGGOP00000006327   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSGGOP00000005577   -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI
ENSGGOP00000028061   --------------------------------------------YNGYQGMVDGgsN.IAEADWESVSSILQVGGTI
ENSPPYP00000002366   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSPPYP00000012821   ----AGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIHEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTV
ENSPPYP00000005085   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSPPYP00000005084   -------------------GMNAAVRFEVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSPPYP00000002366   ------------------------------------------------------..-.IAEADWESVSSILXXGGTI
ENSPPYP00000005085   --------------------MNAAVRFEVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSPPYP00000005084   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSPPYP00000012821   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSNLEP00000021734   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSNLEP00000013514   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSNLEP00000002654   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWYNVAGWLGRGGSM
ENSNLEP00000002654   ----AGKAIGVLSSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI
ENSNLEP00000021734   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IKEATWESVSMMLQLGGTV
ENSNLEP00000013514   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IAEADWESVSSILQVGGTI
hFl_ENSPANP00000012758 PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQVVGWHNVAGWLGRGGSM
hFl_ENSPANP00000007750 VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
hFl_ENSPANP00000012758 ----AGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IQQANWLSVSNIIQLGGTI
hFl_ENSPANP00000019805 -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
hFl_ENSPANP00000019805 ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgaN.IAEADWESVSSILQVGGTI
hFl_ENSPANP00000007750 ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdN.IKEATWESVSMMLQLGGTV
ENSMMUP00000005582   PKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQVVGWHNVAGWLGRGGSM
ENSMMUP00000002742   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSMMUP00000002741   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSMMUP00000039868   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSMMUP00000005583   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSMMUP00000006549   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSMMUP00000039868   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdN.IKEATWESVSMMLQLGGTV
ENSMMUP00000002741   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdN.IKEATWESVSMMLQLGGTV
ENSMMUP00000006549   ------KAIGVLTSGGDAQGATVLGRGVEDCAGEG--GGGVYWRLGGGFGMISA..RcNLHLPGSISWCRLSQGGTI
ENSMMUP00000002742   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdN.IKEATWESVSMMLQLGGTV
ENSMMUP00000005583   ------------------------------------------------------..-.--------------SGGTI
ENSMMUP00000028989   --------------------MNAAVRSAVRVGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSCJAP00000023021   SKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSCJAP00000023045   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
ENSCJAP00000037952   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRMGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSCJAP00000037952   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEADWESVSSILQVGGTI
ENSCJAP00000023025   -----NCNVAVINVGAPAAGMNAAVRSAVRMGIAD--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSCJAP00000023021   -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTV
ENSCJAP00000032497   --------------------MNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSCJAP00000023045   ------------------------------------------------------..-.-------------------
ENSCJAP00000043656   ------------------------------------------------------..-.-------------------
ENSCJAP00000023045   -SKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSOGAP00000004926   -SKSALHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSOGAP00000012192   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgkN.IVEANWESVSNILQVGGTI
ENSOGAP00000012192   -IQKSNCNVAVINVGAPAAGMNAAVRAAVRVGIAD--GHRMLAVYDGFDGLAKG..Q.IKEIGWSDVGGWTGQGGSI
ENSOGAP00000004926   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGedH.IREATWESVSMMLQLGGTV
ENSOGAP00000018319   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSOGAP00000018319   -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQADWLSVSNIIQLGGTV
ENSMICP00000005735   -IPKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAN--GHRMLAIYDGFDGFAKG..Q.IKEIGWTDVGGWTGQGGSI
ENSMICP00000008274   -----SHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFQGLA-G..Q.IEEAGWSYVGGWTGQGGSK
ENSMICP00000008274   ---------IAVLYGGDAHGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
ENSMICP00000005735   -----------VLSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgtN.IAEADWESVSSILQVGGTI
ENSRNOP00000013374   VSKGGLHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSRNOP00000001625   SKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISE--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSRNOP00000023252   -LSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYT--GAKVYFIYEGYQGMVDGgsN.IVEAKWECVSSILQVGGTI
ENSRNOP00000013374   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgeH.IREATWESVSMMLQLGGTV
ENSRNOP00000001625   --SGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKPANWLSVSNIIQLGGTI
ENSRNOP00000023252   KIPKSNCNVAIINVGAPAAGMNAAVRSAVRVGIAE--GHKMFAIYDGFDGLANG..Q.XXEIGWGDVGGWTGQGGSI
ENSMUSP00000020522   SKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISE--GHTVYIVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSMUSP00000059801   VSKGGLHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSMUSP00000132803   VSKGGLHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSMUSP00000021614   --VKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMFAIYDGFEGFANG..Q.IKEIGWADVGGWTGQGGSI
ENSMUSP00000117030   HLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYT--GAKVYFIYEGYQGLVDGgsN.IVEAKWDCVSSILQVGGTI
ENSMUSP00000021614   HLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYT--GAKVYFIYEGYQGLVDGgsN.IVEAKWDCVSSILQVGGTI
ENSMUSP00000117030   --VKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMFAIYDGFEGFANG..Q.IKEIGWADVGGWTGQGGSI
ENSMUSP00000020522   --SGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKPANWLSVSNIIQLGGTI
ENSMUSP00000059801   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgeH.IREATWESVSMMLQLGGTV
ENSMUSP00000132803   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgeH.IREATWESVSMMLQLGGTV
ENSMUSP00000115313   --------------------MNAAVRAVVRMGIYT--GAKVYFIYEGYQGLVDGgsN.IVEAKWDCVSSILQVGGTI
ENSMUSP00000123662   ------------------------------------------------------..-.-------------------
ENSMUSP00000114439   ------------------------------------------------------..-.-------------------
ENSDORP00000006665   -------AIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IQEADWESVSSILQVGGTI
ENSDORP00000006665   -ITKSNCNVAIINVGAPAAGMNAAVRSAVRVGISD--GHKMFAIYDGFDGFAKG..Q.IKKIGWSDVGGWTGQGGSI
ENSDORP00000000082   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgeH.IREATWESVSMMLQLGGTV
ENSDORP00000006568   SKEKSSFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.XXXXXXXXXXXXXXXXXXX
ENSDORP00000000082   VSKGGLHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSDORP00000006568   --------------------MNAAVRAVTRMGIYV--GAKVL-IYEGYEGLVEGgeN.IKPANWLSVSNIIQLGGTI
ENSDORP00000000082   ------------------------------------------------------..-.-------------------
ENSSTOP00000022581   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISH--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSSTOP00000001736   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIALIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSSTOP00000005651   HLSGSGKAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEAKWESVSSILQVGGTI
ENSSTOP00000022581   --SGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKPANWLSVSNIIQLGGTV
ENSSTOP00000005651   -ITKSNCSVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMLAIYDGFDGFAKG..Q.IKEIGWSDVGGWTGQGGSI
ENSSTOP00000001736   --------------------MNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
HGL_H00000345771     -SKTGAFTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
HGL_H00000384038     SKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
HGL_H00000345771     -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
HGL_H00000370517     -----GKAIGVLTSGGGAR-MNAAVRAVVRMGIYT--GAKVYFIYEGYQGMVDGgsN.IVEADWESVSSILQVGGTI
HGL_H00000370517     -IPKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAE--GHKMFAVYDGFDGFAKG..H.IKEIGWADVGGWTGQGGSI
HGL_H00000384038     --------------------MNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKPATWLSVSNIIQLGGTV
HGL_H00000370517     ------------------------------------------------------..-.-------------------
HGL_H00000370517     ------------------------------------------------------..-.-------------------
ENSCPOP00000020281   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSCPOP00000007508   -SKSGSFTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSCPOP00000001292   -ITKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAE--GHKMFAIYDGFDGFAKG..H.IKEIGWTDVGGWTGQGGSI
ENSCPOP00000001292   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYT--GAKVYFIYEGYQGMVDGgaN.IVEADWESVSSILQVGGTI
ENSCPOP00000007508   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdN.IREATWESVSMMLQLGGTV
ENSCPOP00000020281   ------------------AGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKPATWLSVSNIIQLGGTI
ENSOCUP00000014991   --KSGSYTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSOCUP00000009500   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEANWESVSSILQVGGTI
ENSOCUP00000026775   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEANWESVSSILQVGGTI
ENSOCUP00000009500   -IQKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMFAVYDGFDGFAKG..Q.IKEIRWGDVGGWTGQGGSI
ENSOCUP00000014991   -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
ENSOCUP00000017314   -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IQPASWLSVSNIIQLGGTI
ENSOCUP00000026775   ------------------------------------------------------..-.-------------------
ENSOCUP00000026775   -IQKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMFAVYDGFDGFAKG..Q.IKEIRWGDVGGWTGQGGSI
ENSOPRP00000013455   VSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSOPRP00000002617   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEANWESVSSILQVGGTI
ENSOPRP00000013455   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
ENSOPRP00000001668   ----------------------------------------------GYEGLVEGgeN.IQQASWLSVSNIIQLGGTI
ENSOPRP00000001668   -------------------------------------GHTVYVVHDGFEGLVKG..Q.VQEVSWHDVAGWLGRGGSM
ENSOPRP00000002617   -IPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMFAVYDGFDGFAKG..Q.IKEIGWGDVGGWTGQGGSI
ENSOPRP00000002617   ------------------------------------------------------..-.-------------------
ENSTBEP00000004211   ------KAIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGv.D.NIREATQSVSMMLQLGGTV
ENSTBEP00000007887   -IPKSNCNVAVINVGAPAAGMNAAVRSAVVGIAD---GYKMLAIYDGFDGFAKG..Q.IKEIGWGDVGGWTGQGGSI
ENSTBEP00000014699   --------------------MNAAVRAVTRMGIYV--GAKVFLIYEXXXXXXXXxxX.XXXXXXXXXXXXXXXGGTV
ENSTBEP00000004211   VSKSGAHTIAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSTBEP00000014699   ------------------------------------------------------..-.-------------------
ENSTBEP00000007887   ------------------------------------------------------..-.-------------------
ENSTBEP00000014699   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQVVGWHDVAGWLGRGGSM
ENSSSCP00000022897   ---GAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLICEGYEGLVEGgeN.IKPANWLSVSNIIQLGGTV
ENSSSCP00000021675   -------AIAVLTSGGDAQVFQGSVKAVLRTNIHG--GLRIWHCHEGYQGLVDGgdN.IREATWESVSMMLQLGGTV
ENSSSCP00000022897   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSSSCP00000021675   VTKSGSYTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSSSCP00000024482   ------------------------------------------------------..-.---------------GGTI
ENSSSCP00000011907   -------------------GMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEADWESVSSILQVGGTI
ENSSSCP00000024482   QIPKTNCNVGVVNVGAPAAGMNAAVRAAVRVGISD--GHKMFAVYDGFEGFAKG..N.IKEIGWADVGGWTGQGGSI
ENSBTAP00000051545   SKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQ--GHTVYVVHDGFEGLAKN..Q.VQEVSWHDVAGWLGRGGSM
ENSBTAP00000000359   -SKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRMLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSBTAP00000003472   ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEADWESVSSILQVGGTI
ENSBTAP00000003472   EIPKSNCNVGVVNVGAPAAGMNAAVRAAVRVGISE--GHKMFAVYDGFEGFAKG..Q.IKEIGWGDVGGWTGQGGSI
ENSBTAP00000000359   -------AIAVLTSGGDAQGMNAAVRAVVRVGIYT--GARVFFVHEGYQGLVDGgdN.IREATWESVSMMLQLGGTV
ENSBTAP00000051545   -----GKAIGVLTSGGDAQGMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTV
tfI_ENSOARP00000012730 SKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQ--GHTVYVVHDGFEGLAKN..Q.VQEVSWHDVAGWLGRGGSM
tfI_ENSOARP00000020732 ------KAIAVLTSGGDAQGMNAAVRAVVRVGIYT--GARVFFVHEGYQGLVDGgdN.IREATWESVSMMLQLGGTV
tfI_ENSOARP00000020732 IWSNHIVACTRWPLGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
tfI_ENSOARP00000012730 -------------------GMNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IRQANWLSVSNIIQLGGTV
tfI_ENSOARP00000014794 PKVGDPAPILSPAS--GAAGMNAAVRAAVRVGISE--GHKMFAVYDGFEGFAKG..Q.IKEIGWGDVGGWTGQGGSI
tfI_ENSOARP00000014794 ------KAIGVRTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgsN.IVEANWESVSSILQVLVSI
ENSVPAP00000011298   ------------------------------------------------------..-.-------------------
ENSVPAP00000011298   ------------------------------------------------------..-.-------------------
ENSVPAP00000011298   LSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.-------------------
ENSTTRP00000014670   -SKSGSYTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
ENSTTRP00000014670   --LGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYT--GARVFFVHEXXXXXXXXxxX.XXXXXXXXXXXXXXXGGTV
ENSTTRP00000013840   SKEKTSFSLAILNVGAPAAGMNAAVRSAVRTGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVGWHDVAGWLGRGGSM
ENSTTRP00000014340   ------KAIGVLTSGGDAQXXXXXXXXXXXXXXXX--XXXXXXXXXGYQGMVDGgsN.IVEADWESVSSILQVGGTI
ENSTTRP00000013840   --------------------MNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IRPANWLSVSNIIQLGGTV
ENSTTRP00000014340   ------------------------------------------------------..-.-------------------
ENSTTRP00000014340   QIRKSNCNVGIVNVGAPAAGMNAAVRAAVRVGISD--GHKVFAVYDGFEGFAKG..Q.XXXXXXXXXXXXXXXXXXX
ENSTTRP00000013840   ------------------------------------------------------..-.-------------------
Mpf_ENSMPUP00000010015 SKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQ--GHTVYVVHDGFEGLAKG..Q.VQEVSWHDVAGWLGRGGSM
Mpf_ENSMPUP00000000438 KAPGSTHTVAVMNVGAPAAGMNAAVRSTVRIGLIQ--GNRVLVVHDGFEGLAKG..Q.IEEAGWSYVGGWTGQGGSK
Mpf_ENSMPUP00000016124 ------KAIGVLTSGGDAQGMNAAVRAVVRMGIYV--GAKVYFIYEGYQGMVDGgrN.IVEASWESVSSILQVGGTI
Mpf_ENSMPUP00000016124 --VKSNCNVAVINVGAPAAGMNAAVRSAVRVGIAD--GHKMLAIYDGFEGFAKG..Q.IKEIGWGDVGGWTGQGGSI
Mpf_ENSMPUP00000000438 -------AIAVLTSGGDAQGMNAAVRAVVRVGIFT--GARVFFVHEGYQGLVDGgdH.IREATWESVSMMLQLGGTV
Mpf_ENSMPUP00000010015 --------------------MNAAVRAVTRMGIYV--GAKVFLIYEGYEGLVEGgeN.IKQANWLSVSNIIQLGGTI


                       140                            150       160       170       180             
                         |                              |         |         |         |             
d1kzha_                IVSSGRTK.....................IETEEHYNKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFK......
ENSP00000309438      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSP00000352842      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSP00000449426      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSP00000309438      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000352842      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000449426      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000269848      LGTKRTLP.....................---KGQLESIVENIRIYGIHALLVVGGFEAYEGVLQLVEARG......
ENSP00000448177      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000345771      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000269848      IGSARCKA.....................FTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSP00000370517      LGTKRVLP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSP00000370465      LGTKRVLP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSP00000370517      IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSP00000345771      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSP00000448177      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSP00000370465      IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSP00000385880      IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSP00000387871      LGTKRVLP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYKSACDMAEARG......
ENSP00000446519      LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSP00000408858      --------.....................------------------------------------------......
ENSP00000476311      --------.....................------------------------------------------......
ENSP00000446805      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEW-......
ENSP00000449269      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEW-......
ENSP00000450369      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEW-......
ENSP00000448253      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSE--......
ENSP00000370462      --------.....................------------------------------------------......
ENSP00000446829      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDG-------------......
ENSP00000477128      IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEW-......
ENSP00000449835      IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIG----------------......
ENSP00000446945      IG------.....................------------------------------------------......
ENSP00000450091      --------.....................------------------------------------------......
ENSP00000408858      --------.....................------------------------------------------......
ENSP00000448940      --------.....................------------------------------------------......
ENSP00000448315      --------.....................------------------------------------------......
ENSP00000447997      --------.....................------------------------------------------......
ENSP00000448018      --------.....................------------------------------------------......
ENSP00000449622      --------.....................------------------------------------------......
ENSP00000410275      --------.....................------------------------------------------......
ENSPTRP00000056036   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSPTRP00000056036   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSPTRP00000040215   LGTKRTLP.....................---KGQLESIVENIRIYGIHALLVVGGFEAYEGVLQLVEARG......
ENSPTRP00000003790   LGTKRVLP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSPTRP00000040215   IGSARCKA.....................FTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSPTRP00000003790   IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANIFRKEWSglleel
ENSGGOP00000019823   LGTKRTLP.....................---KGQLESIVENVRIYGIHALLVVGGFEAYEGVLQLVEARG......
ENSGGOP00000005577   LGTKRTLP.....................---KGQLESIVENVRIYGIHALLVVGGFEAYEGVLQLVEARG......
ENSGGOP00000006327   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSGGOP00000019823   IGSARCKA.....................FTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSGGOP00000006327   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSGGOP00000005577   IGSARCKA.....................FTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSGGOP00000028061   IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSPPYP00000002366   LGTKRVLP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSPPYP00000012821   IGSARCKA.....................FTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSPPYP00000005085   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSPPYP00000005084   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSPPYP00000002366   IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSPPYP00000005085   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSPPYP00000005084   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSPPYP00000012821   LGTKRTLP.....................---KGQLESIVENIRIYGIHALLVVGGFEVLDGIAYMHEARG......
ENSNLEP00000021734   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSNLEP00000013514   LGTKRVLP.....................---GKYLDEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSNLEP00000002654   LGTKRTLP.....................---KGQLESIVENIRIHGIHALLVVGGFEAYEGVLQLVEARG......
ENSNLEP00000002654   IGSARCKA.....................-TTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSNLEP00000021734   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllidl
ENSNLEP00000013514   IGSARCQA.....................FRTREGRLKAARNLLQRGITNLCVIGGDGSLTGANIFRKEWSglleel
hFl_ENSPANP00000012758 LGTKRTLP.....................---KGQLESIVENIRVYGIHALLVVGGFEAYEGVLQLVEARG......
hFl_ENSPANP00000007750 LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
hFl_ENSPANP00000012758 IGSARCKA.....................FTTREGRRTAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
hFl_ENSPANP00000019805 LGTKRVLP.....................---GKYLEEIATQMRAHSINALLIIGGFEAYLGLLELSAARE......
hFl_ENSPANP00000019805 IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
hFl_ENSPANP00000007750 IGSARCKD.....................FREREGRLRAAYNLKAG------------------KITDEEA......
ENSMMUP00000005582   LGTKRTLP.....................---KGQLESIVENIRIYGIHALLVVGGFEAYEGVLQLVEARG......
ENSMMUP00000002742   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSMMUP00000002741   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSMMUP00000039868   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSMMUP00000005583   LGTKRILP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSMMUP00000006549   LGTKRILP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAARE......
ENSMMUP00000039868   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllgdl
ENSMMUP00000002741   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllgdl
ENSMMUP00000006549   IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSMMUP00000002742   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllgdl
ENSMMUP00000005583   IGSARCQA.....................FRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSMMUP00000028989   LGTKRILP.....................---GKYLEEIATQMRTHSINALLIIGGFEAYKSACDMAEARG......
ENSCJAP00000023021   LGTKRTLP.....................---KGHLESIVENIRTYGIHALLAVGGFEAYEGVLQLVEARG......
ENSCJAP00000023045   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSCJAP00000037952   LGTKRVLP.....................---GKYLEEIATQMRMHSINALLIIGGFEAYLGLLELSAARE......
ENSCJAP00000037952   IGSARCQA.....................FRTRDGRLKA-RNLVQRGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSCJAP00000023025   LGTKRVLP.....................---GKYLEEIATQMRMHSINALLIIGGFEAYLGLLELSAARE......
ENSCJAP00000023021   IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSCJAP00000032497   LGTKRTLP.....................---KGHLESIVENIRTYGIHALLAVGGFEAYEGVLQLVEARG......
ENSCJAP00000023045   --------.....................------------------------------------------......
ENSCJAP00000043656   --------.....................------------------------------------------......
ENSCJAP00000023045   LGTKS---.....................------------------------------------------......
ENSOGAP00000004926   LGTKRTLP.....................---KKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSOGAP00000012192   IGSARCKA.....................FRTREGRLKAAYNLTQVGITNLCVIGGDGSLTGANIFRKEWMelleel
ENSOGAP00000012192   LGTKRVLP.....................---GKFLDKIAEQMRSHSIHALLIIGGFEAYLGLLELSAARE......
ENSOGAP00000004926   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSOGAP00000018319   LGTKRTLP.....................---KGHMESIVENIRTYSIHALLVKSSFPAYEGVLQLVEARG......
ENSOGAP00000018319   IGSARCKA.....................FMTREGRLAAAYNLVQRGITNLCVIGGDGSLTGADIFRSEWGglletl
ENSMICP00000005735   LGTKRVLP.....................---GKNLGAIAEQMHNHNIHALLMIGGFEAYLGLLELSAARE......
ENSMICP00000008274   LGTKRTLP.....................---KKSFDQISANITKFNIQGLIIIGGFEAYTGGLELMEGRK......
ENSMICP00000008274   IGSARCKD.....................FRDREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSMICP00000005735   IGSARCKD.....................FLSREGRLKAAGNLVRLGITNLCVIGGDGSLTGANIFRKEWRgllqel
ENSRNOP00000013374   LGTKRTLP.....................---KKNLEQISANITKYNIQGLVIIGGFEAYTGGLELMEGRK......
ENSRNOP00000001625   LGTKRTLP.....................---KPHLEAIVENLRTYNIHALLVIGGFEAYEGVLQLVEARG......
ENSRNOP00000023252   IGSARCQA.....................FRSREGRLKAACNLVRLGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSRNOP00000013374   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllndl
ENSRNOP00000001625   IGSARCKA.....................FTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGANIFRNEWGslleel
ENSRNOP00000023252   LGTKRTLP.....................---GKYLEKIAEQMHSKNINALLIIGGFEAYLGLLELAAARN......
ENSMUSP00000020522   LGTKRTLP.....................---KPHLEAIVENLRTYNIHALLVIGGFEAYEGVLQLVEARG......
ENSMUSP00000059801   LGTKRTLP.....................---KKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSMUSP00000132803   LGTKRTLP.....................---KKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSMUSP00000021614   LGTKRTLP.....................---GKYLEKIAEQMHSHSINALLIIGGFEGYHGAIMLSEARN......
ENSMUSP00000117030   IGSARCKA.....................FRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSMUSP00000021614   IGSARCKA.....................FRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSMUSP00000117030   LGTKRTLP.....................---GKYLEKIAEQMHSHSINALLIIGGFEAYLGLLELAAARE......
ENSMUSP00000020522   IGSARCKA.....................FTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGANIFRNEWGslleel
ENSMUSP00000059801   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllndl
ENSMUSP00000132803   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllndl
ENSMUSP00000115313   IGSARCKA.....................FRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSMUSP00000123662   --------.....................-----------------------IIGGFEAYLGLLELAAARE......
ENSMUSP00000114439   --------.....................------------------------------------------......
ENSDORP00000006665   IGSARCQV.....................FRTREGRLKAACNLVRLGITNLCVIGGDGSLTGANLFRKEWSglleel
ENSDORP00000006665   LGTKRILP.....................---GKYLEQIAKQMKNHNINALLVIGGFEAYLGLLELAAARE......
ENSDORP00000000082   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllndl
ENSDORP00000006568   XXXXX---.....................TLPRAHLESIVENLRTYNIHALLVIGGFEAYEGVLQLVEARE......
ENSDORP00000000082   LGTKRTLP.....................---KKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSDORP00000006568   IGSARCKA.....................FTTREGRRAAAYNLLQHGITNLCVIGGDGSLTGANVFRSEWGslleel
ENSDORP00000000082   --------.....................------------------------------------------......
ENSSTOP00000022581   LGTKRTLP.....................---KAHLEAIVENLRTYNIHALLVIGGFEAYEGVLQLVEARG......
ENSSTOP00000001736   LGTKRTLP.....................---KKNFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSSTOP00000005651   IGSARCKA.....................FHTREGRLQAAANLVQWGITNLCVIGGDGSLTGANIFRKEWSellvel
ENSSTOP00000022581   IGSARCKA.....................FTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSSTOP00000005651   LGTKRVLP.....................---GKFLEEIAEQIRAHSINALLIIGGFEAYLGLLELSAARE......
ENSSTOP00000001736   IGSARCKD.....................FRDREGRLRAALNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
HGL_H00000345771     LGTKRTLP.....................---KKSLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
HGL_H00000384038     LGTKRTLP.....................---KAHMEAIVENLRTHNIHALLVIGGFEAYEGVLQLVEARG......
HGL_H00000345771     IGSARCKD.....................FREREGRLRAAHNLVKLGITNLCVIGGDGSLTGADTFRSEWSdllsdl
HGL_H00000370517     IGSARCKA.....................FRTREGRLKAALNLVQLGITNMCVIGGDGSLTGANIFQEEWSglleel
HGL_H00000370517     LGTKRTLP.....................---GKYLEQIAEQIHVHNINALLIIGGFEAYLGLLELSAARE......
HGL_H00000384038     IGSARCKA.....................FTTREGRRAAAFNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
HGL_H00000370517     --------.....................------------------------------------------......
HGL_H00000370517     --------.....................----------------------------DAFHSVFMMAQARD......
ENSCPOP00000020281   LGTKRTLP.....................---KGHMEAIVENLRAHNIHALLVIGGFEAYEGVLQLVEARG......
ENSCPOP00000007508   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSCPOP00000001292   LGTKRTLP.....................---GKYLEQIAEQIRVHNINALLIIGGFEAYLGLLELSAARE......
ENSCPOP00000001292   IGSARCKA.....................FRSREGRLKAALNLVQLGITNVCVIGGDGSLTGANIFREEWSglleel
ENSCPOP00000007508   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllndl
ENSCPOP00000020281   IGSARCQA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGglleel
ENSOCUP00000014991   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSOCUP00000009500   IGSARCKA.....................FRTREGRLKAACNLIHRGITNLCVIGGDGSLTGANIFRMEWSglleel
ENSOCUP00000026775   IGSARCKA.....................FRTREGRLKAACNLIHRGITNLCVIGGDGSLTGANIFRMEWSglleel
ENSOCUP00000009500   LGTKRILP.....................---GKYLEEIATQIRTHNINAILIIGGFEAYLGLLELSAARE......
ENSOCUP00000014991   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSOCUP00000017314   IGSARCKA.....................FTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSOCUP00000026775   --------.....................----------------------------DAYHSMLILGEART......
ENSOCUP00000026775   LGTKRILP.....................---GKYLEEIATQIRTHNINAILIIGGFEAYLGLLELSAARE......
ENSOPRP00000013455   LGTKRTLP.....................---RKSFEQISANITKFNIQGLIIIGGFEAYTGGLELMEGRK......
ENSOPRP00000002617   IGSARCKA.....................FRTREGRLKAASNLVHRGITNLCVIGGDGSLTGANIFRKEWSslleel
ENSOPRP00000013455   IGSARCKD.....................FREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSOPRP00000001668   IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSOPRP00000001668   LGTKXXXXxxxxxxxxxxxxxxxxxxxxxX----XX--------------------XXAYEGVLQLVEARG......
ENSOPRP00000002617   LGTKRILP.....................---GKYLDKIATQIRTHNINAVLIIGGFEAYLGLLELSAARE......
ENSOPRP00000002617   --------.....................------------------------------------------......
ENSTBEP00000004211   IGSARCKD.....................FRDREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSTBEP00000007887   LGTKRTLP.....................---GKNLEEIAAQMRAHNINALLIIGGFEAYLGLLELSAARE......
ENSTBEP00000014699   IGSARCKA.....................FTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGglleel
ENSTBEP00000004211   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSTBEP00000014699   --------.....................------------------------------------------......
ENSTBEP00000007887   --------.....................------------------------------------------......
ENSTBEP00000014699   LGTK----.....................------------------------------------------......
ENSSSCP00000022897   IGSARCKA.....................FTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGsllael
ENSSSCP00000021675   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWGdllndl
ENSSSCP00000022897   LGTKRTLP.....................---KAYLEKIVENIRTYNIHALLVIGGFEAYEGVLQLVEARG......
ENSSSCP00000021675   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSSSCP00000024482   IGSARCKD.....................FRSREGRLKAAANLIQLGITNLCVIGGDGSLTGANIFRREWSglleel
ENSSSCP00000011907   IGSARCKD.....................FRSREGRLKAAANLIQLGITNLCVIGGDGSLTGANIFRREWSglleel
ENSSSCP00000024482   LGTKRTLP.....................---GKYLEDIAAQMRAHRINALLIIGGFEAYLGLLELSAARE......
ENSBTAP00000051545   LGTKRTLP.....................---KGFMEKIVENIRLHNIHALLVIGGFEAYEGVLQLVEARG......
ENSBTAP00000000359   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSBTAP00000003472   IGSARCQD.....................FRTREGRLKAACNLVQLGITSLCVIGGDGSLTGAHIFQTEWSglleel
ENSBTAP00000003472   LGTKRTLP.....................---GKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQ......
ENSBTAP00000000359   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSBTAP00000051545   IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
tfI_ENSOARP00000012730 LGTKRTLP.....................---KGYMEQIVESIRLHNIHALLVIGGFEAYEGVLQLVEARG......
tfI_ENSOARP00000020732 IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWGdllsdl
tfI_ENSOARP00000020732 LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
tfI_ENSOARP00000012730 IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
tfI_ENSOARP00000014794 LGTKRILP.....................---GKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQ......
tfI_ENSOARP00000014794 IGFKQCEC.....................FLTNSPLRWQTCSGLHQLIPQVFVAGGAADLKAAIHWCKTWSsitskv
ENSVPAP00000011298   --------.....................------------------------------------------......
ENSVPAP00000011298   --------.....................------------------------------------------......
ENSVPAP00000011298   --------.....................------------------------------------------......
ENSTTRP00000014670   LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
ENSTTRP00000014670   IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
ENSTTRP00000013840   LGTKRTLPkgxxxxxxxxxxxxxxxxxxxX----XX--------------------XXAYEGVLQLVEARE......
ENSTTRP00000014340   IGSARCKD.....................FRSREGRLKAAHNLLQLGITNLCVIGGDGSLTGANIFRKEWSglleel
ENSTTRP00000013840   IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGslleel
ENSTTRP00000014340   --------.....................------------------------------------------......
ENSTTRP00000014340   XXXXX---.....................TLPGKYLEDIAAQMHTHGINALLIIGGFE-------------......
ENSTTRP00000013840   --------.....................------------------------------------------......
Mpf_ENSMPUP00000010015 LGTKRTLP.....................---KSYLEKIVENIRAHNIHALLVIGGFEAYEGVLQLVEARG......
Mpf_ENSMPUP00000000438 LGTKRTLP.....................---KKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRK......
Mpf_ENSMPUP00000016124 IGSARCKA.....................FRTREGRLKAAQNLVQRGITNLCVIGGDGSLTGANIFRKEWSglleel
Mpf_ENSMPUP00000016124 LGTKRTLP.....................---GKSLEDIAAQMRTHSINALLIIGGFEAYLGLLELSAARD......
Mpf_ENSMPUP00000000438 IGSARCKD.....................FREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSdllsdl
Mpf_ENSMPUP00000010015 IGSARCKA.....................FTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRNEWGslleel


                                                                                190        200      
                                                                                  |          |      
d1kzha_                .........................................................KNG.ENIQVIGVPKTIDADL
ENSP00000309438      ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSP00000352842      ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSP00000449426      ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSP00000309438      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000352842      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000449426      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000269848      .........................................................RYEeLCIVMCVIPATISNNV
ENSP00000448177      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000345771      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000269848      ..............................................vaegkisettaRTY.SHLNIAGLVGSIDNDF
ENSP00000370517      .........................................................KHEeFCVPMVMVPATVSNNV
ENSP00000370465      .........................................................KHEeFCVPMVMVPATVSNNV
ENSP00000370517      ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSP00000345771      ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSP00000448177      ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSP00000370465      ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSP00000385880      ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSP00000387871      .........................................................RHQeLCIPLCVVPATISNNV
ENSP00000446519      .........................................................QFDeLCIPFVVIPATVSNNV
ENSP00000408858      .........................................................---.----------------
ENSP00000476311      .........................................................---.----------------
ENSP00000446805      .........................................................---.----------------
ENSP00000449269      .........................................................---.----------------
ENSP00000450369      .........................................................---.----------------
ENSP00000448253      .........................................................---.----------------
ENSP00000370462      .........................................................---.----------------
ENSP00000446829      .........................................................---.----------------
ENSP00000477128      .........................................................---.----------------
ENSP00000449835      .........................................................---.----------------
ENSP00000446945      .........................................................---.----------------
ENSP00000450091      .........................................................---.---PFVVIPATVSNNV
ENSP00000408858      .........................................................---.----------------
ENSP00000448940      .........................................................---.----------------
ENSP00000448315      .........................................................---.----------------
ENSP00000447997      .........................................................---.----------------
ENSP00000448018      .........................................................---.----------------
ENSP00000449622      .........................................................---.----------------
ENSP00000410275      .........................................................---.----------------
ENSPTRP00000056036   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSPTRP00000056036   .........................................................QFDeLCIPFVVIPATVSNNV
ENSPTRP00000040215   .........................................................RYEeLCIVMCVIPATISNNV
ENSPTRP00000003790   .........................................................KHEeFCVPMVMVPATVSNNV
ENSPTRP00000040215   ..............................................vaegkisettaRTY.SHLNIAGLVGSIDNDF
ENSPTRP00000003790   ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSGGOP00000019823   .........................................................RYEeLCIVMCVIPATISNNV
ENSGGOP00000005577   .........................................................RYEeLCIVMCVIPATISNNV
ENSGGOP00000006327   .........................................................QFDeLCIPFVVIPATVSNNV
ENSGGOP00000019823   ..............................................vaegkisettaRTY.SHLNIAGLVGSIDNDF
ENSGGOP00000006327   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSGGOP00000005577   ..............................................vaegkisettaRTY.SHLNIAGLVGSIDNDF
ENSGGOP00000028061   ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSPPYP00000002366   .........................................................KHEeFCVPMVMVPATVSNNV
ENSPPYP00000012821   ..............................................vaegkisetmaRTY.SHLNIAGLVGSIDNDF
ENSPPYP00000005085   .........................................................QFDeLCIPFVVIPATVSNNV
ENSPPYP00000005084   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSPPYP00000002366   ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSPPYP00000005085   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSPPYP00000005084   .........................................................QFDeLCIPFVVIPATVSNNV
ENSPPYP00000012821   .........................................................TRE.CPCPSAGAVPGLCPRV
ENSNLEP00000021734   .........................................................QFDeLCIPFVVIPATVSNNV
ENSNLEP00000013514   .........................................................KHEeFCVPMVMVPATVSNNV
ENSNLEP00000002654   .........................................................RYEeLCIVMCVIPATISNNV
ENSNLEP00000002654   ..............................................vaegkisetaaRTY.SHLNIAGLVGSIDNDF
ENSNLEP00000021734   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSNLEP00000013514   .............................................arngqidneavqKYA.YSCVAWWVHRHIDNDF
hFl_ENSPANP00000012758 .........................................................RYEeLCIVMCVIPATISNNV
hFl_ENSPANP00000007750 .........................................................QFDeLCIPFVVIPATVSNNV
hFl_ENSPANP00000012758 ..............................................vaegkisettaQTY.SHLNIAGLVGSIDNDF
hFl_ENSPANP00000019805 .........................................................KHEeFCVPMVMVPATVSNNV
hFl_ENSPANP00000019805 ..............................................akngqidkeavQKY.AYLNVVGMVGSIDNDF
hFl_ENSPANP00000007750 .........................................................TKS.SYLNIVGLVGSIDNDF
ENSMMUP00000005582   .........................................................RYEeLCIVMCVIPATISNNV
ENSMMUP00000002742   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMMUP00000002741   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMMUP00000039868   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMMUP00000005583   .........................................................KHEeFCVPMVMVPATVSNNV
ENSMMUP00000006549   .........................................................KHEeFCVPMVMVPATVSNNV
ENSMMUP00000039868   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSMMUP00000002741   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSMMUP00000006549   ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSMMUP00000002742   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSMMUP00000005583   ..............................................arngqidkeavQKY.AYLNVVGMVGSIDNDF
ENSMMUP00000028989   .........................................................RHQeLCIPLCVVPATISNNV
ENSCJAP00000023021   .........................................................RYEeLCIVMCVIPATISNNV
ENSCJAP00000023045   ..............................................qkagkitdeeaTKS.SYLNIVGLVGSIDNDF
ENSCJAP00000037952   .........................................................KHEeFCVPMVMVPATVSNNV
ENSCJAP00000037952   ..............................................akngqiekeavQRY.AHLNVVGMVGSIDNDF
ENSCJAP00000023025   .........................................................KHEeFCVPMVMVPATVSNNV
ENSCJAP00000023021   ..............................................vaegkisestaRTY.SHLNIAGLVGSIDNDF
ENSCJAP00000032497   .........................................................RYEeLCIVMCVIPATISNNV
ENSCJAP00000023045   .........................................................---.----------------
ENSCJAP00000043656   .........................................................---.----------------
ENSCJAP00000023045   .........................................................---.----------------
ENSOGAP00000004926   .........................................................QFDeLCIPFVVIPATVSNNV
ENSOGAP00000012192   ..............................................vrngqieekamQKY.AHLNVVGMVGSIDNDF
ENSOGAP00000012192   .........................................................KHEeFCVPMVMVPATVSNNV
ENSOGAP00000004926   ..............................................qkagkitdeeaKKS.SYLNIVGLVGSIDNDF
ENSOGAP00000018319   .........................................................RYEeLCIVMCVIPATISNNV
ENSOGAP00000018319   ..............................................vgegkisettaQTY.SHLNIVGLVGSIDNDF
ENSMICP00000005735   .........................................................KHEeFCVPMVMVPATVSNNV
ENSMICP00000008274   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMICP00000008274   ..............................................qkagkitaeevTKS.SYLNIVGLVGSIDNDF
ENSMICP00000005735   aknxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxXX-.----------------
ENSRNOP00000013374   .........................................................QFDeLCIPFVVIPATVSNNV
ENSRNOP00000001625   .........................................................RYEeLCIVMCVIPATISNNV
ENSRNOP00000023252   ..............................................akngeidsdtvKKH.AYLNVVGMVGSIDNDF
ENSRNOP00000013374   ..............................................qkdgkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSRNOP00000001625   ..............................................vkegkisestaQNY.AHLSIAGLVGSIDNDF
ENSRNOP00000023252   .........................................................KHEaFCVPMVMVPATVSNNV
ENSMUSP00000020522   .........................................................RYEeLCIVMCVIPATISNNV
ENSMUSP00000059801   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMUSP00000132803   .........................................................QFDeLCIPFVVIPATVSNNV
ENSMUSP00000021614   .........................................................NHEeFCIPICVLPATISNDI
ENSMUSP00000117030   ..............................................arngdidndtvQKY.SYLNVVGMVGSIDNDF
ENSMUSP00000021614   ..............................................arngdidndtvQKY.SYLNVVGMVGSIDNDF
ENSMUSP00000117030   .........................................................KHEaFCVPMVMVPATVSNNV
ENSMUSP00000020522   ..............................................vkegkisestaQNY.AHLTIAGLVGSIDNDF
ENSMUSP00000059801   ..............................................qkdgkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSMUSP00000132803   ..............................................qkdgkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSMUSP00000115313   ..............................................arngdidndtvQKY.SYLNVVGMVGSIDNDF
ENSMUSP00000123662   .........................................................KHEaFCVPMVMVPATVSNNV
ENSMUSP00000114439   .........................................................---.----------------
ENSDORP00000006665   ..............................................aengeidneavQKY.AHLNVVGMVGSIDNDF
ENSDORP00000006665   .........................................................HYEeFCVPMVMVPATVSNNV
ENSDORP00000000082   ..............................................qksgkitaeeaSKS.SFLNIVGLVGSIDNDF
ENSDORP00000006568   .........................................................RYEeLCIVMCVIPATISNNV
ENSDORP00000000082   .........................................................LFDeLCIPFVVIPATVSNNV
ENSDORP00000006568   ..............................................vkegkisettaQTY.SHLNIAGLVGSIDNDF
ENSDORP00000000082   .........................................................---.----------------
ENSSTOP00000022581   .........................................................RYEeLCIVMCVIPATISNNV
ENSSTOP00000001736   .........................................................QFDeLCIPFVVIPATVSNNV
ENSSTOP00000005651   ..............................................akngkiseeavTKY.SYLNVVGMVGSIDNDF
ENSSTOP00000022581   ..............................................vgegkisehtaQTY.SHLNIAGLVGSIDNDF
ENSSTOP00000005651   .........................................................KYEeLCIPMVMVPATVSNNV
ENSSTOP00000001736   ..............................................qkagkitpeeaTKS.SYLNIVGLVGSIDNDF
HGL_H00000345771     .........................................................QFDeLCIPFVVIPATVSNNV
HGL_H00000384038     .........................................................RYEeLCIVMCVIPATISNNV
HGL_H00000345771     ..............................................qkagkitaeeaKKS.SFLNIVGLVGSIDNDF
HGL_H00000370517     ..............................................aqngkiseeavKMH.GYLNVVGMVGSIDNDF
HGL_H00000370517     .........................................................KHEeFCVPMVMVPATVSNNV
HGL_H00000384038     ..............................................vregrisetaaQTY.SHLNIAGLVGSID---
HGL_H00000370517     .........................................................---.----------------
HGL_H00000370517     .........................................................SHEeFCIPMCVLAATLSNNV
ENSCPOP00000020281   .........................................................RYEeLCIVMCVIPATISNNV
ENSCPOP00000007508   .........................................................QFDeLCIPFVVIPATVSNNV
ENSCPOP00000001292   .........................................................KHEeFCVPMVMVPATVSNNV
ENSCPOP00000001292   ..............................................aqngkiseeamKKH.GYLNVVGMVGSIDNDF
ENSCPOP00000007508   ..............................................qkagkitaeeaKKS.SFLNIVGLVGSIDNDF
ENSCPOP00000020281   ..............................................vregkisettaQTY.SHLNIAGLVGSIDNDF
ENSOCUP00000014991   .........................................................QFDeLCIPFVVIPATVSNNV
ENSOCUP00000009500   ..............................................aqdgkidneavQKY.AYLNVVGMVGSIDNDF
ENSOCUP00000026775   ..............................................aqdgkidneavQKY.AYLNVVGMVGSIDNDF
ENSOCUP00000009500   .........................................................KHEeFCVPMVMVPATVSNNV
ENSOCUP00000014991   ..............................................qkagkitaeeaTRS.SYLNIVGLVGSIDNDF
ENSOCUP00000017314   ..............................................vqegkisestaQTY.SHLNIAGLVGSIDNDF
ENSOCUP00000026775   .........................................................RHEeFCIPMCVVPATISNNV
ENSOCUP00000026775   .........................................................KHEeFCVPMVMVPATVSNNV
ENSOPRP00000013455   .........................................................QFDeLCIPFVVIPATVSNNV
ENSOPRP00000002617   ...............................ardxxxxxxxxxxxxxxxxxxxxxxxXXX.FC--------------
ENSOPRP00000013455   ..............................................qkagkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSOPRP00000001668   ..............................................vqegkisestaQTY.SHLNIAGLVGSIDNDF
ENSOPRP00000001668   .........................................................RYEeLCIVMCVVPATISNNV
ENSOPRP00000002617   .........................................................KYEeFCIPMVMVPATVSNNV
ENSOPRP00000002617   .........................................................---.----------------
ENSTBEP00000004211   ..............................................qkagkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSTBEP00000007887   .........................................................RHEeFCVPMVMVPATVSNNV
ENSTBEP00000014699   ...........................aregkiseattryshlialvliddfctdmiVDS.LHIMVID---------
ENSTBEP00000004211   .........................................................QYDeLCIPFVVIPATVSNNV
ENSTBEP00000014699   .........................................................---.----------------
ENSTBEP00000007887   .........................................................---.----------------
ENSTBEP00000014699   .........................................................---.----------------
ENSSSCP00000022897   ..............................................vsegrisestaQTY.SHLSIAGLVGSIDNDF
ENSSSCP00000021675   ..............................................qkagkitaeeaNKS.SYLNIVGLVGSIDNDF
ENSSSCP00000022897   .........................................................RYEeLCIVMCVIPATISNNV
ENSSSCP00000021675   .........................................................QYDeLCIPFVVIPATVSNNV
ENSSSCP00000024482   ..............................................akdgkidkeavQRH.GHLNVVGMVGSIDNDF
ENSSSCP00000011907   ..............................................akdgkidkeavQRH.GHLNVVGMVGSIDNDF
ENSSSCP00000024482   .........................................................KHEeFCVPMVMVPATVSNNV
ENSBTAP00000051545   .........................................................RYEeLCIVMCVIPATISNNV
ENSBTAP00000000359   .........................................................QYDeLCIPFVVIPATVSNNV
ENSBTAP00000003472   ..............................................ardgkisteqvQKH.GHLNVVGMVGSIDNDF
ENSBTAP00000003472   .........................................................KHEeFCVPMVMVPATVSNNV
ENSBTAP00000000359   ..............................................qksgkitaeeaTKS.SYLNIVGLVGSIDNDF
ENSBTAP00000051545   ..............................................vsegkisegtaQTY.SHLNIAGLVGSIDNDF
tfI_ENSOARP00000012730 .........................................................RYEeLCIVMCVIPATISNNV
tfI_ENSOARP00000020732 ..............................................qksgkitaeeaTKS.SYLNIVGLVGSIDNDF
tfI_ENSOARP00000020732 .........................................................QYDeLCIPFVVIPATVSNNV
tfI_ENSOARP00000012730 ..............................................vsegkisegtaQTY.SHLNIAGLVGSIDNDF
tfI_ENSOARP00000014794 .........................................................KHEeFCVPMVMVPATVSNNV
tfI_ENSOARP00000014794 ..............................................crtgkisaeqvQKH.GHLNVVGMVGSIDNDF
ENSVPAP00000011298   .........................................................---.----------------
ENSVPAP00000011298   .........................................................---.----------------
ENSVPAP00000011298   .........................................................---.----------------
ENSTTRP00000014670   .........................................................QYDeLCIPFVVIPATVSNNV
ENSTTRP00000014670   ..............................................qksgkitaeeaAKS.RYLNIVGLVGSIDNDF
ENSTTRP00000013840   .........................................................RYEeLCIVMCVIPATISNNV
ENSTTRP00000014340   ..............................................aregkinteevQKH.GYLNVVGMVGSIDNDF
ENSTTRP00000013840   ..............................................vsegkisqstaQTY.SHLSIAGLVGSIDNDF
ENSTTRP00000014340   .........................................................---.----------------
ENSTTRP00000014340   .........................................................---.----------------
ENSTTRP00000013840   .........................................................---.----------------
Mpf_ENSMPUP00000010015 .........................................................RYEeLCIVMCVVPATISNNV
Mpf_ENSMPUP00000000438 .........................................................QFDeLCIPFVVIPATVSNNV
Mpf_ENSMPUP00000016124 ..............................................aqngeidkeqvQKH.AYLNVVGMVGSIDNDF
Mpf_ENSMPUP00000016124 .........................................................RYEeLCVPMVMVPATVSNNV
Mpf_ENSMPUP00000000438 ..............................................qkagkitaeeaTKS.SYLNIVGLVGSIDNDF
Mpf_ENSMPUP00000010015 ..............................................vaagkisestaQTY.SHLSIAGLVGSIDNDF


                        210       220           230       240       250       260                   
                          |         |             |         |         |         |                   
d1kzha_                RNDHIEISFGFDSATKIYSEL....IGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKT............HPNI
ENSP00000309438      C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSP00000352842      C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSP00000449426      C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSP00000309438      P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSP00000352842      P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSP00000449426      P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSP00000269848      P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSP00000448177      P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSP00000345771      P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSP00000269848      C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSP00000370517      P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSP00000370465      P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSP00000370517      C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSP00000345771      C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSP00000448177      C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSP00000370465      C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSP00000385880      C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSP00000387871      P--GTEISLGSDTGLNAVVET....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GAD-
ENSP00000446519      P--GSDFSVGADTALNTICTT....CDRIKQSAAG--------------------------............----
ENSP00000408858      ---------------------....--------------------MGRHCGYLALVSALAC............GADW
ENSP00000476311      ---------------------....--------------------MGRHCGYLALVSALAC............GADW
ENSP00000446805      ---------------------....------------------------------------............----
ENSP00000449269      ---------------------....------------------------------------............----
ENSP00000450369      ---------------------....------------------------------------............----
ENSP00000448253      ---------------------....------------------------------------............----
ENSP00000370462      ---------------------....--------------------MGGYCGYLANMGGLAA............GADA
ENSP00000446829      ---------------------....------------------------------------............----
ENSP00000477128      ---------------------....------------------------------------............----
ENSP00000449835      ---------------------....------------------------------------............----
ENSP00000446945      ---------------------....------------------------------------............----
ENSP00000450091      P--GSDFSVGADTALNTICT-....------------------------------------............----
ENSP00000408858      ---------------------....------------------------------------............----
ENSP00000448940      ---------------------....------------------------------------............----
ENSP00000448315      ---------------------....------------------------------------............----
ENSP00000447997      ---------------------....------------------------------------............----
ENSP00000448018      ---------------------....------------------------------------............----
ENSP00000449622      ---------------------....------------------------------------............----
ENSP00000410275      ---------------------....------------------------------------............----
ENSPTRP00000056036   C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSPTRP00000056036   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSPTRP00000040215   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSPTRP00000003790   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSPTRP00000040215   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSPTRP00000003790   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSGGOP00000019823   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSGGOP00000005577   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSGGOP00000006327   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSGGOP00000019823   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSGGOP00000006327   C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSGGOP00000005577   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSGGOP00000028061   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSPPYP00000002366   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSPPYP00000012821   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSPPYP00000005085   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSPPYP00000005084   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSPPYP00000002366   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSPPYP00000005085   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSPPYP00000005084   P--GSDFSVGADTA-NTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLAM-AGLAA............GADA
ENSPPYP00000012821   P--GTPLPTHSQCVCRPLSTS....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSNLEP00000021734   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSNLEP00000013514   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSNLEP00000002654   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSNLEP00000002654   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSNLEP00000021734   C--GTDMTIGTDSALHRIMEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSNLEP00000013514   A---HDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
hFl_ENSPANP00000012758 P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
hFl_ENSPANP00000007750 P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
hFl_ENSPANP00000012758 C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
hFl_ENSPANP00000019805 P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
hFl_ENSPANP00000019805 C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
hFl_ENSPANP00000007750 C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMMUP00000005582   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSMMUP00000002742   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMMUP00000002741   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMMUP00000039868   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMMUP00000005583   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSMMUP00000006549   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSMMUP00000039868   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMMUP00000002741   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMMUP00000006549   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSMMUP00000002742   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMMUP00000005583   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSMMUP00000028989   P--GTEISLGADTSLNVIVQT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GAD-
ENSCJAP00000023021   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFVVETMGGYCGYLATVTGIAV............GADA
ENSCJAP00000023045   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSCJAP00000037952   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSCJAP00000037952   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSCJAP00000023025   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSCJAP00000023021   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSCJAP00000032497   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFVVETMGGYCGYLATVTGIAV............GADA
ENSCJAP00000023045   -------------ALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSCJAP00000043656   ---------------------....--------------------MGGYCGYLANMGGLAA............GADA
ENSCJAP00000023045   ---------------------....------------------------------------............----
ENSOGAP00000004926   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSOGAP00000012192   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSOGAP00000012192   P--GSDFSIGADTALNTVTDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSOGAP00000004926   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSOGAP00000018319   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSOGAP00000018319   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSMICP00000005735   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAA............GADA
ENSMICP00000008274   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMICP00000008274   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMICP00000005735   ---------------------....-----------HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSRNOP00000013374   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSRNOP00000001625   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSRNOP00000023252   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSRNOP00000013374   C--GTDMTIGTDSALHRIVEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSRNOP00000001625   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSRNOP00000023252   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSMUSP00000020522   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSMUSP00000059801   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMUSP00000132803   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSMUSP00000021614   P--GSDISIGCDTALNVIVET....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAA............GADA
ENSMUSP00000117030   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALTC............GADW
ENSMUSP00000021614   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALTC............GADW
ENSMUSP00000117030   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAA............GADA
ENSMUSP00000020522   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSMUSP00000059801   C--GTDMTIGTDSALHRIVEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMUSP00000132803   C--GTDMTIGTDSALHRIVEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSMUSP00000115313   C--GTDMTIGTDSALHRIIEV....VDAIMTTA----------------------------............----
ENSMUSP00000123662   P--GSDFSIGADTALNTITD-....------------------------------------............----
ENSMUSP00000114439   ---------------------....------------------------------------............----
ENSDORP00000006665   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSDORP00000006665   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAA............GADA
ENSDORP00000000082   C--GTDMTIGTDSALHRIVEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSDORP00000006568   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSDORP00000000082   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSDORP00000006568   C--GTDMTIGTDSALHRIMEV....IDAITTTAQX-XXXXXXXXXXXXXXXYLALVSALAS............GADW
ENSDORP00000000082   ---------------------....------------------------------------............----
ENSSTOP00000022581   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSSTOP00000001736   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSSTOP00000005651   C--GTDMTIGTDSALHRIMEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSSTOP00000022581   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSSTOP00000005651   P--GSDFSIGSDTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSSTOP00000001736   C--GTDMTIGTDSALHRIVEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
HGL_H00000345771     P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
HGL_H00000384038     P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGCCGYLATVAGIAV............GADA
HGL_H00000345771     C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
HGL_H00000370517     C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
HGL_H00000370517     P--GSDFSIGADTALNTITDA....FHSVFMMA----------------------------............----
HGL_H00000384038     ----TDMTIGTDSALHRIM--....------------------------------------............----
HGL_H00000370517     ---------------------....---------------FIIETMGGYCGYLANMGGLAA............GADA
HGL_H00000370517     P--GADFSIGCDTSLNVVVET....CDRIKQSASG--------------------------............----
ENSCPOP00000020281   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSCPOP00000007508   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSCPOP00000001292   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSCPOP00000001292   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSCPOP00000007508   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSCPOP00000020281   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSOCUP00000014991   P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSOCUP00000009500   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSOCUP00000026775   C--GTDMTIGTDSALHRIIEV....IDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSOCUP00000009500   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSOCUP00000014991   C--GTDMTIGTDSALHRITEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSOCUP00000017314   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSOCUP00000026775   P--GSDLSIGCDTGLNMVVET....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSOCUP00000026775   P--GSDFSIGADTALNTITDA....------------------------------------............----
ENSOPRP00000013455   P--GSDFSIGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSOPRP00000002617   ---GTDMTIGTDSALHRIIEV....VDAIMTTAQS----RDFVLVMGRHCGYLALVSALAC............GADW
ENSOPRP00000013455   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSOPRP00000001668   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSOPRP00000001668   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSOPRP00000002617   P--GSDFSIGADTALNTITD-....------------------------------------............----
ENSOPRP00000002617   ---------------------....------------------------------------............----
ENSTBEP00000004211   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSTBEP00000007887   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
ENSTBEP00000014699   ---------------------....----ITTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSTBEP00000004211   P--GSDFSIGADTALNTICTT....CNLI--------------------------------............----
ENSTBEP00000014699   ---------------------....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSTBEP00000007887   ---------------------....-----------HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSTBEP00000014699   ---------------------....------------------------------------............----
ENSSSCP00000022897   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
ENSSSCP00000021675   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTLCLEVMGRHCGYLALVTSLSC............GADW
ENSSSCP00000022897   P--GTDFSLGSDTAVNAAMEQscvrARDVEYTYKSKRRVV-----------NICVITAIQVirdsvdgitrgdRKHL
ENSSSCP00000021675   P--GSDFSVGADTALNTICMT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSSSCP00000024482   C--GTDMTIGTDSALHRIMEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSSSCP00000011907   C--GTDMTIGTDSALHRIMEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSSSCP00000024482   P--GSDFSIGADTALNTITD-....------------------------------------............----
ENSBTAP00000051545   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSBTAP00000000359   P--GSDFSVGADTALNTICMT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSBTAP00000003472   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSBTAP00000003472   P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAA............GADA
ENSBTAP00000000359   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSBTAP00000051545   C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
tfI_ENSOARP00000012730 P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
tfI_ENSOARP00000020732 C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
tfI_ENSOARP00000020732 P--GSDFSVGADTALNTICMT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
tfI_ENSOARP00000012730 C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW
tfI_ENSOARP00000014794 P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAA............GADA
tfI_ENSOARP00000014794 C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSVPAP00000011298   ---------------------....--------------------------YLALVTSLSC............GADW
ENSVPAP00000011298   ---------------------....------------------------------------............----
ENSVPAP00000011298   ---------------------....------------------------------------............----
ENSTTRP00000014670   P--GSDFSVGTDTALNTICMT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
ENSTTRP00000014670   C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
ENSTTRP00000013840   P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
ENSTTRP00000014340   C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
ENSTTRP00000013840   C--GTDMTIGTDSALHRIMEV....IDAITTTAQ---------------------------............----
ENSTTRP00000014340   ---------------------....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAA............GADA
ENSTTRP00000014340   ---------------------....------------------------------------............----
ENSTTRP00000013840   ---------------------....------------------------------------............----
Mpf_ENSMPUP00000010015 P--GTDFSLGSDTAVNAAMES....CDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAV............GADA
Mpf_ENSMPUP00000000438 P--GSDFSVGADTALNTICTT....CDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAA............GADA
Mpf_ENSMPUP00000016124 C--GTDMTIGTDSALHRIIEV....VDAIMTTAQS-HQRTFVLEVMGRHCGYLALVSALAC............GADW
Mpf_ENSMPUP00000016124 P--GSDFSIGADTALNTITDT....CDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAA............GADA
Mpf_ENSMPUP00000000438 C--GTDMTIGTDSALHRIIEI....VDAITTTAQS-HQRTFVLEVMGRHCGYLALVTSLSC............GADW
Mpf_ENSMPUP00000010015 C--GTDMTIGTDSALHRIMEV....IDAITTTAQS-HQRTFVLEVMGRHCGYLALVSALAS............GADW


                       270       280       290       300       310       320       330              
                         |         |         |         |         |         |         |              
d1kzha_                CIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEVKSLMLELCDIFD..............
ENSP00000309438      VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSP00000352842      VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSP00000449426      VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSP00000309438      AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000352842      AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000449426      AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000269848      AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSP00000448177      AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000345771      AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000269848      LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSP00000370517      AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSP00000370465      AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSP00000370517      VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSP00000345771      VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSP00000448177      VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSP00000370465      VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSP00000385880      VFLPESPPE------------------------------------------------------..............
ENSP00000387871      ---------------------------------------------------------------..............
ENSP00000446519      ---------------------------------------------------------------..............
ENSP00000408858      VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSP00000476311      VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSP00000446805      ---------------------------------------------------------------..............
ENSP00000449269      ---------------------------------------------------------------..............
ENSP00000450369      ---------------------------------------------------------------..............
ENSP00000448253      ---------------------------------------------------------------..............
ENSP00000370462      AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSP00000446829      ---------------------------------------------------------------..............
ENSP00000477128      ---------------------------------------------------------------..............
ENSP00000449835      ---------------------------------------------------------------..............
ENSP00000446945      ---------------------------------------------------------------..............
ENSP00000450091      --------------ANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSP00000408858      ---------------------------------------------------------------..............
ENSP00000448940      ---------------------------------------------------------------..............
ENSP00000448315      ---------------------------------------------------------------..............
ENSP00000447997      ---------------------------------------------------------------..............
ENSP00000448018      ---------------------------------------------------------------..............
ENSP00000449622      ---------------------------------------------------------------..............
ENSP00000410275      ---------------------------------------------------------------..............
ENSPTRP00000056036   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSPTRP00000056036   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSPTRP00000040215   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSPTRP00000003790   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSPTRP00000040215   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSPTRP00000003790   VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSGGOP00000019823   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSGGOP00000005577   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSGGOP00000006327   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSGGOP00000019823   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSGGOP00000006327   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSGGOP00000005577   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSGGOP00000028061   VFLPESPPE------------------------------------------------------..............
ENSPPYP00000002366   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSPPYP00000012821   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSPPYP00000005085   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSPPYP00000005084   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSPPYP00000002366   VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSPPYP00000005085   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSPPYP00000005084   AYIFSPSPF-----RD-LQANVEHLVQKMKTTVKRGLVL------------------------..............
ENSPPYP00000012821   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSNLEP00000021734   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSNLEP00000013514   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSNLEP00000002654   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSNLEP00000002654   LFIPEAPPE-----DGWENFMCERLGETRSLGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSNLEP00000021734   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSNLEP00000013514   VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
hFl_ENSPANP00000012758 AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
hFl_ENSPANP00000007750 AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
hFl_ENSPANP00000012758 LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
hFl_ENSPANP00000019805 AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
hFl_ENSPANP00000019805 VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
hFl_ENSPANP00000007750 VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSMMUP00000005582   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSMMUP00000002742   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMMUP00000002741   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMMUP00000039868   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMMUP00000005583   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSMMUP00000006549   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSMMUP00000039868   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSMMUP00000002741   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSMMUP00000006549   VFLPESPPE-----QGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSMMUP00000002742   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSMMUP00000005583   VFLPESPPE-----QGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSMMUP00000028989   ---------------------------------------------------------------..............
ENSCJAP00000023021   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSCJAP00000023045   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSCJAP00000037952   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSCJAP00000037952   VFLPESPPE-----EGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSCJAP00000023025   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSCJAP00000023021   LFIPESPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSCJAP00000032497   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSCJAP00000023045   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSCJAP00000043656   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSCJAP00000023045   ---------------------------------------------------------------..............
ENSOGAP00000004926   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSOGAP00000012192   VFLPESPPQ-----EGWEQLLCEKLSENRARKKRLNIIIVAEGAIDTKNNAI-----------..............
ENSOGAP00000012192   AYIFEEPFDIRDLQTNV-----EHLTEKMKTSIQRGLVL------------------------..............
ENSOGAP00000004926   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSOGAP00000018319   AYVFEDPFNIHDLKVNV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSOGAP00000018319   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............
ENSMICP00000005735   AYIFEEPFDIRDLQANV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSMICP00000008274   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMICP00000008274   VFIPECPPD-----DDWEEHLCRRLSETRIRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSMICP00000005735   VFLPESPPE-----ENWEDHLCTKLSENRARKKRLNIIIVAEGAIDRKNKPI-----------..............
ENSRNOP00000013374   AYIFEEPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSRNOP00000001625   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSRNOP00000023252   VFLPESPPE-----EGWEEEMCLKLSENRARKKRLNIIIVSEGAIDTQNKPI-----------..............
ENSRNOP00000013374   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSRNOP00000001625   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............
ENSRNOP00000023252   AYIFEEQFDIRDLQSNVMHLT-----E--KMKTARGLVL------------------------..............
ENSMUSP00000020522   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSMUSP00000059801   AYIFEEPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMUSP00000132803   AYIFEEPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSMUSP00000021614   AYIFEEPFDIGDLQSNVVHLT-----EKMKTSIQRGLVL------------------------..............
ENSMUSP00000117030   VFLPESPPE-----EDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPI-----------..............
ENSMUSP00000021614   VFLPESPPE-----EDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPI-----------..............
ENSMUSP00000117030   AYIFEEPFDIGDLQSNVVHLT-----EKMKTSIQRGLVL------------------------..............
ENSMUSP00000020522   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............
ENSMUSP00000059801   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSMUSP00000132803   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSMUSP00000115313   ---------------------------------------------------------------..............
ENSMUSP00000123662   ---------------------------------------------------------------..............
ENSMUSP00000114439   ---------------------------------------------------------------..............
ENSDORP00000006665   VFLPESPPE-----EGWEESMCVKLSENRARKKRLNIIIVAEGAIDRQNKPI-----------..............
ENSDORP00000006665   AYIYEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSDORP00000000082   VFIPECPPD-----DDWEEHLCRRLTETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSDORP00000006568   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSDORP00000000082   AYIFEEPFTI-----------------------------------------------------..............
ENSDORP00000006568   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSDORP00000000082   ---------------------------------------------------------------..............
ENSSTOP00000022581   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSSTOP00000001736   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSSTOP00000005651   VFLPESPPE-----EGWEENMCVKLSENRARKKRLNIIIVAEGAIDTQNQPI-----------..............
ENSSTOP00000022581   LFIPESPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
ENSSTOP00000005651   AYIFEEPFDIRDLQSNV-----EHLTEKMKTSIQRGLVL------------------------..............
ENSSTOP00000001736   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
HGL_H00000345771     AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
HGL_H00000384038     AYVFEDPFNIHDLQANV-----EHMTEKMKTDIQRGLVLRT-GADPGSQAPSPCLAHLS---Apqanvehmtekmkt
HGL_H00000345771     VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAVDKNGKPV-----------..............
HGL_H00000370517     VFLPESPPE-----EGWEENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
HGL_H00000370517     ---------------------------------------------------------------..............
HGL_H00000384038     --------------------------ETRSRGSRLNIIILAEGAIDRNGKPIS----------..............
HGL_H00000370517     AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
HGL_H00000370517     ---------------------------------------------------------------..............
ENSCPOP00000020281   AYVFEDPFNIHDLEANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSCPOP00000007508   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSCPOP00000001292   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSCPOP00000001292   VFLPESPPE-----EGWEENMCIKLSENRARKKRLNIIIVSEGAIDTQNKPI-----------..............
ENSCPOP00000007508   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSCPOP00000020281   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............
ENSOCUP00000014991   AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSOCUP00000009500   VFLPESPPE-----EGWEEQMCVKLSENRAQKKRLNIIIVAEGAIDTLNRPI-----------..............
ENSOCUP00000026775   VFLPESPPE-----EGWEEQMCVKLSENRAQKKRLNIIIVAEGAIDTLNRPI-----------..............
ENSOCUP00000009500   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSOCUP00000014991   VFIPECPPD-----DNWEDHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSOCUP00000017314   LFIPEAPPE-----DGWENFMCER---------------------------------------..............
ENSOCUP00000026775   AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
ENSOCUP00000026775   ---------------------------------------------------------------..............
ENSOPRP00000013455   AYIFEEPFTIRDLQANV-----DHLVQKMKTTVKRGLVL------------------------..............
ENSOPRP00000002617   VFLPESPPE-----EGWEESMCVKLSENRARKKRLNIIIVAEGAIDTQNRPI-----------..............
ENSOPRP00000013455   VFIPECPPE-----DDWEDHLCRRLSETRNRGSRLNIIIVAEGAIDRHGKPI-----------..............
ENSOPRP00000001668   LFIPEAPPE-----DGWENFMCERLGEXXXXXXXX----------------------------..............
ENSOPRP00000001668   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSOPRP00000002617   ---------------------------------------------------------------..............
ENSOPRP00000002617   ----------------------EHLTEKMKTTIQRGLVL------------------------..............
ENSTBEP00000004211   VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSTBEP00000007887   AYIFEEPFDIRDLQSNV-----EHLTEKMKTSIQRGLVL------------------------..............
ENSTBEP00000014699   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRQGKPI-----------..............
ENSTBEP00000004211   ---------------------------------------------------------------..............
ENSTBEP00000014699   AYVFEDPFNIHDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSTBEP00000007887   VFLPESPPE-----EGWEDSMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSTBEP00000014699   ---------------------------------------------------------------..............
ENSSSCP00000022897   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............
ENSSSCP00000021675   VFIPECPPD-----DAWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGQPI-----------..............
ENSSSCP00000022897   ILNGSFPISR-------VKANVEHMTEKMKTDIQRGLVL------------------------..............
ENSSSCP00000021675   AYIFEEPFT------------------------------------------------------..............
ENSSSCP00000024482   VFLPESPPE-----EGWQEDMCIKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSSSCP00000011907   VFLPESPPE-----EGWQEDMC-----------------------------------------..............
ENSSSCP00000024482   ---------------------------------------------------------------..............
ENSBTAP00000051545   AYVFEDPFNIQDLKANV-----EHMTEKMKTEIQRGLVL------------------------..............
ENSBTAP00000000359   AYIFEDPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSBTAP00000003472   VFLPESPPE-----EGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSBTAP00000003472   AYIFEEPFDIRDLQSNV-----EHLTEKMKTSIQRGLVL------------------------..............
ENSBTAP00000000359   VFIPECPPD-----DDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSBTAP00000051545   LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPI-----------..............
tfI_ENSOARP00000012730 AYVFEDPFNIQDLKANV-----EHMTEKMKTEIQRGLVL------------------------..............
tfI_ENSOARP00000020732 VFIPECPPD-----DDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKQGKPI-----------..............
tfI_ENSOARP00000020732 AYIFEEPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
tfI_ENSOARP00000012730 LFIPEAPPE-----DGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKSI-----------..............
tfI_ENSOARP00000014794 AYIFEEPFI-----RDL-QSNVEHLTEKMKTSIQRGLVL------------------------..............
tfI_ENSOARP00000014794 VFLPESPPE-----EGWQENMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
ENSVPAP00000011298   VFIPECPPD-----DDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPI-----------..............
ENSVPAP00000011298   -----------------------HLVQKMKTTVKRGLVL------------------------..............
ENSVPAP00000011298   ---------------------------------------------------------------..............
ENSTTRP00000014670   AYIFEEPFTIRDLQVNV-----EHLVQKMKTTVKRGLVL------------------------..............
ENSTTRP00000014670   VFIPECPPD-----DDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDRNGKPI-----------..............
ENSTTRP00000013840   AYVFEDPFNIQDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
ENSTTRP00000014340   VFLPESPPE-----EGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKAI-----------..............
ENSTTRP00000013840   ---------------------------------------------------------------..............
ENSTTRP00000014340   -YIFEEPFDIRDLQSNV-EHT-----EKMKTTIQRGLVL------------------------..............
ENSTTRP00000014340   ---------------------------------------------------------------..............
ENSTTRP00000013840   ---------------------------------------------------------------..............
Mpf_ENSMPUP00000010015 AYVFEDPFNIQDLKANV-----EHMTEKMKTDIQRGLVL------------------------..............
Mpf_ENSMPUP00000000438 AYIFEEPFTIRDLQANV-----EHLVQKMKTTVKRGLVL------------------------..............
Mpf_ENSMPUP00000016124 VFLPESPPE-----EGWQEDMCVKLSENRARKKRLNIIIVAEGAIDTQNKPI-----------..............
Mpf_ENSMPUP00000016124 AYIFEEPFDIRDLQSNV-----EHLTEKMKTTIQRGLVL------------------------..............
Mpf_ENSMPUP00000000438 VFIPECPPD-----DDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPI-----------..............
Mpf_ENSMPUP00000010015 LFIPEAPPE-----DGWEYLMCERLGETRSRGSRLNIIIIAEGAIDRHGKPI-----------..............


                                      340       350        360       370       380       390       4
                                        |         |          |         |         |         |        
d1kzha_                ........KNEGEFKGLNIEKMKEIFVAKLSDYMK.GVYLSLPLFIQFELIKSILERDPHGNFNVSRVPTEKLFIEM
ENSP00000309438      ........---------------------------.---------------------------------TSEDIKNL
ENSP00000352842      ........---------------------------.---------------------------------TSEDIKNL
ENSP00000449426      ........---------------------------.---------------------------------TSEDIKNL
ENSP00000309438      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000352842      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000449426      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000269848      ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSP00000448177      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000345771      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000269848      ........---------------------------.---------------------------------SSSYVKDL
ENSP00000370517      ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSP00000370465      ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSP00000370517      ........---------------------------.---------------------------------TSEKIKEL
ENSP00000345771      ........---------------------------.---------------------------------TSEDIKNL
ENSP00000448177      ........---------------------------.-----------------------------------------
ENSP00000370465      ........---------------------------.---------------------------------TSEKIKEL
ENSP00000385880      ........---------------------------.-----------------------------------------
ENSP00000387871      ........---------------------------.-----------------------------------------
ENSP00000446519      ........---------------------------.-----------------------------------------
ENSP00000408858      ........---------------------------.---------------------------------TSEKIKEL
ENSP00000476311      ........---------------------------.---------------------------------TSEKIKEL
ENSP00000446805      ........---------------------------.-----------------------------------------
ENSP00000449269      ........---------------------------.-----------------------------------------
ENSP00000450369      ........---------------------------.-----------------------------------------
ENSP00000448253      ........---------------------------.-----------------------------------------
ENSP00000370462      ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSP00000446829      ........---------------------------.-----------------------------------------
ENSP00000477128      ........---------------------------.-----------------------------------------
ENSP00000449835      ........---------------------------.-----------------------------------------
ENSP00000446945      ........---------------------------.-----------------------------------------
ENSP00000450091      ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSP00000408858      ........---------------------------.-----------------------------------------
ENSP00000448940      ........---------------------------.-----------------------------------------
ENSP00000448315      ........---------------------------.-----------------------------------------
ENSP00000447997      ........---------------------------.-----------------------------------------
ENSP00000448018      ........---------------------------.-----------------------------------------
ENSP00000449622      ........---------------------------.-----------------------------------------
ENSP00000410275      ........---------------------------.------------------------------------FIYQL
ENSPTRP00000056036   ........---------------------------.---------------------------------TSEDIKNL
ENSPTRP00000056036   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSPTRP00000040215   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSPTRP00000003790   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSPTRP00000040215   ........---------------------------.---------------------------------SSSYVKDL
ENSPTRP00000003790   ........---------------------------.---------------------------------TSEKIKEL
ENSGGOP00000019823   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSGGOP00000005577   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSGGOP00000006327   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSGGOP00000019823   ........---------------------------.---------------------------------SSSYVKDL
ENSGGOP00000006327   ........---------------------------.---------------------------------TSEDIKNL
ENSGGOP00000005577   ........---------------------------.---------------------------------SSSYVKDL
ENSGGOP00000028061   ........---------------------------.-----------------------------------------
ENSPPYP00000002366   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSPPYP00000012821   ........---------------------------.---------------------------------SSSYVKDL
ENSPPYP00000005085   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSPPYP00000005084   ........---------------------------.---------------------------------TSEDIKNL
ENSPPYP00000002366   ........---------------------------.---------------------------------TSEKIKEL
ENSPPYP00000005085   ........---------------------------.---------------------------------TSEDIKNL
ENSPPYP00000005084   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSPPYP00000012821   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSNLEP00000021734   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSNLEP00000013514   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSNLEP00000002654   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSNLEP00000002654   ........---------------------------.---------------------------------SSSYVKDL
ENSNLEP00000021734   ........---------------------------.---------------------------------TSEDIKNL
ENSNLEP00000013514   ........---------------------------.---------------------------------TSEKIKEL
hFl_ENSPANP00000012758 ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
hFl_ENSPANP00000007750 ........---------------------------.------------------------RNEKCNENYTTDFIFNL
hFl_ENSPANP00000012758 ........---------------------------.---------------------------------SSSYVKDL
hFl_ENSPANP00000019805 ........---------------------------.------------------------RNESCSENYTTDFIYQL
hFl_ENSPANP00000019805 ........---------------------------.---------------------------------TSEKIKEL
hFl_ENSPANP00000007750 ........---------------------------.---------------------------------TSEDIKNL
ENSMMUP00000005582   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSMMUP00000002742   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMMUP00000002741   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMMUP00000039868   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMMUP00000005583   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSMMUP00000006549   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSMMUP00000039868   ........---------------------------.---------------------------------TSEDIKNL
ENSMMUP00000002741   ........---------------------------.---------------------------------TSEDIKNL
ENSMMUP00000006549   ........---------------------------.---------------------------------TSEKIKEL
ENSMMUP00000002742   ........---------------------------.-----------------------------------------
ENSMMUP00000005583   ........---------------------------.---------------------------------TSEKIKEL
ENSMMUP00000028989   ........---------------------------.-----------------------------------------
ENSCJAP00000023021   ........---------------------------.------------------------RNEKCHDHYTTEFLYNL
ENSCJAP00000023045   ........---------------------------.---------------------------------TSEDIKNL
ENSCJAP00000037952   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSCJAP00000037952   ........---------------------------.---------------------------------TSEKIKDL
ENSCJAP00000023025   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSCJAP00000023021   ........---------------------------.---------------------------------LSSYVKDL
ENSCJAP00000032497   ........---------------------------.------------------------RNEKCHDHYTTEFLYNL
ENSCJAP00000023045   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSCJAP00000043656   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSCJAP00000023045   ........---------------------------.-----------------------------------------
ENSOGAP00000004926   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSOGAP00000012192   ........---------------------------.---------------------------------TSEKVKEL
ENSOGAP00000012192   ........---------------------------.------------------------RNENCCVNYTTDFIYQL
ENSOGAP00000004926   ........---------------------------.---------------------------------TSEDIKNL
ENSOGAP00000018319   ........---------------------------.------------------------RNEKCHDHYTTEFLYNL
ENSOGAP00000018319   ........---------------------------.---------------------------------SSGYVKDL
ENSMICP00000005735   ........---------------------------.------------------------RNESCSENYTTDFICQL
ENSMICP00000008274   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMICP00000008274   ........---------------------------.---------------------------------TSEDIKNL
ENSMICP00000005735   ........---------------------------.---------------------------------TSEEVKQL
ENSRNOP00000013374   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSRNOP00000001625   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSRNOP00000023252   ........---------------------------.---------------------------------TSEKIKEL
ENSRNOP00000013374   ........---------------------------.---------------------------------TSEDIKNL
ENSRNOP00000001625   ........---------------------------.---------------------------------SSSYVKDL
ENSRNOP00000023252   ........---------------------------.------------------------RNENCSVNYTTDFIYQL
ENSMUSP00000020522   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSMUSP00000059801   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMUSP00000132803   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSMUSP00000021614   ........---------------------------.------------------------RNESCSVNYTTDFIYQL
ENSMUSP00000117030   ........---------------------------.---------------------------------TSEKIKEL
ENSMUSP00000021614   ........---------------------------.---------------------------------TSEKIKEL
ENSMUSP00000117030   ........---------------------------.------------------------RNESCSVNYTTDFIYQL
ENSMUSP00000020522   ........---------------------------.---------------------------------SSSYVKDL
ENSMUSP00000059801   ........---------------------------.---------------------------------TSEDIKNL
ENSMUSP00000132803   ........---------------------------.---------------------------------TSEDIKNL
ENSMUSP00000115313   ........---------------------------.-----------------------------------------
ENSMUSP00000123662   ........---------------------------.-----------------------------------------
ENSMUSP00000114439   ........---------------------------.------------------------RNESCSVNYTTDFIYQL
ENSDORP00000006665   ........---------------------------.---------------------------------SSETIKDL
ENSDORP00000006665   ........---------------------------.-----------------------XXXXXXXXXXHTDFIYQL
ENSDORP00000000082   ........---------------------------.---------------------------------TSEDIKNL
ENSDORP00000006568   ........---------------------------.------------------------RNEKCHEHYTTEFLYHL
ENSDORP00000000082   ........---------------------------.-----------------------------------------
ENSDORP00000006568   ........---------------------------.---------------------------------SSSYVKDL
ENSDORP00000000082   ........---------------------------.-----------------------------------------
ENSSTOP00000022581   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSSTOP00000001736   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSSTOP00000005651   ........---------------------------.---------------------------------SSQKIKDL
ENSSTOP00000022581   ........---------------------------.---------------------------------SSSYVKDL
ENSSTOP00000005651   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSSTOP00000001736   ........---------------------------.---------------------------------TSEDIKNL
HGL_H00000345771     ........---------------------------.------------------------RNEKCNENYTTDFIFNL
HGL_H00000384038     diqrglvlRNEKCHEHYTTEFLYNLYSSEGKGANVeHMTEKMKTDIQRGLV--------LRNEKCHEHYTTEFLYNL
HGL_H00000345771     ........---------------------------.---------------------------------TSEDIRNL
HGL_H00000370517     ........---------------------------.---------------------------------TSEKIKEL
HGL_H00000370517     ........---------------------------.-----------------------------------------
HGL_H00000384038     ........---------------------------.---------------SSYVKDDVGGQESTARLSHEQLVVQR
HGL_H00000370517     ........---------------------------.------------------------RNESCSENYTTDFIYQL
HGL_H00000370517     ........---------------------------.-----------------------------------------
ENSCPOP00000020281   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSCPOP00000007508   ........---------------------------.------------------------RNEKCNDNYTTDFIFNL
ENSCPOP00000001292   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSCPOP00000001292   ........---------------------------.---------------------------------TSEKIKEL
ENSCPOP00000007508   ........---------------------------.---------------------------------TSEDIKNL
ENSCPOP00000020281   ........---------------------------.---------------------------------SSSYVKDL
ENSOCUP00000014991   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSOCUP00000009500   ........---------------------------.---------------------------------TSEKIKEL
ENSOCUP00000026775   ........---------------------------.---------------------------------TSEKIKEL
ENSOCUP00000009500   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSOCUP00000014991   ........---------------------------.---------------------------------TSEGVKDL
ENSOCUP00000017314   ........---------------------------.-----------------------------------------
ENSOCUP00000026775   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSOCUP00000026775   ........---------------------------.-----------------------------------------
ENSOPRP00000013455   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSOPRP00000002617   ........---------------------------.---------------------------------TSEKIKEL
ENSOPRP00000013455   ........---------------------------.---------------------------------TSEGVKDL
ENSOPRP00000001668   ........---------------------------.----------------XXXXXXXXXXXXXXXXXXXXYVKDL
ENSOPRP00000001668   ........---------------------------.------------------------RNEKCHDYYTTEFLYNL
ENSOPRP00000002617   ........---------------------------.-----------------------------------------
ENSOPRP00000002617   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSTBEP00000004211   ........---------------------------.---------------------------------TSEDIKNL
ENSTBEP00000007887   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSTBEP00000014699   ........---------------------------.---------------------------------SSSYVKDL
ENSTBEP00000004211   ........---------------------------.-----------------------------------------
ENSTBEP00000014699   ........---------------------------.------------------------RNEKCHEHYSTEFLYNL
ENSTBEP00000007887   ........---------------------------.-----------------------------------------
ENSTBEP00000014699   ........---------------------------.-----------------------------------------
ENSSSCP00000022897   ........---------------------------.---------------------------------TSRYVKDL
ENSSSCP00000021675   ........---------------------------.---------------------------------TSENIKDL
ENSSSCP00000022897   ........---------------------------.------------------------RNEKCHEYYTTEFLYNL
ENSSSCP00000021675   ........---------------------------.-----------------------------------------
ENSSSCP00000024482   ........---------------------------.---------------------------------TSEQIKEL
ENSSSCP00000011907   ........---------------------------.-----------------------------------------
ENSSSCP00000024482   ........---------------------------.-----------------------------------------
ENSBTAP00000051545   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSBTAP00000000359   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSBTAP00000003472   ........---------------------------.---------------------------------TSEQIKEL
ENSBTAP00000003472   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSBTAP00000000359   ........---------------------------.---------------------------------TSEDIKNL
ENSBTAP00000051545   ........---------------------------.---------------------------------SSRYVKDL
tfI_ENSOARP00000012730 ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
tfI_ENSOARP00000020732 ........---------------------------.---------------------------------TSEDIKNL
tfI_ENSOARP00000020732 ........---------------------------.------------------------RNEKCNENYTTDFIFNL
tfI_ENSOARP00000012730 ........---------------------------.---------------------------------SSRYVKDL
tfI_ENSOARP00000014794 ........---------------------------.------------------------RNESCSENYTTDFIYQL
tfI_ENSOARP00000014794 ........---------------------------.---------------------------------TSEQIKEL
ENSVPAP00000011298   ........---------------------------.---------------------------------TSEEIKNL
ENSVPAP00000011298   ........---------------------------.------------------------RNEKCNGNYTTDFIFNL
ENSVPAP00000011298   ........---------------------------.-----------------------------------------
ENSTTRP00000014670   ........---------------------------.------------------------RNEKCNENYTTDFIFNL
ENSTTRP00000014670   ........---------------------------.---------------------------------SSEDIKNL
ENSTTRP00000013840   ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
ENSTTRP00000014340   ........---------------------------.---------------------------------TSEQIKEL
ENSTTRP00000013840   ........---------------------------.-----------------------------------------
ENSTTRP00000014340   ........---------------------------.------------------------RNESCSENYTTDFIYQL
ENSTTRP00000014340   ........---------------------------.-----------------------------------------
ENSTTRP00000013840   ........---------------------------.-----------------------------------------
Mpf_ENSMPUP00000010015 ........---------------------------.------------------------RNEKCHEHYTTEFLYNL
Mpf_ENSMPUP00000000438 ........---------------------------.------------------------RNEKCNENYTTDFIFNL
Mpf_ENSMPUP00000016124 ........---------------------------.---------------------------------TSEQIKEL
Mpf_ENSMPUP00000016124 ........---------------------------.------------------------RNESCSENYTTDFIYQL
Mpf_ENSMPUP00000000438 ........---------------------------.---------------------------------TSEDIKNL
Mpf_ENSMPUP00000010015 ........---------------------------.---------------------------------SSRYVKDL


                       00       410       420                             430       440       450   
                        |         |         |                               |         |         |   
d1kzha_                IQSRLNDMKKRGEYKGSFTPVDHFFGYEGR......................SAFPSNFDSDYCYSLGYNAVVLIL.
ENSP00000309438      VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSP00000352842      VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSP00000449426      VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSP00000309438      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSP00000352842      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSP00000449426      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSP00000269848      YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSP00000448177      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSP00000345771      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSP00000269848      VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSP00000370517      YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSP00000370465      YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSP00000370517      VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSP00000345771      VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSP00000448177      ------------------------------......................----TSEDIKNGSRMGVEAVMALL.
ENSP00000370465      VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSP00000385880      ------------------------------......................------------------------.
ENSP00000387871      ------------------------------......................------------------------.
ENSP00000446519      ------------------------------......................------------------------.
ENSP00000408858      VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSP00000476311      VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIA--.
ENSP00000446805      ------------------------------......................------------------------.
ENSP00000449269      ------------------------------......................------------------------.
ENSP00000450369      ------------------------------......................------------------------.
ENSP00000448253      ------------------------------......................------------------------.
ENSP00000370462      YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSP00000446829      ------------------------------......................------------------------.
ENSP00000477128      ------------------------------......................------------------------.
ENSP00000449835      ------------------------------......................------------------------.
ENSP00000446945      ------------------------------......................------------------------.
ENSP00000450091      YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPF-----------------.
ENSP00000408858      ------------------------------......................------------------------.
ENSP00000448940      ------------------------------......................------------------------.
ENSP00000448315      ------------------------------......................------------------------.
ENSP00000447997      ------------------------------......................------------------------.
ENSP00000448018      ------------------------------......................------------------------.
ENSP00000449622      ------------------------------......................------------------------.
ENSP00000410275      YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSPTRP00000056036   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSPTRP00000056036   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSPTRP00000040215   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSPTRP00000003790   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSPTRP00000040215   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSPTRP00000003790   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSGGOP00000019823   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSGGOP00000005577   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSGGOP00000006327   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSGGOP00000019823   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSGGOP00000006327   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSGGOP00000005577   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSGGOP00000028061   ------------------------------......................------------------------.
ENSPPYP00000002366   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSPPYP00000012821   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMAMEAVMALL.
ENSPPYP00000005085   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAIEAMNWM.
ENSPPYP00000005084   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILVSHW-------AL.
ENSPPYP00000002366   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSPPYP00000005085   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRIL-------------.
ENSPPYP00000005084   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPF-RNFATKMGAIEAMNWM.
ENSPPYP00000012821   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSNLEP00000021734   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSNLEP00000013514   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSNLEP00000002654   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSNLEP00000002654   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSNLEP00000021734   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSNLEP00000013514   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
hFl_ENSPANP00000012758 YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
hFl_ENSPANP00000007750 YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
hFl_ENSPANP00000012758 VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
hFl_ENSPANP00000019805 YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
hFl_ENSPANP00000019805 VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
hFl_ENSPANP00000007750 VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMMUP00000005582   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWLS.
ENSMMUP00000002742   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMMUP00000002741   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMMUP00000039868   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMMUP00000005583   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSMMUP00000006549   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSMMUP00000039868   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMMUP00000002741   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMMUP00000006549   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSMMUP00000002742   ------------------------------......................----TSEDIKNGSRMGVEAVMALL.
ENSMMUP00000005583   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSMMUP00000028989   ------------------------------......................------------------------.
ENSCJAP00000023021   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWVS.
ENSCJAP00000023045   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSCJAP00000037952   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSCJAP00000037952   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSCJAP00000023025   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSCJAP00000023021   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSCJAP00000032497   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWVS.
ENSCJAP00000023045   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSCJAP00000043656   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSCJAP00000023045   ------------------------------......................------------------------.
ENSOGAP00000004926   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSOGAP00000012192   VVKQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSOGAP00000012192   YSEEGKGV---------FDCRKNVLGHMQQ......................GGTPSPFDRNFGTKISARAMEWLTl
ENSOGAP00000004926   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSOGAP00000018319   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSOGAP00000018319   VVQRL-----------GYDTRITVLGHVQR......................GGTPSAFDRVLSSKMGVEAVMALL.
ENSMICP00000005735   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSMICP00000008274   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMICP00000008274   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMICP00000005735   VVKQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVAAVIALL.
ENSRNOP00000013374   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSRNOP00000001625   YSSEGRGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSRNOP00000023252   VVTNL-----------GFDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVLALL.
ENSRNOP00000013374   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSRNOP00000001625   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSRNOP00000023252   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISAKAMEWIS.
ENSMUSP00000020522   YSSEGRGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWVS.
ENSMUSP00000059801   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMUSP00000132803   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSMUSP00000021614   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISAKAMEWIS.
ENSMUSP00000117030   VVKNL-----------GFDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSMUSP00000021614   VVKNL-----------GFDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSMUSP00000117030   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISAKAMEWIS.
ENSMUSP00000020522   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSMUSP00000059801   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMUSP00000132803   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSMUSP00000115313   ------------------------------......................------------------------.
ENSMUSP00000123662   ------------------------------......................------------------------.
ENSMUSP00000114439   YSEEGKGV---------FDCRKNVLGHMQQifiikrscdsslasemgwengsGGAPSPFDRNFGTKISAKAMEWIS.
ENSDORP00000006665   VVKQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSDORP00000006665   YSEEGKGV---------FDCRKNVLGHMQQ......................GGSPSPFDRNFGTKISARAMEWITv
ENSDORP00000000082   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRIL-------------.
ENSDORP00000006568   YSSEGRGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSDORP00000000082   ------------------------------......................------------------------.
ENSDORP00000006568   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
ENSDORP00000000082   ------------------------------......................GGSPTPFDRNFATKMGAKAMNWMF.
ENSSTOP00000022581   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSSTOP00000001736   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSSTOP00000005651   VVKQL-----------GFDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVVALL.
ENSSTOP00000022581   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGVEAVMALL.
ENSSTOP00000005651   YSEEGKGV---------FDCRKNVLGHMQQ......................GGVPSPFDRNFGTKISARAMQWIT.
ENSSTOP00000001736   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
HGL_H00000345771     YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
HGL_H00000384038     YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKALLWMS.
HGL_H00000345771     VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
HGL_H00000370517     VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
HGL_H00000370517     ------------------------------......................------------------------.
HGL_H00000384038     L---------------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
HGL_H00000370517     YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
HGL_H00000370517     ------------------------------......................------------------------.
ENSCPOP00000020281   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSCPOP00000007508   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSCPOP00000001292   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSCPOP00000001292   VVSQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSCPOP00000007508   VVTRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSCPOP00000020281   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGIEAVMALL.
ENSOCUP00000014991   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMA.
ENSOCUP00000009500   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVLALL.
ENSOCUP00000026775   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVLALL.
ENSOCUP00000009500   YSEEGRGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIT.
ENSOCUP00000014991   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSOCUP00000017314   ------------------------------......................------------------------.
ENSOCUP00000026775   YSEEGRGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIT.
ENSOCUP00000026775   ------------------------------......................------------------------.
ENSOPRP00000013455   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSOPRP00000002617   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVIALL.
ENSOPRP00000013455   VVKRL-----------GYDTRVTV-GHVQR......................GT----------------------.
ENSOPRP00000001668   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSOPRP00000001668   YSSEGG----------VFDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWVS.
ENSOPRP00000002617   ------------------------------......................------------------------.
ENSOPRP00000002617   YSEEGKGV---------FDCRKNVLGHMQQ......................XXXXXXXXXXXXXXISARAMRWIS.
ENSTBEP00000004211   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSTBEP00000007887   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMEWIT.
ENSTBEP00000014699   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSTBEP00000004211   ------------------------------......................------------------------.
ENSTBEP00000014699   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
ENSTBEP00000007887   ------------------------------......................------------------------.
ENSTBEP00000014699   ------------------------------......................------------------------.
ENSSSCP00000022897   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRVLSSKMGMEAVMALL.
ENSSSCP00000021675   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSSSCP00000022897   YSSEGRGI---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAILWMS.
ENSSSCP00000021675   ------------------------------......................------------------------.
ENSSSCP00000024482   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILGAE----------.
ENSSSCP00000011907   ------------------------------......................------------------------.
ENSSSCP00000024482   ------------------------------......................------------------------.
ENSBTAP00000051545   YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAIIWMS.
ENSBTAP00000000359   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSBTAP00000003472   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVVALL.
ENSBTAP00000003472   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIS.
ENSBTAP00000000359   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSBTAP00000051545   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
tfI_ENSOARP00000012730 YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAILWMS.
tfI_ENSOARP00000020732 VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
tfI_ENSOARP00000020732 YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
tfI_ENSOARP00000012730 VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
tfI_ENSOARP00000014794 YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIS.
tfI_ENSOARP00000014794 VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVVALL.
ENSVPAP00000011298   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGS-MGVEAVMALL.
ENSVPAP00000011298   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSVPAP00000011298   ------------------------------......................------------------------.
ENSTTRP00000014670   YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
ENSTTRP00000014670   VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
ENSTTRP00000013840   YSSEGKGI---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAILWMS.
ENSTTRP00000014340   VVTQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVVALA.
ENSTTRP00000013840   ------------------------------......................------------------------.
ENSTTRP00000014340   YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIS.
ENSTTRP00000014340   ------------------------------......................------------------------.
ENSTTRP00000013840   VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.
Mpf_ENSMPUP00000010015 YSSEGKGV---------FDCRTNVLGHLQQ......................GGAPTPFDRNYGTKLGVKAMLWMS.
Mpf_ENSMPUP00000000438 YSEEGKGI---------FDSRKNVLGHMQQ......................GGSPTPFDRNFATKMGAKAMNWMS.
Mpf_ENSMPUP00000016124 VVKQL-----------GYDTRVTILGHVQR......................GGTPSAFDRILASRMGVEAVVALL.
Mpf_ENSMPUP00000016124 YSEEGKGV---------FDCRKNVLGHMQQ......................GGAPSPFDRNFGTKISARAMQWIS.
Mpf_ENSMPUP00000000438 VVKRL-----------GYDTRVTVLGHVQR......................GGTPSAFDRILGSRMGVEAVMALL.
Mpf_ENSMPUP00000010015 VVQRL-----------GFDTRVTVLGHVQR......................GGTPSAFDRILSSKMGMEAVMALL.


                                                            460       470       480          490    
                                                              |         |         |            |    
d1kzha_                .............N...GL................TGYMSCIKNLNLKPTDWIAGGVPLTML...MNMEERYGEKKP
ENSP00000309438      .............E...GTpdt.............PACVVSLSGN-------QAVRLPLMEC...VQVTKDVTKA--
ENSP00000352842      .............E...GTpdt.............PACVVSLSGN-------QAVRLPLMEC...VQVTKDVTKA--
ENSP00000449426      .............E...GTpdt.............PACVVSLSGN-------QAVRLPLMEC...VQVTKDVTKA--
ENSP00000309438      .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAEL...KD----------
ENSP00000352842      .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAEL...KD----------
ENSP00000449426      .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAEL...KD----------
ENSP00000269848      .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSP00000448177      .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAELkdqTDFEHRIPKEQW
ENSP00000345771      .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAELkdqTDFEHRIPKEQW
ENSP00000269848      .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSP00000370517      .............A...KLkeargrgkkfttdd..SICVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSP00000370465      .............A...KLkeargrgkkfttdd..SICVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSP00000370517      .............EatpDT................PACVVSLNGN-------HAVRLPL---...------------
ENSP00000345771      .............E...GT................PDTPACVVSL-----------------...------------
ENSP00000448177      .............E...GT................PDTPACVVSL-----------------...------------
ENSP00000370465      .............EatpDT................PACVVSLNGN-------HAVRLPL---...------------
ENSP00000385880      .............-...--................---------------------------...------------
ENSP00000387871      .............-...--................---------------------------...------------
ENSP00000446519      .............-...--................---------------------------...------------
ENSP00000408858      .............EatpDT................PACVVSLNGN-------HAVRLPLM--...------------
ENSP00000476311      .............-...--................---------------------------...------------
ENSP00000446805      .............-...--................---------------------------...------------
ENSP00000449269      .............-...--................---------------------------...------------
ENSP00000450369      .............-...--................---------------------------...------------
ENSP00000448253      .............-...--................---------------------------...------------
ENSP00000370462      .............A...KLkeargrgkkfttdd..SICVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSP00000446829      .............-...--................---------------------------...------------
ENSP00000477128      .............-...--................---------------------------...------------
ENSP00000449835      .............-...--................---------------------------...------------
ENSP00000446945      .............-...--................---------------------------...------------
ENSP00000450091      .............-...--................---------------------------...------------
ENSP00000408858      .............-...--................---------------------------...------------
ENSP00000448940      .............-...--................---------------------------...------------
ENSP00000448315      .............-...--................---------------------------...------------
ENSP00000447997      .............-...--................---------------------------...------------
ENSP00000448018      .............-...--................---------------------------...------------
ENSP00000449622      .............-...--................---------------------------...------------
ENSP00000410275      .............A...KLkeargrgkkfttdd..SICVLGISKR-------NVIFQPVAEL...K-----------
ENSPTRP00000056036   .............E...GTpdt.............PACVVSLSGN-------QAVRLPLMEC...VQVTKDVTKA--
ENSPTRP00000056036   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAEL...KD----------
ENSPTRP00000040215   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSPTRP00000003790   .............V...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSPTRP00000040215   .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSPTRP00000003790   .............EatpDT................PACVVSLNGN-------HAVRLPL---...------------
ENSGGOP00000019823   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSGGOP00000005577   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSGGOP00000006327   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAELkdqTDFEHRIPKEQW
ENSGGOP00000019823   .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSGGOP00000006327   .............E...GT................PDTPACVVSL-----------------...------------
ENSGGOP00000005577   .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSGGOP00000028061   .............-...--................---------------------------...------------
ENSPPYP00000002366   .............A...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSPPYP00000012821   .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...------------
ENSPPYP00000005085   .............S...GKikesyrngrifantpdSGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSPPYP00000005084   .............Q...--................---------------------------...------------
ENSPPYP00000002366   .............EatpDT................PACVVSLNGN-------HAVRLPLMEC...------------
ENSPPYP00000005085   .............-...--................---------------------------...------------
ENSPPYP00000005084   .............S...GKikesyrngrifantpdSGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSPPYP00000012821   .............E...KL................---------------------------...------------
ENSNLEP00000021734   .............G...KIkesyrngrifanspd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSNLEP00000013514   .............A...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkqTDFEHRIPKEQW
ENSNLEP00000002654   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTE-...------------
ENSNLEP00000002654   .............EatpDT................PACVVTLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSNLEP00000021734   .............E...GT................PDTPACVVSL-----------------...------------
ENSNLEP00000013514   .............EatpDT................PACVVSLNGN-------HAVRLPL---...------------
hFl_ENSPANP00000012758 .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
hFl_ENSPANP00000007750 .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELqgqTDFEHRIPKEQW
hFl_ENSPANP00000012758 .............EatpDT................PACVVSLSGN-------QSVRLPLMEC...VQMTKEVQKA--
hFl_ENSPANP00000019805 .............A...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkqqTDFEHRIPKEQW
hFl_ENSPANP00000019805 .............EatpDT................PACVVSLNGN-------HAVRLPLM--...------------
hFl_ENSPANP00000007750 .............E...GT................PDTPACVVSL-----------------...------------
ENSMMUP00000005582   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSMMUP00000002742   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELqgqTDFEHRIPKEQW
ENSMMUP00000002741   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELqgqTDFEHRIPKEQW
ENSMMUP00000039868   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELqgqTDFEHRIPKEQW
ENSMMUP00000005583   .............A...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkqqTDFEHRIPKEQW
ENSMMUP00000006549   .............A...KLkeargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkqqTDFEHRIPKEQW
ENSMMUP00000039868   .............E...GT................PDTPACVVSL-----------------...------------
ENSMMUP00000002741   .............E...GT................PDTPACVVSL-----------------...------------
ENSMMUP00000006549   .............EatpDT................PACVVSLNGN-------HAVRLPL---...------------
ENSMMUP00000002742   .............E...GT................PDTPACVVSL-----------------...------------
ENSMMUP00000005583   .............EatpDT................PACVVSLNGN-------HAVRLPLMEC...------------
ENSMMUP00000028989   .............-...--................---------------------------...------------
ENSCJAP00000023021   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSCJAP00000023045   .............E...GTpdt.............PACVVSLSGN-------QAVRLPLMEC...VQ----------
ENSCJAP00000037952   .............A...KLkaargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkeTDFEHRIPKEQW
ENSCJAP00000037952   .............EatpDT................PACVVSLSGN-------H---------...------------
ENSCJAP00000023025   .............A...KLkaargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkeTDFEHRIPKEQW
ENSCJAP00000023021   .............EatpDT................PACVVSLSGN-----------------...------------
ENSCJAP00000032497   .............E...KLrevyrkgrvfanapd.SACVIGLKKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSCJAP00000023045   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELkdqTDFEHRIPKEQW
ENSCJAP00000043656   .............A...KLkaargrgkkfttdd..SVCVLGISKR-------NVIFQPVAELkkeTDFEHRIPKEQW
ENSCJAP00000023045   .............-...--................---------------------------...------------
ENSOGAP00000004926   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------TLLFQPVTELkdqTDFEHRIPKEQW
ENSOGAP00000012192   .............EatpEV................PACVVSLSGN-------HAVRLPL---...------------
ENSOGAP00000012192   lvscsptprkkfyS...ND................SVCVLGISKR-------NVLFQPVADLkeeTDFEHRIPKEQW
ENSOGAP00000004926   .............E...GT................PDTPACVVSL-----------------...------------
ENSOGAP00000018319   .............E...KLravyrkgrvfanapd.SACVIGLQKK-------AVAFSPVTELkndTDFEHRMPREQW
ENSOGAP00000018319   .............EaspDT................PACVVSLSGN-------QSVRLPLMEC...VQMTKEVQKA--
ENSMICP00000005735   .............E...KLkefkgkrfvtdd....SICVLGISKR-------NVLFQPVAELkkeTDFEHRIPKEQW
ENSMICP00000008274   .............G...KIkesyrngrifanspd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSMICP00000008274   .............E...GT................PDTPACVVSL-----------------...------------
ENSMICP00000005735   .............EatpET................PPCVVSLSGN-------HPVLLPLMEC...VQMTQDVQKA--
ENSRNOP00000013374   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSRNOP00000001625   .............E...KLrdvyrkgrvfanapd.SACVIGLRKK-------VVAFSSVTELkkeTDFEHRMPREQW
ENSRNOP00000023252   .............EatpET................PACVVSLRGN-------QAVRLPL---...------------
ENSRNOP00000013374   .............E...GT................PDTPACVVSL-----------------...------------
ENSRNOP00000001625   .............EatpDT................PACVVSLSG------------------...------------
ENSRNOP00000023252   .............A...KLkgshgtgkkfvsdd..SICVLGIQKR-------DLLFKPVAELrkaTDFEHRIPKQQW
ENSMUSP00000020522   .............E...KLrdvyrkgrvfanapd.SACVIGLRKK-------VVAFSPVTELkkeTDFEHRMPREQW
ENSMUSP00000059801   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSMUSP00000132803   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSMUSP00000021614   .............A...KLkgsqgtgkkfvsdd..SICVLGICKR-------DLLFQPVAELkkvTDFEHRIPKEQW
ENSMUSP00000117030   .............EatpET................PACVVSLRGN-------QAVRLPL---...------------
ENSMUSP00000021614   .............EatpET................PACVVSLRGN-------QAVRLPL---...------------
ENSMUSP00000117030   .............A...KLkgsqgtgkkfvsdd..SICVLGICKR-------DLLFQPVAELkkvTDFEHRIPKEQW
ENSMUSP00000020522   .............EatpDT................PACVVSLSGN-----------------...------------
ENSMUSP00000059801   .............E...GT................PDTPACVVSL-----------------...------------
ENSMUSP00000132803   .............E...GT................PDTPACVVSL-----------------...------------
ENSMUSP00000115313   .............-...--................---------------------------...------------
ENSMUSP00000123662   .............-...--................---------------------------...------------
ENSMUSP00000114439   .............A...KLkgsqgtgkkfvsdd..SICVLGICKR-------DLLFQPVAELkkvTDFEHRIPKEQW
ENSDORP00000006665   .............EatpDT................PACVVSLSGN-------QAVRLPL---...------------
ENSDORP00000006665   klkesagkgkkftS...DD................SICVLGICKR-------NLVFQPVAELrqkTDFEHRIPKEQW
ENSDORP00000000082   .............-...--................---------------------------...------------
ENSDORP00000006568   .............E...KLravyrkgrvfanapd.SACVIGLRKK-------AVAFSPVTELkkdTDFDHRMPREQW
ENSDORP00000000082   .............-...--................---------------------------...------------
ENSDORP00000006568   .............EatpDT................PACVVSLSGN-----------------...------------
ENSDORP00000000082   .............G...KIkesyrngrifansp..DSCVLGMRK--------RAVFQPVTELkdqTDFDHRIPKEQW
ENSSTOP00000022581   .............E...KLravyrkgrvfanapd.SACVIGLRKK-------AVAFSPVTELkkdTDFEHRMPREQW
ENSSTOP00000001736   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSSTOP00000005651   .............EatpET................PACVVSLSGN-------QAVRLPLVEC...VQ----------
ENSSTOP00000022581   .............EatpDT................PACVVSLSGN-------QPVRLPL---...------------
ENSSTOP00000005651   .............T...KLkesygkgkkcvsdd..YICVLGISKR-------NVIFQPVADLkeeTDFEHRIPKEQW
ENSSTOP00000001736   .............E...GT................PDTPACVVSL-----------------...------------
HGL_H00000345771     .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELqeqTDFEHRIPKEQW
HGL_H00000384038     .............D...KLravyrrgrvfanapd.SACVIGLRKK-------VVAFSPVTELkedTDFEHRMPREQW
HGL_H00000345771     .............E...GT................PDTPACVVSL-----------------...------------
HGL_H00000370517     .............EatpEI................PACVVSLNGN-------HAVRLPL---...------------
HGL_H00000370517     .............-...--................---------------------------...------------
HGL_H00000384038     .............EatpDT................PACVVSLSGN-------QSVRLPLLGC...VQVTKDVQKA--
HGL_H00000370517     .............T...KLkgsqgkakkfvtnd..SICLLGIRKR-------NLLFQPVTELkkeTDFEHRIPKEQW
HGL_H00000370517     .............-...--................---------------------------...------------
ENSCPOP00000020281   .............D...KLqavyrkgrvfanapd.SACVIGLRKK-------VVAFSPVTELkedTDFEHRMPREQW
ENSCPOP00000007508   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkeqTDFEHRIPKEQW
ENSCPOP00000001292   .............A...KLkesqgkgkkfvtdd..SICLLGMRKR-------NLLFQPVTELkeeTDFEHRIPKEQW
ENSCPOP00000001292   .............EatpEI................PACVVSLNGN-------HAVRLPL---...------------
ENSCPOP00000007508   .............E...GT................PDTPACVVSL-----------------...------------
ENSCPOP00000020281   .............EatpDT................PACVVSLSG------------------...------------
ENSOCUP00000014991   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELqnqTDFEHRIPKEQW
ENSOCUP00000009500   .............EatpET................PACVVSLSGN-------HAVRLPL---...------------
ENSOCUP00000026775   .............EatpET................PACVVSLSGN-------HAVRLPL---...------------
ENSOCUP00000009500   .............T...KLkespgkgkrfvsdd..SICVLGISKR-------NVLFQPVAELkneTDFEHRIPKEQW
ENSOCUP00000014991   .............E...GT................PDTPACVVSL-----------------...------------
ENSOCUP00000017314   .............-...--................---------------------------...------------
ENSOCUP00000026775   .............T...KLkespgkgkrfvsdd..SICVLGISKR-------NVLFQPVAEL...KN----------
ENSOCUP00000026775   .............-...--................---------------------------...------------
ENSOPRP00000013455   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
ENSOPRP00000002617   .............EatpET................PACVVSLSGN-------QAVRLPL---...------------
ENSOPRP00000013455   .............-...--................---------------------------...------------
ENSOPRP00000001668   .............EatpDT................PACVVSLSGN-------QSVRLPLMEC...VQVTKEVQKA--
ENSOPRP00000001668   .............E...MLravyrkgrvfanapd.SACVIGLRKK-------AVAFSPVT--...------------
ENSOPRP00000002617   .............-...--................---------------------------...------------
ENSOPRP00000002617   .............T...KLkeapgkaetvvsdd..SICVLGISKR-------NVVFQPVTELkkeTDFEHRIPKEQW
ENSTBEP00000004211   .............E...GT................PDTPACVVSL-----------------...------------
ENSTBEP00000007887   .............-...--................---------------------------...------------
ENSTBEP00000014699   .............EatpDT................PACVVSLSGN-------QSVRLPLMEC...VQ----------
ENSTBEP00000004211   .............-...--................---------------------------...------------
ENSTBEP00000014699   .............E...KLravyrkgrvfanapd.SACVIGLQKK-------TVAFSPVTE-...------------
ENSTBEP00000007887   .............-...--................---------------------------...------------
ENSTBEP00000014699   .............-...--................---------------------------...------------
ENSSSCP00000022897   .............EatpDT................PACVVSLSGN-----------------...------------
ENSSSCP00000021675   .............E...GT................PDTPACVVSL-----------------...------------
ENSSSCP00000022897   .............E...KLravyrkgrvfanapd.SACVIGLQKK-------AVAFSPVTELkedTDFEHRMPREQW
ENSSSCP00000021675   .............-...--................---------------------------...------------
ENSSSCP00000024482   .............-...--................---------------------------...------------
ENSSSCP00000011907   .............-...--................---------------------------...------------
ENSSSCP00000024482   .............-...--................---------------------------...------------
ENSBTAP00000051545   .............E...KLravyrngrvfanasd.SACVIGLQKK-------VVAFSPVTELkkdTDFEHRMPREQW
ENSBTAP00000000359   .............G...KIkesyrngrifanspd.SGCVLGMRKR-------ALVFQPVTELkeqTDFEHRIPKEQW
ENSBTAP00000003472   .............QatpET................PACVVSLSGN-------QAVRLPL---...------------
ENSBTAP00000003472   .............S...KLresvgkgkkflsed..CVCVLGISKR-------TLLFQPVAELkkeTDFEHRIPKEQW
ENSBTAP00000000359   .............E...GT................PDTPACVVSL-----------------...------------
ENSBTAP00000051545   .............EatpDT................PACVVSLSGN-----------------...------------
tfI_ENSOARP00000012730 .............E...KLravyrngrvfanapd.SACVIGLQKK-------VVAFSPVTELkkdTDFEHRMPREQW
tfI_ENSOARP00000020732 .............E...GT................PDTPACVVSL-----------------...------------
tfI_ENSOARP00000020732 .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALLFQPVTELqeqTDFEHRIPKEQW
tfI_ENSOARP00000012730 .............EatpDT................PACVVSLSGN-------QSVRLPL---...------------
tfI_ENSOARP00000014794 .............S...KLresagkgkkflsed..SVCVLGISKR-------TLLFQPVAELkkeTDFEHRIPKEQW
tfI_ENSOARP00000014794 .............QatpET................PACVVSLSG------------------...------------
ENSVPAP00000011298   .............E...GT................PDT------------------------...------------
ENSVPAP00000011298   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALIFQPVTELmeqTDFEHRIPKEQW
ENSVPAP00000011298   .............-...--................---------------------------...------------
ENSTTRP00000014670   .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVAELkeqTDFEHRIPKEQW
ENSTTRP00000014670   .............E...GT................PDTPACVVSL-----------------...------------
ENSTTRP00000013840   .............E...--................---------------------------...------------
ENSTTRP00000014340   .............Tp..ET................PACVVSLSGN-------QAVRLPL---...------------
ENSTTRP00000013840   .............-...--................---------------------------...------------
ENSTTRP00000014340   .............A...KLkepagrgrrfvsdd..SVCVLGISKR-------NLLFQPVAELkeeTDFVHRIPKEQW
ENSTTRP00000014340   .............-...--................---------------------------...------------
ENSTTRP00000013840   .............EatpHT................PACVVSLSGN-------QSVRLPLMEC...VQMTKEVQKA--
Mpf_ENSMPUP00000010015 .............E...KLravyrngrvfanapd.SACVIGLRKK-------AVAFSPVTELkkdTDFEHRMPREQW
Mpf_ENSMPUP00000000438 .............G...KIkesyrngrifantpd.SGCVLGMRKR-------ALVFQPVTELkdqTDFEHRIPKEQW
Mpf_ENSMPUP00000016124 .............QatpET................PACVVSLSGN-------QAVRLPLVE-...------------
Mpf_ENSMPUP00000016124 .............T...KLkeapgkgkrftsed..SICVLGISKR-------NLLFQPVTQLrkdTDFEHRIPKEQW
Mpf_ENSMPUP00000000438 .............E...GT................PDTPACVVSL-----------------...------------
Mpf_ENSMPUP00000010015 .............EatpDT................QACVVSLSGN-----------------...------------


                          500       510       520       530       540       550            
                            |         |         |         |         |         |            
d1kzha_                VIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEIVDEITETLK---lel.........
ENSP00000309438      --------------------------------------------------------mdek........
ENSP00000352842      --------------------------------------------------------mdek........
ENSP00000449426      --------------------------------------------------------mdek........
ENSP00000309438      --------------------------------------------------------qtd.........
ENSP00000352842      --------------------------------------------------------qtd.........
ENSP00000449426      --------------------------------------------------------qtd.........
ENSP00000269848      WLSLR---------------------------------------------------l...........
ENSP00000448177      WLKLRP--------------------------------------------------ilkila......
ENSP00000345771      WLKLRP--------------------------------------------------ilkila......
ENSP00000269848      --------------------------------------------------------............
ENSP00000370517      WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSP00000370465      WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSP00000370517      --------------------------------------------------------............
ENSP00000345771      --------------------------------------------------------............
ENSP00000448177      --------------------------------------------------------............
ENSP00000370465      --------------------------------------------------------............
ENSP00000385880      --------------------------------------------------------............
ENSP00000387871      --------------------------------------------------------............
ENSP00000446519      --------------------------------------------------------............
ENSP00000408858      --------------------------------------------------------e...........
ENSP00000476311      --------------------------------------------------------l...........
ENSP00000446805      --------------------------------------------------------s...........
ENSP00000449269      --------------------------------------------------------s...........
ENSP00000450369      --------------------------------------------------------s...........
ENSP00000448253      --------------------------------------------------------w...........
ENSP00000370462      WLKLR------PLMKILAKYKAS---------------------------------ydvsd.......
ENSP00000446829      --------------------------------------------------------............
ENSP00000477128      --------------------------------------------------------............
ENSP00000449835      --------------------------------------------------------............
ENSP00000446945      --------------------------------------------------------............
ENSP00000450091      --------------------------------------------------------............
ENSP00000408858      --------------------------------------------------------............
ENSP00000448940      --------------------------------------------------------ml..........
ENSP00000448315      --------------------------------------------------------q...........
ENSP00000447997      --------------------------------------------------------............
ENSP00000448018      --------------------------------------------------------............
ENSP00000449622      --------------------------------------------------------............
ENSP00000410275      --------------------------------------------------------kqt.........
ENSPTRP00000056036   --------------------------------------------------------mdek........
ENSPTRP00000056036   --------------------------------------------------------qtd.........
ENSPTRP00000040215   WLSLR---------------------------------------------------l...........
ENSPTRP00000003790   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSPTRP00000040215   --------MDDKRFDEATQLRGGSFEN-----------------------------nw..........
ENSPTRP00000003790   --------------------------------------------------------m...........
ENSGGOP00000019823   WLSLR---------------------------------------------------l...........
ENSGGOP00000005577   WLSLR---------------------------------------------------l...........
ENSGGOP00000006327   WLKLRP--------------------------------------------------ilkila......
ENSGGOP00000019823   --------------------------------------------------------............
ENSGGOP00000006327   --------------------------------------------------------............
ENSGGOP00000005577   --------MDDKRFDEATQLRGGSFEN-----------------------------nw..........
ENSGGOP00000028061   --------------------------------------------------------............
ENSPPYP00000002366   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSPPYP00000012821   --------------------------------------------------------v...........
ENSPPYP00000005085   WLKLRP--------------------------------------------------ilkila......
ENSPPYP00000005084   --------------------------------------------------------gltslva.....
ENSPPYP00000002366   --------------------------------------------------------v...........
ENSPPYP00000005085   --------------------------------------------------------............
ENSPPYP00000005084   WLKLR---------------------------------------------------p...........
ENSPPYP00000012821   --------------------------------------------------------rd..........
ENSNLEP00000021734   WLKLRP--------------------------------------------------ilkila......
ENSNLEP00000013514   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSNLEP00000002654   --------------------------------------------------------lk..........
ENSNLEP00000002654   --------------------------------------------------------............
ENSNLEP00000021734   --------------------------------------------------------............
ENSNLEP00000013514   --------------------------------------------------------............
hFl_ENSPANP00000012758 WLSLR---------------------------------------------------l...........
hFl_ENSPANP00000007750 WLKLRP--------------------------------------------------ilkila......
hFl_ENSPANP00000012758 --------------------------------------------------------............
hFl_ENSPANP00000019805 WLKLR------PLMKILAKYKA----------------------------------sydvsd......
hFl_ENSPANP00000019805 --------------------------------------------------------e...........
hFl_ENSPANP00000007750 --------------------------------------------------------............
ENSMMUP00000005582   WLSLR---------------------------------------------------l...........
ENSMMUP00000002742   WLKLRP--------------------------------------------------ilkila......
ENSMMUP00000002741   WLKLRP--------------------------------------------------ilkila......
ENSMMUP00000039868   WLKLRP--------------------------------------------------ilkila......
ENSMMUP00000005583   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSMMUP00000006549   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSMMUP00000039868   --------------------------------------------------------s...........
ENSMMUP00000002741   --------------------------------------------------------s...........
ENSMMUP00000006549   --------------------------------------------------------............
ENSMMUP00000002742   --------------------------------------------------------s...........
ENSMMUP00000005583   --------------------------------------------------------v...........
ENSMMUP00000028989   --------------------------------------------------------............
ENSCJAP00000023021   WLSLR---------------------------------------------------l...........
ENSCJAP00000023045   --------------------------------------------------------everq.......
ENSCJAP00000037952   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSCJAP00000037952   --------------------------------------------------------avrlp.......
ENSCJAP00000023025   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSCJAP00000023021   --------------------------------------------------------qsvrlp......
ENSCJAP00000032497   WLSLR---------------------------------------------------l...........
ENSCJAP00000023045   WLKLRP--------------------------------------------------ilkila......
ENSCJAP00000043656   WLKLR------PLMKILAKYKAS---------------------------------ydvsd.......
ENSCJAP00000023045   --------------------------------------------------------ge..........
ENSOGAP00000004926   WLKLRP--------------------------------------------------ilkila......
ENSOGAP00000012192   --------------------------------------------------------v...........
ENSOGAP00000012192   WLKLR------PLMKILAKYQ-----------------------------------atydvs......
ENSOGAP00000004926   --------------------------------------------------------............
ENSOGAP00000018319   WLNLR---------------------------------------------------l...........
ENSOGAP00000018319   --------------------------------------------------------............
ENSMICP00000005735   WLKLR------PLMKILAKY------------------------------------ktsydvs.....
ENSMICP00000008274   WLKLR---------------------------------------------------p...........
ENSMICP00000008274   --------------------------------------------------------............
ENSMICP00000005735   --------------------------------------------------------md..........
ENSRNOP00000013374   WLKLRP--------------------------------------------------ilkila......
ENSRNOP00000001625   WLNLR---------------------------------------------------l...........
ENSRNOP00000023252   --------------------------------------------------------............
ENSRNOP00000013374   --------------------------------------------------------............
ENSRNOP00000001625   --------------------------------------------------------n...........
ENSRNOP00000023252   WLKLR------PIMKILAKYEAS---------------------------------ydmsd.......
ENSMUSP00000020522   WLNLR---------------------------------------------------l...........
ENSMUSP00000059801   WLKLRP--------------------------------------------------ilkila......
ENSMUSP00000132803   WLKLRP--------------------------------------------------ilkila......
ENSMUSP00000021614   WLKLR------PIMKILAKYEAS---------------------------------ydmsd.......
ENSMUSP00000117030   --------------------------------------------------------m...........
ENSMUSP00000021614   --------------------------------------------------------m...........
ENSMUSP00000117030   WLKLR------PIMKILAKYEAS---------------------------------ydmsd.......
ENSMUSP00000020522   --------------------------------------------------------qsvrlp......
ENSMUSP00000059801   --------------------------------------------------------............
ENSMUSP00000132803   --------------------------------------------------------............
ENSMUSP00000115313   --------------------------------------------------------............
ENSMUSP00000123662   --------------------------------------------------------............
ENSMUSP00000114439   WLKLR------PIMKILAKYEAS---------------------------------ydmsd.......
ENSDORP00000006665   --------------------------------------------------------v...........
ENSDORP00000006665   WLKLRP------V-------------------------------------------mkilakyeasyd
ENSDORP00000000082   --------------------------------------------------------............
ENSDORP00000006568   WLNLR---------------------------------------------------l...........
ENSDORP00000000082   --------------------------------------------------------rdl.........
ENSDORP00000006568   --------------------------------------------------------qsvrlp......
ENSDORP00000000082   WLKLR---------------------------------------------------p...........
ENSSTOP00000022581   WLSLR---------------------------------------------------l...........
ENSSTOP00000001736   WLKLRP--------------------------------------------------ilkila......
ENSSTOP00000005651   --------------------------------------------------------m...........
ENSSTOP00000022581   --------------------------------------------------------............
ENSSTOP00000005651   WLKLR------PLMKIL---------------------------------------akykasfd....
ENSSTOP00000001736   --------------------------------------------------------............
HGL_H00000345771     WLKLRP--------------------------------------------------ilki........
HGL_H00000384038     WLNLR---------------------------------------------------l...........
HGL_H00000345771     --------------------------------------------------------............
HGL_H00000370517     --------------------------------------------------------m...........
HGL_H00000370517     --------------------------------------------------------qa..........
HGL_H00000384038     --------------------------------------------------------md..........
HGL_H00000370517     WLKLR------PLMKILAKY------------------------------------kasydvs.....
HGL_H00000370517     --------------------------------------------------------tk..........
ENSCPOP00000020281   WLNLR---------------------------------------------------l...........
ENSCPOP00000007508   WLKLR---------------------------------------------------p...........
ENSCPOP00000001292   WLKLR------PLMKILAKYKA----------------------------------sydvsd......
ENSCPOP00000001292   --------------------------------------------------------m...........
ENSCPOP00000007508   --------------------------------------------------------............
ENSCPOP00000020281   --------------------------------------------------------n...........
ENSOCUP00000014991   WLKLR---------------------------------------------------p...........
ENSOCUP00000009500   --------------------------------------------------------v...........
ENSOCUP00000026775   --------------------------------------------------------v...........
ENSOCUP00000009500   WLKLR------PLMKILAKYKTS---------------------------------ydvsd.......
ENSOCUP00000014991   --------------------------------------------------------............
ENSOCUP00000017314   --------------------------------------------------------l...........
ENSOCUP00000026775   --------------------------------------------------------e...........
ENSOCUP00000026775   --------------------------------------------------------............
ENSOPRP00000013455   WLKLR---------------------------------------------------p...........
ENSOPRP00000002617   --------------------------------------------------------............
ENSOPRP00000013455   --------------------------------------------------------p...........
ENSOPRP00000001668   --------MDERRFDEAIQLRGR---------------------------------sfennw......
ENSOPRP00000001668   --------------------------------------------------------el..........
ENSOPRP00000002617   --------------------------------------------------------............
ENSOPRP00000002617   WLKLR------PVMKILAKYRTSYDVSD----------------------------s...........
ENSTBEP00000004211   --------------------------------------------------------............
ENSTBEP00000007887   --------------------------------------------------------tkl.........
ENSTBEP00000014699   --------------------------------------------------------vx..........
ENSTBEP00000004211   --------------------------------------------------------k...........
ENSTBEP00000014699   --------------------------------------------------------lk..........
ENSTBEP00000007887   --------------------------------------------------------............
ENSTBEP00000014699   --------------------------------------------------------xx..........
ENSSSCP00000022897   --------------------------------------------------------qsvrlp......
ENSSSCP00000021675   --------------------------------------------------------............
ENSSSCP00000022897   WLNLR---------------------------------------------------l...........
ENSSSCP00000021675   --------------------------------------------------------ir..........
ENSSSCP00000024482   --------------------------------------------------------rg..........
ENSSSCP00000011907   --------------------------------------------------------iklse.......
ENSSSCP00000024482   --------------------------------------------------------............
ENSBTAP00000051545   WLNLR---------------------------------------------------l...........
ENSBTAP00000000359   WLKLR---------------------------------------------------p...........
ENSBTAP00000003472   --------------------------------------------------------............
ENSBTAP00000003472   WLKLR------PLMKIL---------------------------------------akykvsfev...
ENSBTAP00000000359   --------------------------------------------------------............
ENSBTAP00000051545   --------------------------------------------------------qsvrlp......
tfI_ENSOARP00000012730 WLNLR---------------------------------------------------l...........
tfI_ENSOARP00000020732 --------------------------------------------------------............
tfI_ENSOARP00000020732 WLKLR---------------------------------------------------p...........
tfI_ENSOARP00000012730 --------------------------------------------------------m...........
tfI_ENSOARP00000014794 WLKLR------PLMKIL---------------------------------------akykvsfev...
tfI_ENSOARP00000014794 --------------------------------------------------------n...........
ENSVPAP00000011298   --------------------------------------------------------pacvv.......
ENSVPAP00000011298   WLKLR---------------------------------------------------p...........
ENSVPAP00000011298   --------------------------------------------------------x...........
ENSTTRP00000014670   WLKLR---------------------------------------------------p...........
ENSTTRP00000014670   --------------------------------------------------------............
ENSTTRP00000013840   --------------------------------------------------------klr.........
ENSTTRP00000014340   --------------------------------------------------------............
ENSTTRP00000013840   --------------------------------------------------------............
ENSTTRP00000014340   WLKLR------PLMKILAKY------------------------------------kasfevs.....
ENSTTRP00000014340   --------------------------------------------------------............
ENSTTRP00000013840   --------------------------------------------------------mdekr.......
Mpf_ENSMPUP00000010015 WLNLR---------------------------------------------------l...........
Mpf_ENSMPUP00000000438 WLKLR---------------------------------------------------p...........
Mpf_ENSMPUP00000016124 --------------------------------------------------------c...........
Mpf_ENSMPUP00000016124 WLKLR------PLMKILAKY------------------------------------kasyev......
Mpf_ENSMPUP00000000438 --------------------------------------------------------s...........
Mpf_ENSMPUP00000010015 --------------------------------------------------------qsvrlp......


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0047912 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Aquifex aeolicus VF5
NoYes   Elusimicrobium minutum Pei191
NoYes   uncultured Termite group 1 bacterium phylotype Rs-D17
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Methylibium petroleiphilum PM1
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Alicycliphilus denitrificans K601
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. JS42
NoYes   Comamonas testosteroni CNB-2
NoYes   Collimonas fungivorans Ter331
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Magnetococcus marinus MC-1
NoYes   Sphingomonas wittichii RW1
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   alpha proteobacterium HIMB59
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Buchnera aphidicola BCc
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Candidatus Riesia pediculicola USDA
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Candidatus Blochmannia floridanus
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Candidatus Phytoplasma solani tobfin_28409
NoYes   Candidatus Phytoplasma australiense Strawberry lethal yellows phytoplasma (CPA) str. NZSb11
NoYes   Candidatus Phytoplasma australiense
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Spiroplasma taiwanense CT-1
NoYes   Spiroplasma apis B31
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Mycoplasma parvum str. Indiana
NoYes   Mycoplasma leachii PG50
NoYes   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
NoYes   Mycoplasma mycoides subsp. mycoides SC str. PG1
NoYes   Candidatus Mycoplasma haemominutum 'Birmingham 1'
NoYes   Mycoplasma ovis str. Michigan
NoYes   Mycoplasma cynos C142
NoYes   Candidatus Mycoplasma haemolamae str. Purdue
NoYes   Mycoplasma suis str. Illinois
NoYes   Mycoplasma haemofelis str. Langford 1
NoYes   Mycoplasma putrefaciens Mput9231
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Mycoplasma pneumoniae M129-B7
NoYes   Mycoplasma pneumoniae FH
NoYes   Mycoplasma pneumoniae M129
NoYes   Mycoplasma hyorhinis SK76
NoYes   Mycoplasma hyorhinis MCLD
NoYes   Mycoplasma hyorhinis HUB-1
NoYes   Mycoplasma hyorhinis DBS 1050
NoYes   Mycoplasma hyopneumoniae 168-L
NoYes   Mycoplasma hyopneumoniae 7422
NoYes   Mycoplasma hyopneumoniae 232
NoYes   Mycoplasma hyopneumoniae 7448
NoYes   Mycoplasma hyopneumoniae J
NoYes   Mycoplasma genitalium M2321
NoYes   Mycoplasma genitalium M2288
NoYes   Mycoplasma genitalium M6282
NoYes   Mycoplasma genitalium M6320
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae TN
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium urealyticum DSM 7111
NoYes   Corynebacterium argentoratense DSM 44202
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium pseudotuberculosis 258
NoYes   Corynebacterium pseudotuberculosis Cp162
NoYes   Corynebacterium pseudotuberculosis P54B96
NoYes   Corynebacterium pseudotuberculosis 267
NoYes   Corynebacterium pseudotuberculosis 1/06-A
NoYes   Corynebacterium pseudotuberculosis 42/02-A
NoYes   Corynebacterium pseudotuberculosis 3/99-5
NoYes   Corynebacterium pseudotuberculosis 31
NoYes   Corynebacterium pseudotuberculosis CIP 52.97
NoYes   Corynebacterium pseudotuberculosis PAT10
NoYes   Corynebacterium pseudotuberculosis I19
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Corynebacterium pseudotuberculosis C231
NoYes   Corynebacterium pseudotuberculosis 1002
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium diphtheriae BH8
NoYes   Corynebacterium diphtheriae INCA 402
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae HC02
NoYes   Corynebacterium diphtheriae HC01
NoYes   Corynebacterium diphtheriae 241
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Corynebacterium diphtheriae PW8
NoYes   Corynebacterium diphtheriae C7 (beta)
NoYes   Corynebacterium diphtheriae 31A
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Actinomyces graevenitzii C83
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus oshimai JL-2
NoYes   Thermus thermophilus JL-18
NoYes   Thermus thermophilus SG0.5JP17-16
NoYes   Thermus thermophilus HB8
NoYes   [Eubacterium] cylindroides [Eubacterium] cylindroides T2-87
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Ruminococcus champanellensis 18P13
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Coprococcus catus GD/7
NoYes   Roseburia intestinalis XB6B4
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium sp. SY8519
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Thermoanaerobacter sp. X513
NoYes   Halobacteroides halobius DSM 5150
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecium Aus0085
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Enterococcus faecium DO
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus salivarius UCC118
NoYes   Lactobacillus amylovorus GRL 1112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus helveticus R0052
NoYes   Lactobacillus helveticus H10
NoYes   Lactobacillus helveticus CNRZ32
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Lactobacillus acidophilus La-14
NoYes   Lactobacillus acidophilus NCFM
NoYes   Pediococcus pentosaceus SL4
NoYes   Lactococcus garvieae Lg2
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris UC509.9
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Lactococcus lactis subsp. cremoris SK11
NoYes   Streptococcus constellatus subsp. pharyngis C1050
NoYes   Streptococcus constellatus subsp. pharyngis C818
NoYes   Streptococcus constellatus subsp. pharyngis C232
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus anginosus C238
NoYes   Streptococcus anginosus C1051
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
NoYes   Streptococcus lutetiensis 033
NoYes   Streptococcus equi subsp. zooepidemicus ATCC 35246
NoYes   Streptococcus equi subsp. zooepidemicus MGCS10565
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus parasanguinis FW213
NoYes   Streptococcus pyogenes HSC5
NoYes   Streptococcus pyogenes A20
NoYes   Streptococcus pyogenes MGAS1882
NoYes   Streptococcus pyogenes MGAS15252
NoYes   Streptococcus pyogenes Alab49
NoYes   Streptococcus pyogenes MGAS10750
NoYes   Streptococcus pyogenes MGAS10270
NoYes   Streptococcus pyogenes MGAS2096
NoYes   Streptococcus pyogenes MGAS9429
NoYes   Streptococcus pyogenes MGAS6180
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus pyogenes NZ131
NoYes