SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

MHC antigen-recognition domain alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0034827 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                     10        20   
                                                                                      |         |   
d1a1na2               .......................................................GSHSMRYFYTAMSRPGRGEPRFI
ENSGGOP00000023781  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000025096  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000024147  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000009367  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000022475  .......................................................-SHSMRYFSTSVSRPGRGEPRFI
ENSGGOP00000005814  .......................................................-SHSMRYFYTTMSRPGRGEPRFI
ENSGGOP00000022321  .......................................................-SHSMRYFYTTMSRPGRGEPRFI
ENSGGOP00000027233  .......................................................-SHSMRYFSTSVSRPGRGEPRFI
ENSGGOP00000005655  .......................................................-SHSMRYFSTSVSRPGRGEPRFI
ENSGGOP00000026032  .......................................................-SHSLKYFHTSVSRPGRGEPRFI
ENSGGOP00000018173  .......................................................-SHSLKYFHTSVSRPGRGEPRFI
ENSGGOP00000024622  .......................................................-SHSMRYFSAAVSRPGRGEPRFI
ENSGGOP00000007343  .......................................................-SHSMRYFSAAVSRPGRGEPRFI
ENSGGOP00000006482  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000022945  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000012487  .......................................................-SHSLKYFHTSVSRPGRGEPRFI
ENSGGOP00000026941  .......................................................----MRYFSAAVSRPGRGEPRFI
ENSGGOP00000009826  .......................................................-SHSLRYFSTAVSRPGRGEPRYI
ENSGGOP00000019378  .......................................................-SHSLRYFSTAVSRPGRGEPRYI
ENSGGOP00000007834  .......................................................-SHSLRYFSTAVSQPGRGEPRFI
ENSGGOP00000026162  .......................................................--HSLRYFRLGISDPIHGVPEFI
ENSGGOP00000001964  .......................................................GHYSLTYIYTGLSKHVEDIPAFQ
ENSGGOP00000014373  ......................................................e-PLSFRVIWIESF-YNHSWKQNL
ENSGGOP00000024095  ......................................................e-PLSFRVIWIESF-YNHSWKQNL
ENSGGOP00000006230  .......................................................-SHSLHYLFMGASEQDLGLSLFE
ENSGGOP00000005239  .......................................................GPTSFHVIQTSSF-TNSTWAQTQ
ENSGGOP00000011482  ...................................................plrc--------LQISSFANSSWTRTD
ENSGGOP00000010536  ......................................................aEPHSLRYNLMVLSQDGSVQSGFL
ENSGGOP00000000494  ...................................................ehvs----FHV-IQILSFVNQSWARGQ
ENSGGOP00000003815  .......................................................DTHSLWYNFTIIHLPRHGQQWCE
ENSGGOP00000009127  .......................................................GGHSLCFNFTIKLLSRPGQPWCE
ENSGGOP00000007539  .......................................................DTHCLCYDFIITPKSRPEPQWCE
ENSGGOP00000007747  .......................................................DPHSLCYDITIIPKFRPGPRWCA
ENSGGOP00000003811  .......................................................DPHSLCYDITIIPKFRPGPRWCA
ENSGGOP00000021596  ......................................................aEPHSLRYNLMVLSQDGSVQSGFL
ENSGGOP00000027668  ......................................................aEPHSLRYNLMVLSQDGSVQSGFL
ENSGGOP00000007350  .......................................................-PHSLRYNLMVLSQDGSVQSGFL
ENSGGOP00000010415  ....................................................ehl---SFRMLQTSSF-ANHSWAHSE
ENSGGOP00000025265  .......................................................-PHSLRYNLMVLSQDGSVQSGFL
ENSGGOP00000008578  .....................................................sh--LSLLYHLTAVSSPAPGTPAFW
ENSGGOP00000014599  ..........................lpggsymavltvtlmvlssplalagdtrp-----------------------
ENSGGOP00000021208  ..........................lpggsymavltvtlmvlssplalagdtrp-----------------------
ENSGGOP00000017683  ..............................gdlrvatvtlmlamlssllaegrds-----------------------
ENSGGOP00000004173  ..............................gdlrvatvtlmlamlssllaegrds-----------------------
ENSGGOP00000018065  ...............................................gfvahves-----------------------
ENSGGOP00000023616  ......................................................p-----------------------
ENSGGOP00000020060  .....................................................fl-----------------------
ENSGGOP00000013296  ...............................aprtvalmallmvlltsvvqgrat-----------------------
ENSGGOP00000028181  ...........................ipggfwaaavtvmlvmlstpvaeardfp-----------------------
ENSGGOP00000010658  ............................sgwvpwvvallvnltrldssmtqgtds-----------------------
ENSGGOP00000001005  ...................................................qrlh-------MLQISYFRDPYHVWYQ
ENSGGOP00000021762  .....................................................fl-----------------------
ENSGGOP00000024258  ..........................................lstpvaeardfpk-----------------------
ENSGGOP00000000687  .....................................................fl-----------------------
ENSGGOP00000023954  .....................................................fl-----------------------
ENSGGOP00000022481  .....................................................fl-----------------------
ENSGGOP00000023682  .....................................................fl-----------------------
ENSGGOP00000023616  .......................................................-SHSMRYFYTSVSRPGRGEPRFI
ENSGGOP00000024462  ..vadhvascgvnlyqsygpsgqfthefdgdeqfyvdlerketawrwpefskfgg-----------------------
ENSGGOP00000020373  ..vadhvascgvnlyqsygpsgqfthefdgdeqfyvdlerketawrwpefskfgg-----------------------
ENSGGOP00000025986  ................................vsggpwtvaltallmvlrisvvq-----------------------
ENSGGOP00000013200  dhvasygvnfyqshgpsgqythesdgdeefyvdletketvwqlpmfsrfisfdpq-----------------------
ENSGGOP00000001218  .........................kadhvstyamfvqthrptgefmfefdedem-----------------------
ENSGGOP00000009633  .keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfe-----------------------
ENSGGOP00000010383  .......................................dhmgsygpafyqsyga-----------------------
ENSGGOP00000013291  .................................yamlythrptgefmfefdedem-----------------------
ENSGGOP00000001966  .......................................................GHYSLTYLYTGLSKPGKGTHRLQ
ENSGGOP00000018454  .......................................................GHYSLTYLYTGLSKPGKGTHRLQ
ENSGGOP00000005712  .............................qnhtflhtvycqdgspgvglseayde-----------------------
ENSGGOP00000019648  .............................qnhtflhtvycqdgspgvglseayde-----------------------
ENSGGOP00000022217  .......................................................GHYSLTYIYTGLSKHVEDIPAFQ
ENSGGOP00000016282  .......................................................DPHSLCYDITVIPEFRPGPRWCA
ENSGGOP00000010666  ......................................................r-----------------------


                           30        40        50         60        70        80        90        10
                            |         |         |          |         |         |         |          
d1a1na2               AVGYVDDTQFVRFDSDAASPRTEPRPPWIEQ.EGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEA.GSHIIQRMY
ENSGGOP00000023781  SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ.EGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSED.GSHTLQSMY
ENSGGOP00000025096  SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ.EGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSED.GSHTLQSMY
ENSGGOP00000024147  SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ.EGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSED.GSHTLQSMY
ENSGGOP00000009367  SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ.EGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSED.GSHTLQSMY
ENSGGOP00000022475  AVGYVDDTQFVRFDSDAASQRMEPRAPWMEQ.EEPEYWDRQTQISKTNAQIELESLRIALRYYNQSED.GSHTIQRMY
ENSGGOP00000005814  SVGYVDDTQFVRFDSDDASPREEPRAPWMER.EGPEYWDRNTQICKAQAQTERENLRIALRYYNQSEG.GSHTMQVMY
ENSGGOP00000022321  SVGYVDDTQFVRFDSDDASPREEPRAPWMER.EGPEYWDRNTQICKAQAQTERENLRIALRYYNQSEG.GSHTMQVMY
ENSGGOP00000027233  AVGYVDDTQFVRFDSDAASQRMEPRAPWMEQ.EEPEYWDRQTQISKTNAQIELESLRIALRYYNQSED.GSHTIQRMY
ENSGGOP00000005655  AVGYVDDTQFVRFDSDAASQRMEPRAPWMEQ.EEPEYWDRQTQISKTNAQIELESLRIALRYYNQSED.GSHTIQRMY
ENSGGOP00000026032  SVGYVDDTQFVRFDNEAASPRMVPRAPWMEQ.EGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEA.GSHTLQWMH
ENSGGOP00000018173  SVGYVDDTQFVRFDNEAASPRMVPRAPWMEQ.EGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEA.GSHTLQWMH
ENSGGOP00000024622  AMGYVDDTQFVRFDSDSACPRMEPRAPWVEQ.EGPEYWEGETRNTKAHAQTDRMNLQTLRGYYNQSEA.SSHTIQRMY
ENSGGOP00000007343  AMGYVDDTQFVRFDSDSACPRMEPRAPWVEQ.EGPEYWEGETRNTKAHAQTDRMNLQTLRGYYNQSEA.SSHTLQWMI
ENSGGOP00000006482  AMGYVDDTQFVRFDSDAASPREEPRAPWMEQ.EGPEYWDRNTQIYKTSAQTDRVSLRNLRGYYNQSEA.GSHTLQRMY
ENSGGOP00000022945  AMGYVDDTQFVRFDSDAASPREEPRAPWMEQ.EGPEYWDRNTQIYKTSAQTDRVSLRNLRGYYNQSEA.GSHTLQRMY
ENSGGOP00000012487  SVGYVDDTQFVRFDNEAASPRMVPRAPWMEQ.EGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAaGSHTLQWMH
ENSGGOP00000026941  AMGYVDDTQFVRFDSDSACPRMEPRAPWVEQ.EGPEYWEGETRNTKAHAQTDRMNLQTLRGYYNQSEA.SSHTLQWMI
ENSGGOP00000009826  AVEYVDDTQFLRFDSDAAIPRMEPREPWVEQ.EGPQYWERTTGYAKANAQTDRVALRNLLRRYNQSEA.GSHTLQWMI
ENSGGOP00000019378  AVEYVDDTQFLRFDSDAAIPRMEPREPWVEQ.EGPQYWERTTGYAKANAQTDRVALRNLLRRYNQSEA.GSHTLQWMI
ENSGGOP00000007834  AVGYVDDTEFVRFDSDSVSPRMERRAPWVEQ.EGLEYWDQETRNAKGHAQIYRVNLRTLLRYYNQSEAdGSHTIQRMH
ENSGGOP00000026162  SVGYVDSHPITTYDSVTR--QKEPRAPWMAEnLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNH--S.GSHTYQRMI
ENSGGOP00000001964  ALGSLNDLQFFRYNSKDR--KSQPMGLWRQV.EGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDS-N.GSHVLQGRF
ENSGGOP00000014373  VSGWLSDLQTHTWDSNSS--TIVFLWPWSRGnFSNEEWKELETLFRIRIIRSFEGIRRYAHELQF--E.YPFEIQVTG
ENSGGOP00000024095  VSGWLSDLQTHTWDSNSS--TIVFLWPWSRGnFSNEEWKELETLFRIRIIRSFEGIRRYAHELQF--E.YPFEIQVTG
ENSGGOP00000006230  ALGYVDDQLFVFYDHESR--RVEPRTPWVSSrISSQVWLQLSQSLKGWDHMFTVDFWTIMENHNHS-K.ESHTLQVIL
ENSGGOP00000005239  GSGWLDDLQIHGWDSDSG--TAIFLKPWSKGnFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQM--K.YPFEIQGIA
ENSGGOP00000011482  GLAWLGELQTHSWSNDSD--TVRSLKPWSQGtFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRL--S.YPLELQVSA
ENSGGOP00000010536  AEGHLDGQPFLRYDRQKR--RAKPQGQWAEDvLGAETWDTETEDLTENGQDLRRTLAHIKDQK----G.GLHSLQEIR
ENSGGOP00000000494  GSGWLDELQTHGWDSESG--TIIFLHTWSKGnFSNEELSDLELLFRFYLFGLTREIQDHASQHYS--K.YPFEVQVKA
ENSGGOP00000003815  VQSQVDQKNVLSYDCGSD--KVLSMGHLEEQlDATDAWGKQLEMLREVGQRLRLELADT-ELEDFTPS.GPLMLQARM
ENSGGOP00000009127  AQVFLNKNLFLQYNSDNN--MVKPLGLLGKKvNATSTWGELTQTLGEVGRDLRMLLLDIKPQIKT--S.GPSTLQVEM
ENSGGOP00000007539  VQGLVDERPFLHYDCVNH--KAKAFASLGKKvNVTKTWEEQTETLRDVVDFLKGQLLDI-QVENLIPI.EPLTLQARM
ENSGGOP00000007747  VQGQVDKKTFLHYDCGNK--TVTPVSPLGNKlNVTKSWKAQNPVLRKVVDILTEQLLDI-QQENYTHK.EPLTLQARM
ENSGGOP00000003811  VQGQVDKKTFLHYDCGNK--TVTPVSPLGNKlNVTKSWKAQNPVLRKVVDILTEQLLDI-QQENYTHK.EPLTLQARM
ENSGGOP00000021596  AEVHLDGQPFLRCDRQKC--RAKPQGQWAEDvLGAETWDTETEDLTENGQDLRMTLTHIKDQK----E.GLHSLQEIR
ENSGGOP00000027668  AEVHLDGQPFLRCDRQKC--RAKPQGQWAEDvLGAETWDTETEDLTENGQDLRMTLTHIKDQK----E.GLHSLQEIR
ENSGGOP00000007350  AEVHLDGQPFLRCDRQKC--RAKPQGQWAEDvLGAETWDTETEDLTENGQDLRMTLTHIKDQK----G.GLHSLQEIR
ENSGGOP00000010415  GSGWLGDLQTHGWDTVLG--TIRFLKPWSHGnFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQL--E.YPFEIQILA
ENSGGOP00000025265  AEVHLDGQPFLRCDRQKC--RAKPQGQWAEDvLGAETWDTETEDLTENGQDLRMTLTHIKDQK----E.GLHSLQEIR
ENSGGOP00000008578  VSGWLGPQQYLSYNSLRG--EAEPCGAWVWEnQVSWYWEKETTDLRIKEKLFLEAFKALGG------K.GPYTLQGLL
ENSGGOP00000014599  -------------------------------.------------------------------------.-RFLKQDKY
ENSGGOP00000021208  -------------------------------.------------------------------------.-RFLKQDKY
ENSGGOP00000017683  -------------------------------.-----------------------------------P.EDFVVQFKA
ENSGGOP00000004173  -------------------------------.-----------------------------------P.EDFVVQFKA
ENSGGOP00000018065  -------------------------------.------------------------------------.---------
ENSGGOP00000023616  -------------------------------.------------------------------------.GSHTLQSMY
ENSGGOP00000020060  -------------------------------.------------------------------------.----KQDKY
ENSGGOP00000013296  -------------------------------.-----------------------------------P.ENYLYQVRQ
ENSGGOP00000028181  -------------------------------.------------------------------------.KDFLVQFKG
ENSGGOP00000010658  -------------------------------.-----------------------------------P.EDFVIQAKA
ENSGGOP00000001005  GNASLGGHLTHVLEGPDTNTTIIQLQPL---.QEPESWARTQSGLQSYLLQFHGLVRLVHQERTL--A.FPLTIRCFL
ENSGGOP00000021762  -------------------------------.------------------------------------.----EQAKC
ENSGGOP00000024258  -------------------------------.------------------------------------.-DFLVQFKG
ENSGGOP00000000687  -------------------------------.------------------------------------.----EQAKC
ENSGGOP00000023954  -------------------------------.------------------------------------.----EQAKC
ENSGGOP00000022481  -------------------------------.------------------------------------.----EQAKC
ENSGGOP00000023682  -------------------------------.------------------------------------.----EQAKC
ENSGGOP00000023616  SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ.EGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNG---.---------
ENSGGOP00000024462  -------------------------------.-------FDPQGALRNMAVAKHNLNIMIKRYNST--.---------
ENSGGOP00000020373  -------------------------------.-------FDPQGALRNMAVAKHNLNIMIKRYNST--.---------
ENSGGOP00000025986  -------------------------------.------------------------------SRAT-P.ENSVYQERQ
ENSGGOP00000013200  -------------------------------.-----------SALRNMAVGKHTLEFMM--------.---------
ENSGGOP00000001218  -----------------------FYVDLDKK.ETVWHLEEFGRAFSFEAQGGLANIAILNNNLNIT--.---------
ENSGGOP00000009633  -------------------------------.---------AQGALANIAVDKANLEIMTKRSNYT--.---------
ENSGGOP00000010383  -------------------------------.------------------------------------.---------
ENSGGOP00000013291  -----------------------FYVDLDKK.ETVWHLEEFGRAFSFEAQGGLANIAILNNNLNIT--.---------
ENSGGOP00000001966  GTVFLNGRAFFHYNSEDR--KAEPLGPWRHV.EGVEDWEKQSQVQNAREDIFMETLNNIMEYYNDSNG.DP-------
ENSGGOP00000018454  GTVFLNGRAFFHYNSEDR--KAEPLGPWRHV.EGVEDWEKQSQVQNAREDIFMETLNNIMEYYNDSNG.DP-------
ENSGGOP00000005712  -----DQLFFFNFSQNTRVPRLPEFADWAQE.Q-----------------------------------.---------
ENSGGOP00000019648  -----DQLFFFNFSQNTRVPRLPEFADWAQE.Q-----------------------------------.---------
ENSGGOP00000022217  ALGSLNDLQFFRYNSKDR--KSQPMGLWRQV.EGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNG.DP-------
ENSGGOP00000016282  VQGQVDKKTFLHYDCGNK--RVIPISHLGKKlNVTKAWKAQNPVLREVVDMLTEQLLDI---------.---------
ENSGGOP00000010666  -------------------------------.------------------------------------.---------


                      0       110       120       130                 140             150         16
                      |         |         |         |                   |               |           
d1a1na2               GCDLGPDGRLLRGHDQSAYDGKDYIALNEDL.....SSWTA.....ADTAAQ....ITQR..KWEAARV..AEQLRAY
ENSGGOP00000023781  GCDLGPDGRLLRGYSQFAYDGKDYIALNEDL.....RSWTA.....ADTAAQ....ITQR..KWEAARE..AEQLRAY
ENSGGOP00000025096  GCDLGPDGRLLRGYSQFAYDGKDYIALNEDL.....RSWTA.....ADTAAQ....ITQR..KWEAARE..AEQLRAY
ENSGGOP00000024147  GCDLGPDGRLLRGYSQFAYDGKDYIALNEDL.....RSWTA.....ADTAAQ....ITQR..KWEAARE..AEQLRAY
ENSGGOP00000009367  GCDLGPDGRLLRGYSQFAYDGKDYIALNEDL.....RSWTA.....ADTAAQ....ITQR..KWEAARE..AEQLRAY
ENSGGOP00000022475  GCEVGPDGRFLRGYLQDAYDGKDYITLNEDL.....RSWTA.....ADMAAQ....ITQR..KWEAARE..AERLRAY
ENSGGOP00000005814  GCDVGPDGRFLRGYEQHAYDGKDYIALNEDL.....RSWTA.....ADMAAQ....ITKR..KWEAARR..AEQLRAY
ENSGGOP00000022321  GCDVGPDGRFLRGYEQHAYDGKDYIALNEDL.....RSWTA.....ADMAAQ....ITKR..KWEAARR..AEQLRAY
ENSGGOP00000027233  GCDVGSDGRFLRGYQQDAYDGKDYIASNEDL.....RSWTA.....ADMAAE....ITKR..KWEAAHF..AEQLRAY
ENSGGOP00000005655  GCDVGSDGRFLRGYQQDAYDGKDYIASNEDL.....RSWTA.....ADMAAE....ITKR..KWEAAHF..AEQLRAY
ENSGGOP00000026032  GCDLGPDGRFLRGYEQFAYDGKDYLTLNEDL.....RSWTA.....VDTAAQ....ISER..KSNDACE..AEHQRAY
ENSGGOP00000018173  GCDLGPDGRFLRGYEQFAYDGKDYLTLNEDL.....RSWTA.....VDTAAQ....ISER..KSNDACE..AEHQRAY
ENSGGOP00000024622  GCDVGSDGRFLRGYQQDAYDGKDYIASNEDL.....RSWTA.....ADMAAE....ITKR..KWEAAHF..AEQLRAY
ENSGGOP00000007343  GCDLGSDGRLLRGYEQYAYDGKDYLALNEDL.....RSWTA.....ADTAAQ....ISKR..KCEAANV..AEQRRAY
ENSGGOP00000006482  GCDLGPDGRLFRGYNQYAYDGKDYLALNEDL.....RSWTA.....ADTAAQ....ISQR..KFEAGGE..AEHQRAY
ENSGGOP00000022945  GCDLGPDGRLFRGYNQYAYDGKDYLALNEDL.....RSWTA.....ADTAAQ....ISQR..KFEAGGE..AEHQRAY
ENSGGOP00000012487  GCDLGPDGRFLRGYEQFAYDGKDYLTLNEDL.....RSWTA.....VDTAAQ....ISER..KSNDACE..AEHQRAY
ENSGGOP00000026941  GCDLGSDGRLLRGYEQYAYDGKDYLALNEDL.....RSWTA.....ADTAAQ....ISKR..KCEAANV..AEQRRAY
ENSGGOP00000009826  GCDLGSDGRLLRGYEQYAYDGKDYLALNEDL.....RSWTA.....ADTVAQ....ITQR..FYEAEEY..AEEFRTY
ENSGGOP00000019378  GCDLGSDGRLLRGYEQYAYDGKDYLALNEDL.....RSWTA.....ADTAAQ....ISKRkrFYEAEEY..AEEFRTY
ENSGGOP00000007834  GCDVGPTGL-LRRYEQFAYDGKDYIALNEDL.....RSWTA.....ANTAAQ....ISQH..KWEADKY..SEQVRAY
ENSGGOP00000026162  GCELLEDGS-TTGFLQYAYDGQDFLIFSKDT.....LSWLA.....VDNVAH....TIKQ..AWEANQHe.LLYQKNW
ENSGGOP00000001964  GCEIENNRS-SGAFWKYYYDGKDYIEFNKEI.....PAWVP.....FDPAAQ....ITKQ..KWEAEPVy.VQRAKAY
ENSGGOP00000014373  GCELHSGKV-SGSFLQLAYQGSDFVSFQNSS.....WLPYPv....AGNMAK....HFCK..VLNQNQHe.NDITHNL
ENSGGOP00000024095  GCELHSGKV-SGSFLQLAYQGSDFVSFQNSS.....WLPYPv....AGNMAK....HFCK..VLNQNQHe.NDITHNL
ENSGGOP00000006230  GCEMQEDNS-TEGYWKYGYDGQDHLEFCPDT.....LDWRA.....AEPRAW....PTKL..EWERHKIr.ARQNRAY
ENSGGOP00000005239  GCQLHSGGA-IVSFLRGALGGLDFLSVKNAS.....CVPSPe....GGSRAQ....KFCA..LIIQYQGi.METVRIL
ENSGGOP00000011482  GCEVHPGNA-SNNFFHVAFQGQDILSFQGTS.....WEPTQ.....EAPLWVn...LAIQ..VLNQDKWt.RETVQWL
ENSGGOP00000010536  VCEIHEDNS-TRSSQHFYYDGELFLSQNLET.....EEWTTpqssrAQTLAM....KVRN..FLKEDAMk.TKTHYYA
ENSGGOP00000000494  GCELHSGKS-PEGFFQVAFNGLDLLSFQNTT.....WVPSPg....CGSLAQ....SVCH..LLNHQYEgvTETVYNL
ENSGGOP00000003815  SCECEADGC-IRGSWQFSFDGQKFLLFDSNN.....RKWTV.....VHAGAR....RMKE..KWEKDSGl.TTFFKMV
ENSGGOP00000009127  FCQREAERC-TGASWQFAINGEKSLLFDAMN.....MTWTV.....INHEAS....KIKE..TWKKDRGl.EKYFRKL
ENSGGOP00000007539  SCEHEAHGL-GRGSWQFVFNGQKFLLFDSNN.....RKWTA.....LHPGAN....KMTE..KWENRDV..TMFFQKI
ENSGGOP00000007747  SCEQKAEGH-SSGSWQFSFDGQIFLLFDSEK.....RMWTM.....VHPEAR....KMKE..MWENDKDv.AMSFHYI
ENSGGOP00000003811  SCEQKAEGH-SSGSWQFSFDGQIFLLFDSEK.....RMWTM.....VHPEAR....KMKE..MWENDKDv.AMSFHYI
ENSGGOP00000021596  VCEIHEDNS-TRSSQHFYYDGELFLSQNLET.....EEWTTpqssrAQTLAM....KVRN..FLKEDAMk.TKTHYYA
ENSGGOP00000027668  VCEIHEDNS-TRSSQHFYYDGELFLSQNLET.....EEWTTpqssrAQTLAM....KVRN..FLKEDAMk.TKTHYYA
ENSGGOP00000007350  VCEIHEDNS-TRSSQHFYYDGELFLSQNLET.....EEWTTpqssrAQTLAM....KVRN..FLKEDAMk.TKTHYYA
ENSGGOP00000010415  GCRMNA----PQIFLNMAYQGSDFLSFQGIS.....WEPSPg....AGIRAQ....NVCK..ALNRYLDi.KEILQSL
ENSGGOP00000025265  VCEIHEDNS-TRSSQHFYYDGELFLSQNLET.....EEWTTpqssrAQTLAM....KVRN..FLKEDAMk.TKTHYYA
ENSGGOP00000008578  GCELGPDNT-SVPTAKFALNGEEFMNFDLKQ.....GTWGG.....DWPEAL....AISQ..RWQQQDKa.ANKELTF
ENSGGOP00000014599  ECHFFNGTERVRYLHRDIYNQEEDLRFDSDV.....GEYRA.....VTELGR....PDAE..YWNSQKDv.LEDERAS
ENSGGOP00000021208  ECHFFNGTERVRYLHRDIYNQEEDLRFDSDV.....GEYRA.....VTELGR....PDAE..YWNSQKDv.LEDERAS
ENSGGOP00000017683  MCYFTNGTERVRYVTRYIYNREESARFDSDV.....GVYRA.....VTPQGR....PDAE..YWNSHKDi.LESTRAE
ENSGGOP00000004173  MCYFTNGTERVRYVTRYIYNREESARFDSDV.....GVYRA.....VTPQGR....PDAE..YWNSHKDi.LESTRAE
ENSGGOP00000018065  TCLLDDAGTPKDFTYCISFNKDLLTCWDPEEnkmapCEFGV.....LNSLAN....VLSQ..HLNQQDTl.MQRLRNG
ENSGGOP00000023616  GCDLGPDGRLLRGYSQFAYDGKDYIALNEDL.....RSWTA.....ADTAAQ....ITQR..KWEAARE..AEQLRAY
ENSGGOP00000020060  ECHFFNGTERVRYLHRDIYNQEEDLRFDSDV.....GEYRA.....VTELGR....PDAE..YWNSQKDv.LEDERAS
ENSGGOP00000013296  ECYAFNGTQ--RFLERYIYNREEWVRFDSDV.....GEFRA.....VTEMGR....PDAE..YWNSQKDl.LEEKRAV
ENSGGOP00000028181  MCYFTNGTERVRGVARYIYNREEYGRFDSDV.....GEFQA.....VTELGR....SI-E..DWNNYKDf.LEQERAA
ENSGGOP00000010658  DCYFTNGTEKVQFVVRFIFNLEEYVRFDSHV.....GMFVA.....LTKLGQ....PDAE..QWNSRLDl.LERSREA
ENSGGOP00000001005  GCELPPESSRPHVFFEVAVNGSSFVSFRPER.....ALWQA.....DTQVTSgvvtFTLQ..QLNAYNRt.RYELREF
ENSGGOP00000021762  ECHILNGTERVQYLNRYIHKREENLRFDSDV.....GEFQA.....VTELGR....PVAE..KWNSQKEi.LEEKRDK
ENSGGOP00000024258  MCYFTNGTERVRGVARYIYNREEYGRFDSDV.....GEFQA.....VTELGR....SI-E..DWNNYKDf.LEQERAA
ENSGGOP00000000687  ECHILNGTERVQYLNRYIHKREENLRFDSDV.....GEFQA.....VTELGR....PVAE..KWNSQKEi.LEEKRDK
ENSGGOP00000023954  ECHILNGTERVQYLNRYIHKREENLRFDSDV.....GEFQA.....VTELGR....PVAE..KWNSQKEi.LEEKRDK
ENSGGOP00000022481  ECHILNGTERVQYLNRYIHKREENLRFDSDV.....GEFQA.....VTELGR....PVAE..KWNSQKEi.LEEKRDK
ENSGGOP00000023682  ECHILNGTERVQYLNRYIHKREENLRFDSDV.....GEFQA.....VTELGR....PVAE..KWNSQKEi.LEEKRDK
ENSGGOP00000023616  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000024462  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000020373  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000025986  ECYAFNGTQ--RVVDGLIYNWEEYVHFDSAV.....GEFLA.....VMELGR....PIGE..YFNSQKDf.MERKRAE
ENSGGOP00000013200  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000001218  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000009633  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000010383  -----------SGQFTHEFDGEQLFSVDLKK.....SE---.....------....----..-------..-------
ENSGGOP00000013291  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000001966  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000018454  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000005712  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000019648  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000022217  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000016282  -------------------------------.....-----.....------....----..-------..-------
ENSGGOP00000010666  --------------------------LSSHV.....GMFVA.....LTKLGQ....PDAE..QWNSRLDl.LERSREA


                      0       170       180                                               
                      |         |         |                                               
d1a1na2               LEGLCVEWLRRYLENGKETLQR..............................................
ENSGGOP00000023781  LEGTCVEWLRRYLENGRETLQR..............................................
ENSGGOP00000025096  LEGTCVEWLRRYLENGRETLQR..............................................
ENSGGOP00000024147  LEGTCVEWLRRYLENGRETLQR..............................................
ENSGGOP00000009367  LEGTCVEWLRRYLENGRETLQR..............................................
ENSGGOP00000022475  MEGTCVEWLRRYLENGKETLQR..............................................
ENSGGOP00000005814  LEGEFVEWLRRYLENGKETLQR..............................................
ENSGGOP00000022321  LEGEFVEWLRRYLENGKETLQR..............................................
ENSGGOP00000027233  LEGTCVEWLRRYLENGKETLQR..............................................
ENSGGOP00000005655  LEGTCVEWLRRYLENGKETLQR..............................................
ENSGGOP00000026032  LEDTCVEWLRKYLEKGKETL--l.............................................
ENSGGOP00000018173  LEDTCVEWLRKYLEKGKETL--l.............................................
ENSGGOP00000024622  LEGTCVEWLRRYLENGKETLQR..............................................
ENSGGOP00000007343  LEGTCVEWLHRYLENGKEMLQR..............................................
ENSGGOP00000006482  LEGLCVESLRRYLENGKETLQR..............................................
ENSGGOP00000022945  LEGLCVESLRRYLENGKETLQR..............................................
ENSGGOP00000012487  LEDTCVEWLRKYLEKGKETL--l.............................................
ENSGGOP00000026941  LEGTCVEWLHRYLENGKEMLQR..............................................
ENSGGOP00000009826  LEGECLELLRRYLENGKETLQR..............................................
ENSGGOP00000019378  LEGECLELLRRYLENGKETLQR..............................................
ENSGGOP00000007834  -EGKCMEWLRRHLENS------sec...........................................
ENSGGOP00000026162  LEEECIAWLKRFLEYGKDTLQR..............................................
ENSGGOP00000001964  LEEECPATLRKYLKYSKNILDR..............................................
ENSGGOP00000014373  LSDTCPRFILGLLDAGKAHLQR..............................................
ENSGGOP00000024095  LSDTCPRFILGLLDAGKAHLQR..............................................
ENSGGOP00000006230  LERDCPAQLQQLLELGRGLL--..............................................
ENSGGOP00000005239  LYETCPRYLLGVLNAGKADLQR..............................................
ENSGGOP00000011482  LNGTCPQFVSGLLESGKSELEK..............................................
ENSGGOP00000010536  MHADCLQELRQYVESG------..............................................
ENSGGOP00000000494  IRSTCPRFLLGLLDAGKMYVH-r.............................................
ENSGGOP00000003815  SMGDCKSWLRDFLMHRKK----..............................................
ENSGGOP00000009127  SKGDCDHWLREFLGHWE-----a.............................................
ENSGGOP00000007539  SLGDCKMWLEEFLMYWEQ----m.............................................
ENSGGOP00000007747  SMGDCAGWLEDFL---------m.............................................
ENSGGOP00000003811  SMGDCAGWLEDFL---------m.............................................
ENSGGOP00000021596  MHADCLQELRQYVESG------..............................................
ENSGGOP00000027668  MHADCLQELRQYVESG------..............................................
ENSGGOP00000007350  MHADCLQELRQYVESG------..............................................
ENSGGOP00000010415  LGHTCPRFLAGLMEAGESELKR..............................................
ENSGGOP00000025265  MHADCLQELRQYVESG------..............................................
ENSGGOP00000008578  LLFSCPHRLREHLERGRGNLE-w.............................................
ENSGGOP00000014599  VDTYCRHN--------------ygvvesftvqr...................................
ENSGGOP00000021208  VDTYCRHN--------------ygvvesftvqr...................................
ENSGGOP00000017683  LDTVCRNNY-------------evafrgilqr....................................
ENSGGOP00000004173  LDTVCRNNY-------------evafrgilqr....................................
ENSGGOP00000018065  LQN-------------------cathtqpfwgsltnrtr.............................
ENSGGOP00000023616  LEGTCVEWLRRYLENGRETLQR..............................................
ENSGGOP00000020060  VDTYCRHNY-------------gvvesftvqr....................................
ENSGGOP00000013296  PDRICRHNY-------------eldeavtlqr....................................
ENSGGOP00000028181  VDKVCRHNYE------------aelrttlqr.....................................
ENSGGOP00000010658  VDGVCRHNYR------------lgapftvgr.....................................
ENSGGOP00000001005  LEDTCVQYVQKH----------..............................................
ENSGGOP00000021762  VDTYCRY---------------sygvfesftvpr..................................
ENSGGOP00000024258  VDKVCRHNY-------------eael..........................................
ENSGGOP00000000687  VDTYCRY---------------sygvfesftvpr..................................
ENSGGOP00000023954  VDTYCRY---------------sygvfesftvpr..................................
ENSGGOP00000022481  VDTYCRY---------------sygvfesftvtr..................................
ENSGGOP00000023682  VDTYCRY---------------sygvfesftvrr..................................
ENSGGOP00000023616  ----------------------r.............................................
ENSGGOP00000024462  ----------------------aatn..........................................
ENSGGOP00000020373  ----------------------aatn..........................................
ENSGGOP00000025986  VDKVCRHKY-------------elmeplirqr....................................
ENSGGOP00000013200  ----------------------rqsnstaatn....................................
ENSGGOP00000001218  ----------------------iqcsnhtqaa....................................
ENSGGOP00000009633  ----------------------pit...........................................
ENSGGOP00000010383  ----------------------avwrlpefgdfarfdpqgglagiaaikahldilversnrsrainvp
ENSGGOP00000013291  ----------------------iqcsnhtqaa....................................
ENSGGOP00000001966  ----------------------p.............................................
ENSGGOP00000018454  ----------------------p.............................................
ENSGGOP00000005712  ----------------------gdapailfdkefcesmiqqigpqvdgkip.................
ENSGGOP00000019648  ----------------------gdapailfdkefcesmiqqigpqvdgkip.................
ENSGGOP00000022217  ----------------------ps............................................
ENSGGOP00000016282  ----------------------qlen..........................................
ENSGGOP00000010666  VDGVCRHNYR------------lgapftvgr.....................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0034827 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Saccharomyces mikatae MIT
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Aquilegia coerulea v195
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Cyclobacterium marinum DSM 745
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum GMI1000
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]