SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

4Fe-4S ferredoxins alignments in PDB chains (SCOP 1.75)

These alignments are sequences aligned to the 0045859 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1b0pa5  ......................................................................................ts--Q
1jnrB  .......................................................................................f---
1hfeL  ........................................................................rieyemhtpdpkadpd---
2v4jB  .........................................................................dhewtdqlceiplav---
1kqfB  .................................................................................ykaevak---
1y5iB  ..................................................................................mkirsq---
2fug9  ................................................................ypdapvalkprfhgrhvltrhpng---
2fug3  ......................sdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrr--H
3c8yA  ....................................................................................ders---
1gteA  qspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaafpplerkpfipkkpipaikdvigkalqylgtfgels---
1h7xA  qspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaafpplerkpfipkkpipaikdvigkalqylgtfgels---
1y4zB  ..................................................................................mkirsq---
2c42A  ..................................................................................fplgts--Q

              10        20             30        40                                                 
               |         |              |         |                                                 
d1b0pa5  FEKRGVAINVPQWVPENCIQCNQ.....CAFVCPHSAILPVLAK....................................EEE........
1jnrB  ------------VNPEKCDGCKAlertaCEYICPNDLMTL----....................................---........
1hfeL  ------KLHFVQIDEAKCIGCDT.....CSQYCPTAAIFGEMGE....................................PH-........
2v4jB  -----------------------.....--ASCPTAAVRP----....................................---........
1kqfB  -----------LIDVSTCIGCKA.....CQVACSEWNDIRDEVGhcvgvydnpadlsakswtvmrfseteqngklewlirKDG........
1y5iB  --------VGMVLNLDKCIGCHT.....CSVTCKNVWTSREGVE....................................YAWfnnvetkp
2fug9  --------------LEKCIGCSL.....CAAACPAYAIYVEPAE....................................NDP........
2fug3  VDKHHPLSPFVILDRERCIHCKR.....CVR-------------....................................---........
1vlfN  -------QYYMVIDVAKCQDCNN.....CFMGCMDEHELNEWPGytasmqrghrwmnierrergtyprndinyr......PTP........
3c8yA  --------KSLTVDRTKCLLCGR.....CVNACGKNTETYAMKF....................................LN-........
1gteA  ----NIEQVVAVIDEEMCINCGK.....CYMTCNDSGYQAIQFD....................................P--........
1h0hB  ----------FFVDTTRCTACRG.....CQVACKQWHGNPATPTentgfhqnppdfnfhtyklvrmheqeidgridwlffPDQ........
1h7xA  ----NIEQVVAVIDEEMCINCGK.....CYMTCNDSGYQAIQFD....................................P--........
1y4zB  --------VGMVLNLDKCIGCHT.....CSVTAKNVWTS-----....................................--Regveyawf
2c42A  FEKRGVAINVPQWVPENCIQCNQ.....CAFVCPHSAILPVLAK....................................EEE........

d1b0pa5  ...........................................................................................
1jnrB  ...........................................................................................
1hfeL  ...........................................................................................
2v4jB  ...........................................................................................
1kqfB  ...........................................................................................
1y5iB  gqgfptdwenqekykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsksqpiarprslitgermakie
2fug9  ...........................................................................................
2fug3  ...........................................................................................
1vlfN  ...........................................................................................
3c8yA  ...........................................................................................
1gteA  ...........................................................................................
1h0hB  ...........................................................................................
1h7xA  ...........................................................................................
1y4zB  nnvetkpgqgfptdwenqekykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsksqpiarprslitg
2c42A  ...........................................................................................

                                                                 50        60        70             
                                                                  |         |         |             
d1b0pa5  ...................................................LVGA..PANFTALEAKGKELKGYKFRIQINTLDC......
1jnrB  ...................................................----..-------------DKEKMKAYNREPDMC......
1hfeL  ...................................................----..--------------------SIPHIEAC......
2v4jB  ...................................................----..--------TKLEIGDKKVNTIAIKNERC......
1kqfB  ...................................................CMHCedPGCLKACPSAGAIIQYANGIVDFQSENC......
1y5iB  .......kgpnweddlggefdklakdknfdniqkamysqfentfmmylprlCEHClnPACVATCPSGAIYKREEDGIVLIDQDKC......
2fug9  ...................................................----..-----ENPVSAGER--YAKVYEINMLRC......
2fug3  ...................................................----..----------------------------......
1vlfN  ...................................................CMHCenAPCVAKGNGAVYQRED--GIVLIDPEKA......
3c8yA  ...................................................----..--------KNGKTIIGAEDEKCFDDTNC......
1gteA  ...................................................----..-----------------ETHLPTVTDTC......
1h0hB  ...................................................CRHCiaPPCKATADMEDESAII-----HDDATGCvlftpk
1h7xA  ...................................................----..-----------------ETHLPTVTDTC......
1y4zB  ermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmylprlCEHClnPACVATCPSGAIYKREEDGIVLIDQDKC......
2c42A  ...................................................LVGA..PANFTALEAKGKELKGYKFRIQINTLDC......

              80          90         100                    110                                     
               |           |           |                      |                                     
d1b0pa5  ....MGCGNCADICPPkeKALVMQ-.---.-------.............-----------pldtqrdaqvpnleyaarip..........
1jnrB  ....WECYSCVKMCPQ..GAIDVRG.YVD.-------.............-----------ysplggacvpmrgtsdimwtvkyrngkvlr
1hfeL  ....INCGQCLTHCPE..NAIY---.---.-------.............-----------..............................
2v4jB  ....MYCGNCYTMCP-..-------.---.-------.............-----------a.............................
1kqfB  ....IGCGYCIAGCPF..NIPRLNK.EDNrVYKCTLCvdrvsvgqe....PACVKTCPTGAihfgtkkemlelaeqrvaklkargyehagv
1y5iB  ....RGWRMCITGCPY..KKIYFNWkSGK.SEKCIFCyprieagqp....TVCSETC----vgrirylgvllydadaieraastenekdly
2fug9  ....IFCGLCEEACPT..GAIVLGY.DFE.M------.............-----------adyeysdlvygkedmlvdvvgtkpqrreak
2fug3  ....------------..-------.---.-------.............-----------yfeevpgdevldfiergvhtfigtmdfglp
1vlfN  ....KGKKELLDTCPY..GVMYWNE.EENvAQKCTMCahllddeswapkmPRCAHNC----gsfvyeflkttpeamakkveeeglevikpe
3c8yA  ....LLCGQCIIACPV..AALS---.---.-------.............-----------e.............................
1gteA  ....TGCTLCLSVCPIi.DCIRMV-.---.-------.............-----------srttpye.......................
1h0hB  tkdlEDYESVISACPY..DVPRKVA.ESNqMAKCDMCidritnglr....PACVTSCPTGAmnfgdlsemeamasarlaeikaaysdaklc
1h7xA  ....TGCTLCLSVCPIi.DCIRMV-.---.-------.............-----------srttpye.......................
1y4zB  ....RGWRMCITGCPY..KKIYFNWkSGK.SEKCIFCyprieagqp....TVCSETC----vgrirylgvllydadaieraastenekdly
2c42A  ....MGCGNCADICPPkeKALVMQ-.---.-------.............-----------pldtqrdaqvpnleyaaripvksevlprds

d1b0pa5  ...........................................................................................
1jnrB  fkfairttpwgsiqpfegfpepteealksellagepeiigtsefp..............................................
1hfeL  ...........................................................................................
2v4jB  ...........................................................................................
1kqfB  ynpegvggthvmyvlhhadqpelyhglpkdpkidtsvslwkgalkplaa..........................................
1y5iB  qrqldvfldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvpplspiqsaadagelgsngilpdveslr
2fug9  rtgkpvkvgyvvpyvrpel........................................................................
2fug3  sgfsgnitdicpvgalldltarfra..................................................................
1vlfN  lgtkprvyyknlyr.............................................................................
3c8yA  ...........................................................................................
1gteA  ...........................................................................................
1h0hB  dpddvrvifltahnpklyhe.......................................................................
1h7xA  ...........................................................................................
1y4zB  qrqldvfldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvpplspiqsaadagelgsngilpdveslr
2c42A  lkgsqfqeplmefsgacsgcgetpyvrvitqlfgerm......................................................

d1b0pa5  ...........................................................................................
1jnrB  ...........................................................................................
1hfeL  ...........................................................................................
2v4jB  ...........................................................................................
1kqfB  ...........................................................................................
1y5iB  ipvqylanlltagdtkpvlralkrmlamrhykraetvdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekng
2fug9  ...........................................................................................
2fug3  ...........................................................................................
1vlfN  ...........................................................................................
3c8yA  ...........................................................................................
1gteA  ...........................................................................................
1h0hB  ...........................................................................................
1h7xA  ...........................................................................................
1y4zB  ipvqylanlltagdtkpvlralkrmlamrhykraetvdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekng
2c42A  ...........................................................................................

d1b0pa5  .............................
1jnrB  .............................
1hfeL  .............................
2v4jB  .............................
1kqfB  .............................
1y5iB  cgftfgdgchgsdtkfnlfnsrridaidv
2fug9  .............................
2fug3  .............................
1vlfN  .............................
3c8yA  .............................
1gteA  .............................
1h0hB  .............................
1h7xA  .............................
1y4zB  cgftfgdgchgsdtkfnlfnsrridaidv
2c42A  .............................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045859 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Amphimedon queenslandica
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Aspergillus zonatus v1.0
NoYes   Phytophthora capsici
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter arilaitensis Re117
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. FB24
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Veillonella parvula DSM 2008
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium cellulolyticum H10
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium lentocellum DSM 5427
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus plantarum JDM1
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus clausii KSM-K16
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium tepidum TLS
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Nitratiruptor sp. SB155-2
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Pandoraea sp. RB-44
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Alicycliphilus denitrificans K601
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Magnetococcus marinus MC-1
NoYes   Caulobacter sp. K31
NoYes   Phenylobacterium zucineum HLK1
NoYes   Maricaulis maris MCS10
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Roseobacter denitrificans OCh 114
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum brasilense Sp245
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium meliloti AK83
NoYes   Methylocella silvestris BL2
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus halophilus Nc4
NoYes   gamma proteobacterium HdN1
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Erwinia billingiae Eb661
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Moraxella catarrhalis RH4
NoYes   Methylophaga sp. JAM1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Aeropyrum pernix K1
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium diphtheriae BH8
NoYes   Corynebacterium diphtheriae INCA 402
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae HC02
NoYes   Corynebacterium diphtheriae HC01
NoYes   Corynebacterium diphtheriae 241
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Corynebacterium diphtheriae PW8
NoYes   Corynebacterium diphtheriae C7 (beta)
NoYes   Corynebacterium diphtheriae 31A
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. VS
NoYes   Dehalococcoides sp. CBDB1
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus oshimai JL-2
NoYes   Thermus thermophilus JL-18
NoYes   Thermus thermophilus SG0.5JP17-16
NoYes   Thermus thermophilus HB8
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium sp. SY8519
NoYes   Clostridium pasteurianum BC1
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Lactobacillus fermentum F-6
NoYes   Lactobacillus fermentum CECT 5716
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus reuteri I5007
NoYes   Lactobacillus reuteri JCM 1112
NoYes   Lactobacillus reuteri SD2112
NoYes   Lactobacillus plantarum WCFS1
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus coagulans 36D1
NoYes   Staphylococcus aureus subsp. aureus MSHR1132
NoYes   Staphylococcus pseudintermedius ED99
NoYes   Staphylococcus pasteuri SP1
NoYes   Staphylococcus lugdunensis N920143
NoYes   Staphylococcus warneri SG1
NoYes   Staphylococcus epidermidis ATCC 12228
NoYes   Staphylococcus aureus CA-347
NoYes   Staphylococcus aureus Bmb9393
NoYes   Staphylococcus aureus M1
NoYes   Staphylococcus aureus 08BA02176
NoYes   Staphylococcus aureus ST228/18412
NoYes   Staphylococcus aureus ST228/18341
NoYes   Staphylococcus aureus ST228/16125
NoYes   Staphylococcus aureus ST228/16035
NoYes   Staphylococcus aureus ST228/15532
NoYes   Staphylococcus aureus ST228/10497
NoYes   Staphylococcus aureus ST228/10388
NoYes   Staphylococcus aureus 04-02981
NoYes   Staphylococcus aureus RF122
NoYes   Staphylococcus aureus subsp. aureus Z172
NoYes   Staphylococcus aureus subsp. aureus 6850
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus CN1
NoYes   Staphylococcus aureus subsp. aureus SA40
NoYes   Staphylococcus aureus subsp. aureus 11819-97
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Staphylococcus aureus subsp. aureus HO 5096 0412
NoYes   Staphylococcus aureus subsp. aureus VC40
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Staphylococcus aureus subsp. aureus ECT-R 2
NoYes   Staphylococcus aureus subsp. aureus JKD6159
NoYes   Staphylococcus aureus subsp. aureus ED133
NoYes   Staphylococcus aureus subsp. aureus ED98
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Staphylococcus aureus subsp. aureus 55/2053
NoYes   Staphylococcus aureus subsp. aureus TCH60
NoYes   Staphylococcus aureus subsp. aureus str. JKD6008
NoYes   Staphylococcus aureus subsp. aureus 71193
NoYes   Staphylococcus aureus subsp. aureus S0385
NoYes   Staphylococcus aureus subsp. aureus str. Newman
NoYes   Staphylococcus aureus subsp. aureus Mu3
NoYes   Staphylococcus aureus subsp. aureus USA300_TCH1516
NoYes   Staphylococcus aureus subsp. aureus USA300_FPR3757
NoYes   Staphylococcus aureus subsp. aureus JH9
NoYes   Staphylococcus aureus subsp. aureus MSSA476
NoYes   Staphylococcus aureus subsp. aureus MRSA252
NoYes   Staphylococcus aureus subsp. aureus MW2
NoYes   Staphylococcus aureus subsp. aureus N315
NoYes   Staphylococcus aureus subsp. aureus Mu50
NoYes   Staphylococcus aureus subsp. aureus COL
NoYes   Staphylococcus aureus subsp. aureus NCTC 8325
NoYes   Chlorobium phaeobacteroides BS1
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis G2136
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis M01-240355
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria gonorrhoeae TCDC-NG08107
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Candidatus Kinetoplastibacterium oncopeltii TCC290E
NoYes   Candidatus Kinetoplastibacterium desouzaii TCC079E
NoYes   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
NoYes   Candidatus Kinetoplastibacterium crithidii TCC036E
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Sulfuricella denitrificans skB26
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Mannheimia succiniciproducens MBEL55E
NoYes   Bibersteinia trehalosi USDA-ARS-USMARC-192
NoYes   Aggregatibacter actinomycetemcomitans ANH9381
NoYes   Aggregatibacter actinomycetemcomitans D11S-1
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Haemophilus parasuis ZJ0906
NoYes   Haemophilus influenzae KR494
NoYes   Haemophilus influenzae 10810
NoYes   Haemophilus influenzae PittGG
NoYes   Haemophilus influenzae 86-028NP
NoYes   Haemophilus influenzae R2866
NoYes   Haemophilus influenzae R2846
NoYes   Haemophilus influenzae Rd KW20
NoYes   Actinobacillus suis H91-0380
NoYes   Actinobacillus pleuropneumoniae serovar 3 str. JL03
NoYes   Actinobacillus pleuropneumoniae serovar 7 str. AP76
NoYes   Vibrio sp. EJY3
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella sp. MR-7
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alcanivorax dieselolei B5
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Spiribacter salinus M19-40
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis AJ13355
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter junii SH205
NoYes   Aeropyrum camini SY1 = JCM 12091
NoYes   Sulfolobus islandicus LAL14/1
NoYes   Sulfolobus islandicus REY15A
NoYes   Sulfolobus islandicus M.16.27
NoYes   Sulfolobus islandicus M.14.25
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Natronococcus occultus SP4
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP10 from Narrow Gauge (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]