SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

RNA-binding domain, RBD alignments in Monodelphis domestica 76_5

These alignments are sequences aligned to the 0049769 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1u1qa_               ..........................................................................ke--
ENSMODP00000007717  ...........................................................................f--
ENSMODP00000022014  ...........................................................................f--
ENSMODP00000029058  ............................................................................--
ENSMODP00000027267  ...........................................................................f--
ENSMODP00000023398  ...........................................................................d--
ENSMODP00000037814  ...........................................................................d--
ENSMODP00000021348  ...........................................................................f--
ENSMODP00000027586  ...........................................................................f--
ENSMODP00000022014  ..........................................................................ma--
ENSMODP00000029058  ...........................................................................a--
ENSMODP00000021348  ..........................................................................ta--
ENSMODP00000027586  ..........................................................................ma--
ENSMODP00000037814  ..........................................................................pt--
ENSMODP00000004837  ...........................................................................a--
ENSMODP00000020923  ...........................................................................d--
ENSMODP00000007717  ..........................................................................ma--
ENSMODP00000024842  ...........................................................................d--
ENSMODP00000006200  ...........................................................................a--
ENSMODP00000036724  ...........................................................................d--
ENSMODP00000004717  ...........................................................................a--
ENSMODP00000008249  ...........................................................................a--
ENSMODP00000027604  ...........................................................................a--
ENSMODP00000023901  ...........................................................................d--
ENSMODP00000023578  ...........................................................................d--
ENSMODP00000007804  ..........................................................................pe--
ENSMODP00000034649  ..........................................................................pe--
ENSMODP00000018486  ...........................................................................d--
ENSMODP00000006475  ............................................................................--
ENSMODP00000014208  ...........................................................................g--
ENSMODP00000040531  ............................................................................--
ENSMODP00000010059  .....................ggsldavpknwfritipygrkydktwllnslqskcsvpftpvefhyentraqffv--
ENSMODP00000013841  ............................................................................--
ENSMODP00000014054  ............................................................................--
ENSMODP00000009994  ...........................................................................r--
ENSMODP00000004654  ...........................................................................y--
ENSMODP00000001901  ...........................................................................m--
ENSMODP00000038186  ...........................................................................s--
ENSMODP00000029243  .................................................................kmddqekllkk--
ENSMODP00000012172  ..........................................................................sk--
ENSMODP00000019849  ...............................................................rgdkkdqekllqk--
ENSMODP00000000959  .........................................................................ran--
ENSMODP00000003831  ............................................................................--
ENSMODP00000016570  .........................................................................ran--
ENSMODP00000022371  ...........................................................................r--
ENSMODP00000034857  ................................................................gkmedqekllkk--
ENSMODP00000034858  ................................................................gkmedqekllkk--
ENSMODP00000005475  ...........................................................................s--
ENSMODP00000022505  ...........................................................................f--
ENSMODP00000003848  ...........................................................................s--
ENSMODP00000004397  ..........................................................................sg--
ENSMODP00000001893  .....................................................................pppdveg--
ENSMODP00000017573  ..........................................................................pg--
ENSMODP00000004247  ...........................................................................y--
ENSMODP00000001568  ..........................................................................pp--
ENSMODP00000012202  ........................................................................nran--
ENSMODP00000031808  ..........................................................................at--
ENSMODP00000006523  ........................................................................masd--
ENSMODP00000019256  ...........................................................................p--
ENSMODP00000031416  .......................................................................pavdr--
ENSMODP00000022875  ...........................................................................t--
ENSMODP00000025722  ..........................................................................pp--
ENSMODP00000013678  ...........................................................................s--
ENSMODP00000019066  ......................................................................fdnrsh--
ENSMODP00000014920  ...........................................................................t--
ENSMODP00000011039  .....................................................................qkkdtsn--
ENSMODP00000025181  .........................................................................psk--
ENSMODP00000006917  ...........................................................................l--
ENSMODP00000028798  .........................................................................rsq--
ENSMODP00000031317  ...........................................................................g--
ENSMODP00000001566  .....................................................ttngpssngrncpspmqtgattd--
ENSMODP00000034177  ..........................................................................gp--
ENSMODP00000015039  .....................................................................swhaeyk--
ENSMODP00000023377  ..................................................................epgpqrsveg--
ENSMODP00000004837  ...................................................................pvdsgnted--
ENSMODP00000021002  ..............................................................llemvgdlpdadik--
ENSMODP00000027677  .......................lsnqiplskqwfkvtisngrnydktwllstlrgkcnvalnpvdfhyddkkalf--
ENSMODP00000022505  ...........................................................................h--
ENSMODP00000001487  ...........................................................................l--
ENSMODP00000038918  ........................................................................dnnk--
ENSMODP00000011435  ...........................................................................n--
ENSMODP00000011432  ...........................................................................n--
ENSMODP00000006345  ........................................................................dnnk--
ENSMODP00000024718  ........................................................................hltv--
ENSMODP00000009844  ...........................................................................r--
ENSMODP00000003000  .......................................................................aprnq--
ENSMODP00000014933  ...........................................................................e--
ENSMODP00000022015  ..........................................................................tk--
ENSMODP00000015618  ......................................................................kgvsgd--
ENSMODP00000001920  ....................................................................rpppdveg--
ENSMODP00000027267  ..............................................................wsqrdpslrksgvg--
ENSMODP00000026325  ..............................................dlpsafiacnldprvfvdslcrakfeslfr--
ENSMODP00000013647  ....................................................fkkpapspcpkrsgkmhttqkdtt--
ENSMODP00000020553  .......................................................cslsggrppagtmhtlqkdtt--
ENSMODP00000003678  .........................................................................tgg--
ENSMODP00000029789  ..........................................................................ql--
ENSMODP00000000721  .........................................................................vtv--
ENSMODP00000006200  .........................................................................igr--
ENSMODP00000004743  .................................................................fqgtamekves--
ENSMODP00000014913  ..........................................................................ke--
ENSMODP00000038918  .........................................................................eig--
ENSMODP00000006371  ......................................................vppslrdgasrrgesmqpnrra--
ENSMODP00000006345  .........................................................................eig--
ENSMODP00000015438  ..................................................spspnpvspvplnnptsaprfgtvip--
ENSMODP00000008450  ...........................................................................k--
ENSMODP00000010490  .......................................................................plrgk--
ENSMODP00000007208  ........................................................aaqtdgqpqtqpsentenks--
ENSMODP00000024712  ............................................................................--
ENSMODP00000017405  ..........................................................................ad--
ENSMODP00000001337  ........................................................qtdgqqsqtqssenteskst--
ENSMODP00000028798  ...........................................................................p--
ENSMODP00000002547  .......................................................................ntdkq--
ENSMODP00000005593  .......................................................................ekmea--
ENSMODP00000018401  .......................................................................ahakv--
ENSMODP00000014913  ...........................................................................e--
ENSMODP00000016281  ...........................................................................p--
ENSMODP00000004397  ...........................................................ldapseeddddddeegl--
ENSMODP00000000006  ...........................................................................p--
ENSMODP00000020576  ...................................................tgyslvqengqrkyggpppgwdaap--
ENSMODP00000005194  ......................................................................mamkkd--
ENSMODP00000002993  ...........................................................................l--
ENSMODP00000015362  ...........................................................................n--
ENSMODP00000004717  ...................................................................pedsgacss--
ENSMODP00000018934  ........................................................................adkk--
ENSMODP00000027604  .....................................................................passgss--
ENSMODP00000002993  .........................................................................arv--
ENSMODP00000000363  ...........................................................................d--
ENSMODP00000014933  .....................................................................nasknqq--
ENSMODP00000016940  ...........................................................................d--
ENSMODP00000007822  .......................................................................gqspv--
ENSMODP00000002891  ...........................................................................w--
ENSMODP00000003337  ........................................................................kkgp--
ENSMODP00000005194  .........................................................................dag--
ENSMODP00000008450  .....................................................................nasknqq--
ENSMODP00000017452  ..............................................................gsswedpsllewda--
ENSMODP00000010785  ..........................................................................ge--
ENSMODP00000010799  ...................................................................spvdpdeds--
ENSMODP00000004654  ........................................................................arka--
ENSMODP00000022797  ...........................................................................r--
ENSMODP00000016382  .....................................sdlptslfacsvhetvfevqeqkerfealftlyddqvtf--
ENSMODP00000003786  ............................................................................--
ENSMODP00000017322  .......................................................................kelpt--
ENSMODP00000020165  ...................................................................dpevmakvk--
ENSMODP00000010787  ..........................................................................ge--
ENSMODP00000001412  ........................................................................ssss--
ENSMODP00000015013  ......................................................................aeykes--
ENSMODP00000003000  ..........................................................................kk--
ENSMODP00000011795  ...............................................................ygdggstfqsttg--
ENSMODP00000022875  ..........................................................................vk--
ENSMODP00000028798  .......................................................................vnqss--
ENSMODP00000003337  ...............................................glmnlppsilnnpnippevisnlqagrlg--
ENSMODP00000018401  ...........................................................................l--
ENSMODP00000019828  ..........................................................................pk--
ENSMODP00000011039  ......................................................................vvnqss--
ENSMODP00000010024  ...........................................................................a--
ENSMODP00000023575  ........................................................stlvacvvdveiftnqevke--
ENSMODP00000001566  ..........................................................................rd--
ENSMODP00000031345  ..........................................................................ek--
ENSMODP00000011039  ..........................................................................gq--
ENSMODP00000017614  ................................................rhervvvirnmfhpkdfeedplvlneir--
ENSMODP00000011435  ............................................................................--
ENSMODP00000011432  ............................................................................--
ENSMODP00000035735  .....................................................ysmiqengqrkyggpppgweglh--
ENSMODP00000001944  ...........................................................................h--
ENSMODP00000036858  ............................................................gpppdsvysgqqpsvg--
ENSMODP00000005193  .......................................................................aqspv--
ENSMODP00000028751  .............................................................eapdldlgppvdpde--
ENSMODP00000039173  ...............................................................ygdggstfqrttd--
ENSMODP00000006815  .......................................................................pgqsp--
ENSMODP00000020576  ....................................................................dedtmssv--
ENSMODP00000025722  ....................................................................dedvmetv--
ENSMODP00000002300  ...................................................................srhdseqdn--
ENSMODP00000003786  ......................................................................gppvrt--
ENSMODP00000023826  ..........................................................................vr--
ENSMODP00000033056  ............................................................................--
ENSMODP00000009807  ............................................................................--
ENSMODP00000018415  .....................................................astqsssatasqgyvlpegkimp--
ENSMODP00000000175  ..................................................................ankpekltpg--
ENSMODP00000039175  .....................................................astqsssatasqgyvlpegkimp--
ENSMODP00000036858  .........................................................vewadpiedpdpevmakvk--
ENSMODP00000008249  ...................................................................lvstngatd--
ENSMODP00000032411  ......................................................................cgeqls--
ENSMODP00000001944  ........................................................................rsph--
ENSMODP00000009227  ...........................................................................l--
ENSMODP00000007480  ...........................................................................y--
ENSMODP00000011795  ................................................................gpnspdtandgf--
ENSMODP00000002604  ...........................................................................n--
ENSMODP00000021564  .............................................................ggagdassgfhgghf--
ENSMODP00000036078  ...........................................................................y--
ENSMODP00000010024  ............................................................................--
ENSMODP00000013583  .........................................................qrnissvpddyapgshdvg--
ENSMODP00000013581  .........................................................qrnissvpddyapgshdvg--
ENSMODP00000001370  ............................................................................--
ENSMODP00000010502  ....................................................................nkpeklss--
ENSMODP00000018934  ......................................................................psdvne--
ENSMODP00000031808  ...........................................................................t--
ENSMODP00000013458  ...................................................feprslinsdkgfvtmtlqspeelq--
ENSMODP00000004397  .........................................................................qrt--
ENSMODP00000002817  .................................................................kipmfasyspg--
ENSMODP00000024842  ....................................................................dhpdqpdl--
ENSMODP00000021564  .......................................................................aasdg--
ENSMODP00000035400  ........................................................................hdvg--
ENSMODP00000003000  ...................................................................nswsgnnsk--
ENSMODP00000007934  ......................................................................dppddk--
ENSMODP00000001484  ...........................................................................g--
ENSMODP00000008195  ...................................................................tnktdprsm--
ENSMODP00000001568  .....................................................................etmqrvk--
ENSMODP00000010946  ........................................................................sgss--
ENSMODP00000003430  ................................................................nitnkndpksln--
ENSMODP00000007024  .......................................................................kpkdv--
ENSMODP00000011964  ......................................................................dppddk--
ENSMODP00000024532  ...........................................................pqpplmgnvdpskidei--
ENSMODP00000004397  ............................................................................--
ENSMODP00000032411  .....................................................................qmakqqe--
ENSMODP00000010717  ................................................................sggshhkvsvsp--
ENSMODP00000008758  ...........................................................................m--
ENSMODP00000021972  ..................................................................tsktdpcsmn--
ENSMODP00000035735  .....................................................................edvmetv--
ENSMODP00000018834  ....................................................spprsrkgpfrrsdsfpeyrgprk--
ENSMODP00000020165  ......................................................gqrkyggpppdsvysgvqpgig--
ENSMODP00000031345  .........................................................................dsn--
ENSMODP00000023979  ..........................................................................yp--
ENSMODP00000015407  ......................ssddrrndryddyrdydsperererrnsdrsedgyhsdgdygehdyrndindew--
ENSMODP00000014946  ...............................................................gkpdqkfeqkpel--
ENSMODP00000003584  ..................................................................lsvfksyepg--
ENSMODP00000007822  .......................................................................tgagn--
ENSMODP00000002891  ...................................................................qrpgtdltv--
ENSMODP00000016781  .............................................................ggenyddphktpasp--
ENSMODP00000009227  ...................................................................rketrtfks--
ENSMODP00000018934  ...........................................................................l--
ENSMODP00000011795  .......................................................................eggeg--
ENSMODP00000029701  ............................................................................--
ENSMODP00000011218  ..........................................................................yp--
ENSMODP00000007822  ..................................................................fkgdnrspgv--
ENSMODP00000001901  srskerrrsrsrsrerrfrgryrspysgpkfnsairgkiglphsiklsrrrsrskspfrkdkspvrepidnltpee--
ENSMODP00000005193  ........................................................................mdga--
ENSMODP00000013253  .............................................................lddtwvtvfgfpqas--
ENSMODP00000001062  ............................................................................--
ENSMODP00000006815  ..........................................................................sv--
ENSMODP00000012172  ...........................................................................f--
ENSMODP00000005193  ....................................................................mpgvsagg--
ENSMODP00000000232  ......................................................pekkqkgekrkpepgwfhveed--
ENSMODP00000034177  .........................................................hyrekspvrepidnlspee--
ENSMODP00000006415  ............................................................................--
ENSMODP00000035735  ............................................................................--
ENSMODP00000023866  ......................................................................dsesdn--
ENSMODP00000026309  ......................rsrrsrhrrsrsrsrerrrhsprsrsqerrererererrqkglpqikpetasvc--
ENSMODP00000041019  .............................................................qtsnvtnkndpksin--
ENSMODP00000001219  ...........................................................................n--
ENSMODP00000006815  .......................................................................rspcs--
ENSMODP00000010225  ....................................................................deyknevk--
ENSMODP00000017514  .....................................qtivllnlyrnpqntaqtadgshchvsdvevqehydsff--
ENSMODP00000039002  .....................................................................ehydeff--
ENSMODP00000009010  ...........................................................................d--
ENSMODP00000020576  ............................................................................--
ENSMODP00000036858  ............................................................................--
ENSMODP00000029254  ....................sgsrkrkhrkrsrsrsrerkrkssrsysserrarerekerqkkglppirsktlsvc--
ENSMODP00000017614  ...........................................................gekrkpepgwfhveegr--
ENSMODP00000018402  ....................................................rhtllrhegiesvshateslvian--
ENSMODP00000016781  ..................hshyhdegygpppphyegrrmgppvgghrrgpsrygpqyghppppppppeygphadsp--
ENSMODP00000013040  .........................................................................tag--
ENSMODP00000002441  ...........................................................................y--
ENSMODP00000009010  ..................................................................fvtptnvrdc--
ENSMODP00000023826  .....................................................................eeddvyl--
ENSMODP00000004397  ...................................................................qgevtaptt--
ENSMODP00000008593  ......................................................................pifspl--
ENSMODP00000014946  .....................................................kgrmetsrvvhimdfqrgknlry--
ENSMODP00000020165  ............................................................................--
ENSMODP00000019256  .....................................................................edvmetv--
ENSMODP00000001487  ..........................................................................nr--
ENSMODP00000023578  ............................................................................--
ENSMODP00000018618  ......................................................hcksctlfppnpnlpppstrer--
ENSMODP00000001944  ......................................................................plpinp--
ENSMODP00000024562  ...........................................................................h--
ENSMODP00000010717  .................................................................ssymhggnpsg--
ENSMODP00000033971  ...........................................................................e--
ENSMODP00000010437  .............................................................dhpglknkendensg--
ENSMODP00000017391  ..........................................................................yp--
ENSMODP00000016781  .......................................................................ilnpi--
ENSMODP00000031445  ............................................................................--
ENSMODP00000017592  .....................................................................vrvvqkn--
ENSMODP00000003000  .....................................................................leaetst--
ENSMODP00000021460  .........................................................................dfy--
ENSMODP00000030260  ...........................................................................p--
ENSMODP00000010225  .......................................................................lflfs--
ENSMODP00000005193  ..................................................................pgsknfqnif--
ENSMODP00000006917  ..........................................................................nr--
ENSMODP00000023718  ...................................................................spndgglae--
ENSMODP00000006381  ..........................................................................dc--
ENSMODP00000013139  ...................................................................gsgiggsle--
ENSMODP00000011106  .......................................................................srkep--
ENSMODP00000011084  ...........................................................................k--
ENSMODP00000033409  ...........................................................................a--
ENSMODP00000007822  ......................................................................nfqnif--
ENSMODP00000000011  .....................................................................sgcsttg--
ENSMODP00000019244  ......................................................hcksctlfppnpnlpppatrer--
ENSMODP00000013327  ..............dyddsseeqsaedsyeassgsetqqrkrdspteplgfpgdgdyrdqdyrteqgeeeeeekas--
ENSMODP00000009227  ...................................................................rsrsphkyg--
ENSMODP00000020775  ............................................................lrnmvgagevdedleg--
ENSMODP00000008836  ............................................................................--
ENSMODP00000018496  ............................................................................--
ENSMODP00000012937  .........................................................................sei--
ENSMODP00000024766  ...........................................................................l--
ENSMODP00000006381  .................................................................rsskaevvdne--
ENSMODP00000010717  ..............................................................ggnkvlllsiqnpl--
ENSMODP00000009664  ........................................vfqevssfqgpldatvvvnlqsptleeknefpedlr--
ENSMODP00000010490  .......................................................................ekikn--
ENSMODP00000024054  ..........................................................................dq--
ENSMODP00000002114  ......................................dprqrltwsknrdlslpvpkfkldefyigqvplkevtf--
ENSMODP00000028156  .............................................................vtqrkpwedeslrcd--
ENSMODP00000003584  ...............................................................srgcqvpstpplp--
ENSMODP00000036903  ............................................................................--
ENSMODP00000003337  ...............................................................elkekdlyrplki--
ENSMODP00000014333  ..............................................................qrqkilqkeraiee--
ENSMODP00000008714  ....................................................................deyknevk--
ENSMODP00000013327  ...........................................................pqalsqgseptsenand--
ENSMODP00000006050  ......................................................pylnlegpdlqpkrdhvlhvtf--
ENSMODP00000013604  ....................................................................hldppade--
ENSMODP00000000664  ........................................................................kaie--
ENSMODP00000012747  ..........................................................................yt--
ENSMODP00000026351  ...........................................keviatqgptdgtvlvtikrsssennffddsli--
ENSMODP00000018934  ........................................................................fvsk--
ENSMODP00000015407  ....................................................................qsvdyycd--
ENSMODP00000009575  .......................................................lkgkkhlrleelratrraqgl--
ENSMODP00000005447  .........................................................................gad--
ENSMODP00000005596  ......................................................................nessss--
ENSMODP00000007024  ........................................................mgpqfvsgvivkiistdplp--
ENSMODP00000024054  ....................................................................deyknevk--
ENSMODP00000001919  ............................................................entklelrkvppelnn--
ENSMODP00000011172  ...........................................................................r--
ENSMODP00000006381  ......................................................................sredqv--
ENSMODP00000009227  ......................................................................vvirlq--
ENSMODP00000001242  ................................................mlptpvlrllnvldddyleneeeyedvv--
ENSMODP00000024718  ............................................................................--
ENSMODP00000026104  ..........................................................................ge--
ENSMODP00000032086  ................................................twgtsplgwtssyssgsawstdssgrts--
ENSMODP00000012383  ........................gsrsrsssgsschrsrspanrrtfrcgnkehcgegspsvrhiekkrekaige--
ENSMODP00000012220  ......................................................................leklkn--
ENSMODP00000020434  ....................................................................sssgritn--
ENSMODP00000000721  ............................................................................--
ENSMODP00000000674  .................................................................gteviqvtnvs--
ENSMODP00000024766  ...........................................................................v--
ENSMODP00000024532  ..........................................................................ta--
ENSMODP00000014848  ................................................mlptpvlrlfnvldddyleneeeyedvv--
ENSMODP00000008714  ..........................................................................fs--
ENSMODP00000013897  .........................................................................gse--
ENSMODP00000008570  .........................................................................saw--
ENSMODP00000015423  .........................................mfdyshsksfpegkivkdsrqdlqdqdyrtgptee--
ENSMODP00000012747  .............................................................hrpkaitvmgffeee--
ENSMODP00000001919  ..............................................................hrpraleisaftes--
ENSMODP00000001944  ......................................................................vvirlq--
ENSMODP00000006156  ....................................................gvagqmgrgrlmpnkqnlrvveck--
ENSMODP00000004377  ...........................................................................n--
ENSMODP00000003434  .........................................................................ldg--
ENSMODP00000021792  .........................................................................nym--
ENSMODP00000000011  ............................................................................--
ENSMODP00000007341  ...................................................................kykkenlvr--
ENSMODP00000010183  .............................................................esvdspgslsqselt--
ENSMODP00000028156  ...............................................................itenedsvnkete--
ENSMODP00000015423  .....................................................................gesrqdg--
ENSMODP00000013069  ...........................................................peaagelgpsgkrvvpg--
ENSMODP00000038791  ..........................................................................pc--
ENSMODP00000000011  ..................................................glpfgcsneknyffsgleivsngial--
ENSMODP00000002674  ....................................................................snaanngf--
ENSMODP00000039642  ............................................................................--
ENSMODP00000036724  ...........................................................................p--
ENSMODP00000023634  ....................................................................ykeddlvk--
ENSMODP00000000087  ..........................................................................kp--
ENSMODP00000007362  ......................................................................rpnqnr--
ENSMODP00000011262  ............................................................................--
ENSMODP00000001586  ..........................................................................vs--
ENSMODP00000013441  ................................eqrslinsdvivglateafcssllprgdpslsrdsqpclgtdgr--
ENSMODP00000022828  .........................................................................lem--
ENSMODP00000013444  ..........................................................................ll--
ENSMODP00000002674  ...............................................................dggstfqgttgyf--


                            10           20                       30                              40
                             |            |                        |                               |
d1u1qa_               PEQLRKLFIGGLS.FE.T.TDES..LR....SHF.E.Q.......W........G.....TLT........D.CVVMR
ENSMODP00000007717  ----TNVYIKNFG.ED.M.DDER..LK....ELF.G.K.......F........G.....PAL........S.VKVMT
ENSMODP00000022014  ----TNVYIKNFG.DD.M.DDGR..LK....ELF.S.K.......Y........G.....KTL........S.VKVMT
ENSMODP00000029058  ----TNIYVKNFE.GD.M.DDEC..LQ....ELF.S.Q.......F........G.....KTL........S.VKVMV
ENSMODP00000027267  ----TNVYIKNFG.ED.M.DDLR..LK....RLF.G.K.......F........G.....PAL........S.VKVMT
ENSMODP00000023398  ----ATVYVGGLD.EK.V.SEPL..LW....ELF.L.Q.......A........G.....PVV........N.THMPK
ENSMODP00000037814  ---YTNIYIKNFG.EN.M.DDQR..LT....EIF.A.K.......Y........G.....PTL........S.VKVMT
ENSMODP00000021348  ----TNVYIKNFG.ED.M.DDLR..LK....RLF.G.K.......F........G.....PSL........S.VKVMT
ENSMODP00000027586  ----TNVYIKNFG.ED.M.DNDR..LT....EVF.G.K.......F........G.....HAL........S.VKVMT
ENSMODP00000022014  -----SLYVGDLH.SD.V.TEAM..LY....EKF.S.P.......A........G.....PVL........S.IRVCR
ENSMODP00000029058  -----SLYVGDLH.PD.V.TEAM..LY....EKF.S.A.......A........G.....PIM........S.IRVCR
ENSMODP00000021348  -----SLYVGDLH.PE.V.SEAM..LY....EKF.S.P.......A........G.....PIL........S.IRVCR
ENSMODP00000027586  -----SLYVGDLH.HD.V.TEAM..LY....EKF.S.P.......A........G.....PIL........S.IRVCR
ENSMODP00000037814  ----ASLYVGDLH.HD.V.TESM..LY....EKF.S.P.......A........G.....PIL........S.IRVCR
ENSMODP00000004837  -----NLYVSGLP.KT.M.TQKE..LE....QLF.S.Q.......Y........G.....RII........T.SRILV
ENSMODP00000020923  ----RKLFIGMVS.KK.C.NEND..IR....VMF.S.P.......F........G.....QIE........E.CRILR
ENSMODP00000007717  -----SLYVGDLH.PD.V.TEAM..LY....EKF.S.P.......A........G.....PIL........S.IRVCR
ENSMODP00000024842  ----RKLFIGMIS.KK.C.NEND..IR....VMF.S.S.......F........G.....QIE........E.CRILR
ENSMODP00000006200  -----NLYISGLP.RT.M.TQKD..VE....DMF.S.R.......F........G.....RII........N.SRVLV
ENSMODP00000036724  ----RKLFVGMLG.KQ.Q.SEED..VR....RLF.E.P.......F........G.....QIE........E.CTILR
ENSMODP00000004717  -----NLYVSGLP.RN.M.MQKD..LE....QLF.S.P.......F........G.....RII........T.SRILI
ENSMODP00000008249  -----NLYVSGLP.KT.M.SQKE..ME....QLF.S.Q.......Y........G.....RII........T.SRILV
ENSMODP00000027604  -----NLYVSGLP.RN.M.MQKD..LE....QLF.S.P.......F........G.....RII........T.SRILI
ENSMODP00000023901  ----RKLFVGMLN.KQ.Q.SEED..VL....RLF.Q.P.......F........G.....VID........E.CTVLR
ENSMODP00000023578  ----RKLFVGMLG.KQ.Q.TDED..VR....KMF.E.P.......F........G.....TID........E.CTVLR
ENSMODP00000007804  --QLRKLFIGGLS.FQ.M.TDES..LR....SHF.E.Q.......W........G.....TLT........D.CVAMR
ENSMODP00000034649  --QLRKLFIGSLS.FE.T.MDDS..LR....EHF.K.-.......W........G.....TLS........D.FAVMR
ENSMODP00000018486  ----CRIYVGNLP.PD.I.RTKD..IE....DVF.Y.K.......Y........G.....AIR........D.IDLKN
ENSMODP00000006475  ----TNLYIRGLP.PN.T.TDQD..LV....KLC.Q.P.......Y........G.....KIV........S.TKAIL
ENSMODP00000014208  ----CRVFIGRLN.PA.A.REKD..VE....RFF.K.G.......Y........G.....RIR........D.IDLK-
ENSMODP00000040531  -----RVYIGRLS.YQ.A.RERD..VE....RFF.K.G.......Y........G.....KIL........E.VDLK-
ENSMODP00000010059  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000013841  -----RVYIGRLS.YQ.A.RERD..VE....RFF.K.G.......Y........G.....KIL........E.VDLK-
ENSMODP00000014054  ------LIVLGLP.WK.T.TEQD..LK....EYF.S.T.......F........G.....EVL........M.VQVKK
ENSMODP00000009994  ----CRLFVGNLP.TD.I.TEED..FK....RLF.E.R.......Y........G.....EPS........E.VFINR
ENSMODP00000004654  -----RAFITNIP.FD.V.KWQS..LK....DLV.K.Ek......V........G.....EVT........Y.VELLM
ENSMODP00000001901  -----RLYVGSLH.FN.I.TEDM..LR....GIF.E.P.......F........G.....RIE........S.IQLMM
ENSMODP00000038186  -----KVIIRRLP.PT.L.TKEQ..LE....EHL.Q.P.......L........P.....EHD........Y.FEFFA
ENSMODP00000029243  ---SCTLYVGNLS.FY.T.TEEQ..IY....ELF.S.K.......S........G.....DIK........K.IIMGL
ENSMODP00000012172  -------------.-Y.T.PESV..LR....ERF.S.P.......F........G.....EIQ........D.IWVVR
ENSMODP00000019849  ---SCTLYVGNLS.FY.T.TEEQ..IY....ELF.G.K.......S........G.....DIK........K.IVMGL
ENSMODP00000000959  PDPNTCLGVFGLS.LY.T.TERD..LR....EVF.S.R.......Y........G.....PLS........G.VNVVY
ENSMODP00000003831  -----RIYVENLP.AD.V.REKD..LE....DLF.Y.K.......Y........G.....RIR........D.IELKN
ENSMODP00000016570  PDPNCCLGVFGLS.LY.T.TERD..LR....EVF.S.K.......Y........G.....PIA........D.VSIVY
ENSMODP00000022371  ----CRLFVGNLP.AD.I.TDED..FK....RLF.A.K.......Y........G.....EPG........E.VFINK
ENSMODP00000034857  ---SCTLCVGNLS.FY.T.TEEQ..IY....ELF.S.K.......S........G.....DIK........K.IIMGL
ENSMODP00000034858  ---SCTLCVGNLS.FY.T.TEEQ..IY....ELF.S.K.......S........G.....DIK........K.IIMGL
ENSMODP00000005475  -----RLFVGNLP.PD.I.TEEE..MR....KLF.E.K.......Y........G.....KAG........E.VFIHK
ENSMODP00000022505  ----TNVYIKNFG.DD.I.DEER..LK....EIF.S.K.......Y........G.....KTE........-.--CQS
ENSMODP00000003848  -----KVVIRRLP.PS.L.TKEQ..LE....EQL.H.P.......L........P.....AHD........Y.FEFCT
ENSMODP00000004397  -----RLFVRNLP.YT.S.TEED..LE....KLF.A.K.......Y........G.....PLS........E.VHYPI
ENSMODP00000001893  ---MTSLKVDNLT.YR.T.SPDT..LR....RVF.E.K.......Y........G.....RVG........D.VYIPR
ENSMODP00000017573  -----KLFVGGLN.TE.T.NEKA..LE....AVF.G.K.......Y........G.....RIV........E.VLLMK
ENSMODP00000004247  -----RAFITNIP.FD.V.KWQS..LK....DLI.KeK.......V........G.....KVT........Y.VELLM
ENSMODP00000001568  --RGCEVFVGKIP.RD.M.YEDE..LV....PVF.E.R.......A........G.....KIY........E.FRLMM
ENSMODP00000012202  PDPNCCLGVFGLS.LY.T.TERD..LR....ELF.S.K.......Y........G.....PIA........D.VSIVY
ENSMODP00000031808  ----RTLFIGNLE.KT.T.TYHD..LR....NIF.Q.R.......F........G.....EIV........D.IDIKK
ENSMODP00000006523  ---EGKLFVGGLS.FD.T.NEQS..LE....QVF.S.K.......Y........G.....QIA........E.VVVVK
ENSMODP00000019256  -PHGCEVFVGKIP.RD.V.YEDE..LV....PVF.E.S.......V........G.....RIY........Q.MRLMM
ENSMODP00000031416  --SLRSVFVGNIP.YE.A.TEEQ..LK....DIF.S.E.......V........G.....PVV........S.FRLVY
ENSMODP00000022875  -----EIFVGKIP.RD.L.FEDE..LV....PLF.E.K.......A........G.....PIW........D.LRLMM
ENSMODP00000025722  --RGCEVFVGKIP.RD.V.YEDE..LV....PVF.E.S.......V........G.....RIY........Q.MRLMM
ENSMODP00000013678  ------LWMGDLE.PY.M.DENF..IS....RAF.A.T.......M........Ge....TVL........S.VKIIR
ENSMODP00000019066  PDPNCCLGVFGLS.LF.T.TEKD..LR....EIF.A.K.......Y........G.....PIS........N.VAVVY
ENSMODP00000014920  ----RNLFIGNLD.HS.V.SEVE..LR....RAF.E.K.......Y........G.....IIE........E.VVIKR
ENSMODP00000011039  ---HFHVFVGDLS.PE.I.TTED..IK....SAF.A.P.......F........G.....KIS........D.ARVVK
ENSMODP00000025181  ----STVYVSNLP.FS.L.TNND..LY....RIF.S.K.......Y........G.....KVV........K.VTIMK
ENSMODP00000006917  ------LCIANLP.PS.Y.TQQQ..FE....ELV.R.P.......F........G.....NLE........R.CFLVY
ENSMODP00000028798  --DHFHVFVGDLS.PE.I.TTED..IK....AAF.A.P.......F........G.....RIS........D.ARVVK
ENSMODP00000031317  -------------.--.-.----..LR....EYF.G.Q.......F........G.....EVK........E.CLVMR
ENSMODP00000001566  -DSKTNLIVNYLP.QN.M.TQEE..FR....SLF.G.S.......I........G.....EIE........S.CKLVR
ENSMODP00000034177  ----MRLYVGSLH.FN.I.TEDM..LR....GIF.E.P.......F........G.....KID........N.IVLMK
ENSMODP00000015039  --DSAWVFVGGLP.YE.L.TEGD..II....CVF.S.Q.......Y........G.....EIV........N.INLVR
ENSMODP00000023377  ----WILFVTGVH.EE.A.TEED..IH....DKF.A.E.......Y........G.....EIK........N.IHLNL
ENSMODP00000004837  --SKTNLIVNYLP.QN.M.TQEE..LK....SLF.G.S.......I........G.....EIE........S.CKLVR
ENSMODP00000021002  -PPENVLFVCKLN.PV.T.TDED..LE....IIF.S.R.......F........G.....PIK........S.CEVIR
ENSMODP00000027677  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000022505  -------------.--.-.----..--....---.-.-.......-........-.....-VL........S.IRVCK
ENSMODP00000001487  ------LCITNLP.PS.F.TIEE..FE....ELV.R.T.......F........G.....NIE........R.CFLVY
ENSMODP00000038918  ---SNKIFVGGIP.HN.C.GETE..LR....EYF.K.K.......F........G.....VVT........E.VVMIY
ENSMODP00000011435  -----RIYVASVH.QD.L.SDDD..IK....SVF.E.A.......F........G.....KIK........S.CTLAR
ENSMODP00000011432  -----RIYVASVH.QD.L.SDDD..IK....SVF.E.A.......F........G.....KIK........S.CTLAR
ENSMODP00000006345  ---SNKIFVGGIP.HN.C.GETE..LR....EYF.K.K.......F........G.....VVT........E.VVMIY
ENSMODP00000024718  ----KKIFVGGIK.ED.T.EEYN..LR....DYF.E.K.......Y........G.....KIE........T.IEVME
ENSMODP00000009844  --PNHTIYINNLN.EK.I.KKDE..LKkslyAIF.S.Q.......F........G.....QIL........D.ILVSR
ENSMODP00000003000  --SNKTLFVKGLS.ED.T.TEET..LK....DSF.H.G.......S........-.....--V........G.ARIAT
ENSMODP00000014933  --PPKKVFVGGLS.PD.T.SEEQ..IK....EYF.G.A.......F........G.....EIE........N.IELPM
ENSMODP00000022015  ----RVLYVGGLA.EE.V.DEKV..LH....AAF.I.P.......F........G.....DIT........D.IQIPL
ENSMODP00000015618  --PHLTLFVGRLN.LQ.T.TEEK..LK....DVF.S.R.......Y........G.....DIR........K.LRLVR
ENSMODP00000001920  ---MTSLKVDNLT.YR.T.SPDT..LR....RVF.E.K.......Y........G.....RVG........D.VYIPR
ENSMODP00000027267  -----NIFIKNLD.KS.I.DNKA..LF....DTF.S.A.......F........G.....NIL........S.CKVVC
ENSMODP00000026325  -------------.--.-.----..--....---.-.T.......Y........D.....KDI........T.FQYFK
ENSMODP00000013647  ---YTKIFVGGLP.YH.T.TDSS..LR....KYF.E.V.......F........G.....EIE........E.AVVIT
ENSMODP00000020553  ---FTKIFVGGLP.YH.T.TDSS..LR....KYF.E.G.......F........G.....DIE........E.AVVIT
ENSMODP00000003678  -----KLLVSNLD.FG.V.SDAD..IQ....ELF.A.E.......F........G.....TLK........K.AAVHY
ENSMODP00000029789  ----RKLFVGGLS.FE.T.IDKS..LW....SHF.E.Q.......Q........G.....TLT........D.CVVMR
ENSMODP00000000721  ----KKLFVGGIK.ED.T.EEHH..LR....DYF.E.E.......Y........G.....KID........T.IEIIT
ENSMODP00000006200  ----TNLIVNYLP.QN.M.TQDE..LR....SLF.S.S.......I........G.....EVE........S.AKLIR
ENSMODP00000004743  --DQRSVYVGNVD.YS.G.TAKE..LE....SHF.S.C.......C........G.....EIN........R.VTILC
ENSMODP00000014913  --PVKKIFVGGLS.PD.T.PEEK..IR....EYF.G.G.......F........G.....EVE........S.IELPM
ENSMODP00000038918  -----KLFVGGLD.WS.T.TQET..LR....SYF.S.Q.......Y........G.....EVV........D.CVIMK
ENSMODP00000006371  -DDNATIRVTNLS.ED.T.RETD..LQ....ELF.R.P.......F........G.....SIS........R.IYLAK
ENSMODP00000006345  -----KLFVGGLD.WS.T.TQET..LR....SYF.S.Q.......Y........G.....EVV........D.CVIMK
ENSMODP00000015438  ----NRIFVGGID.FK.T.NEND..LR....KFF.A.Q.......Y........G.....SVK........E.VKIVN
ENSMODP00000008450  -----KVFVGGLS.PD.K.SEEQ..IK....EYF.G.A.......F........G.....EIE........N.IELPM
ENSMODP00000010490  ----RSVFVGNLP.YK.I.EEAA..IQ....EHF.S.D.......C........G.....SVL........A.VKIVR
ENSMODP00000007208  --QPKRLHVSNIP.FR.F.RDPD..LR....QMF.G.Q.......F........G.....KIL........D.VEIIF
ENSMODP00000024712  -------FLGGLP.YE.L.TEGD..II....CVF.S.Q.......Y........G.....EIV........N.INLVR
ENSMODP00000017405  ----RTLFVGNLD.CK.V.TEEL..LF....ELF.H.Q.......A........G.....PVI........K.VKIPK
ENSMODP00000001337  ---PKRLHVSNIP.FR.F.RDPD..LR....QMF.G.Q.......F........G.....KIL........D.VEIIF
ENSMODP00000028798  ----KTLYVGNLS.RD.V.TEAL..IL....QLF.S.Q.......I........G.....PCK........N.CKMIM
ENSMODP00000002547  --QPKRLHVSNIP.FR.F.RDPD..LR....QMF.G.Q.......F........G.....KIL........D.VEIIF
ENSMODP00000005593  --DARSIYVGNVD.YG.A.TAEE..LE....AHF.H.G.......C........G.....SVN........R.VTILC
ENSMODP00000018401  ----KKLFVGGLK.GD.V.AEGD..LV....EHF.S.Q.......F........G.....TVE........K.AEIIA
ENSMODP00000014913  ----WKMFIGGLS.WD.T.TKKD..LK....DYF.S.K.......F........G.....EVV........D.CTLKL
ENSMODP00000016281  --PNTSLFVRNVA.DD.T.RSED..LR....REF.G.R.......Y........G.....PIV........D.VYVPL
ENSMODP00000004397  --PGCTLFIKNLN.FS.T.TEET..LK....EAF.S.K.......V........G.....KVK........N.CSISK
ENSMODP00000000006  ---NHTIYINNMN.DK.I.KKEE..LKrslyALF.S.Q.......F........G.....HVV........D.IVAL-
ENSMODP00000020576  PERGCEIFIGKLP.RD.L.FEDE..LV....PLC.E.K.......I........G.....KIY........E.VRMMM
ENSMODP00000005194  --PVKKIFVGGLN.PE.A.TEDK..IR....EYF.G.D.......F........G.....EIE........S.IELPM
ENSMODP00000002993  ----CKLFVGGLS.PY.T.TEIR..LR....SYF.E.A.......F........G.....CLR........D.CVVVM
ENSMODP00000015362  -----KLYIGNLN.ES.V.TPAD..LE....KVF.A.E.......H........K.....ISY........S.GQFLV
ENSMODP00000004717  -DPKTNLIVNYLP.QS.M.TQEE..FY....NLF.A.T.......V........G.....KIQ........S.CKLVR
ENSMODP00000018934  ----ARLIIRNLS.FK.C.SEDD..LK....TLF.A.Q.......F........G.....AVL........E.VNIPR
ENSMODP00000027604  -DPKTNLIVNYLP.QS.M.TQEE..FY....NLF.A.T.......V........G.....KIQ........S.CKLVR
ENSMODP00000002993  ----KKIFVGGIK.GD.V.SESD..LV....RHF.S.Q.......F........G.....PVE........K.AEIIV
ENSMODP00000000363  ----RKLFVGMLN.KQ.Q.SEDD..VR....RLF.E.A.......F........G.....NIE........E.CTILR
ENSMODP00000014933  --DDGKMFIGGLS.WD.T.SKKD..LT....EYL.S.R.......F........G.....EVV........D.CTIKT
ENSMODP00000016940  ----CKVYVGNLG.NN.G.NKTE..LE....RAF.G.Y.......Y........G.....PLR........S.VWVAR
ENSMODP00000007822  ----LRIIVENLF.YP.V.TLDV..LH....QIF.S.K.......F........G.....TVL........K.IITFT
ENSMODP00000002891  -----KLFIRGLS.FE.R.TDES..PQ....SHF.K.Q.......W........D.....TLT........D.CVMMR
ENSMODP00000003337  --NRNRVFISNIP.YD.M.KWQA..IK....DLMrE.K.......V........G.....EVT........Y.VELFK
ENSMODP00000005194  -----KMFVGGLS.WD.T.SKKD..LK....DYF.T.K.......F........G.....EVV........D.CTIKM
ENSMODP00000008450  --DDGKMFIGGLS.WD.T.SKKD..LT....EYL.S.C.......F........G.....EVI........D.CTVKT
ENSMODP00000017452  --DDFRIFCGDLG.NE.V.NDDI..LA....RAF.S.R.......F........P.....SFL........K.AKVIR
ENSMODP00000010785  ----TKVYVGNLG.TG.A.GKGE..LE....RAF.S.Y.......Y........G.....PLR........T.VWIAR
ENSMODP00000010799  --ENSAIYVQGLN.ES.V.TADE..LA....DFF.K.Q.......C........G.....VVKmnkrtgqpM.INIYL
ENSMODP00000004654  ----CQIFVRNLP.FD.F.TWKM..LK....DKF.N.E.......C........G.....HVL........Y.ADIKM
ENSMODP00000022797  -PPNTSLFVRNVT.DA.T.RPED..LR....REF.G.R.......Y........G.....PIV........D.VYIPL
ENSMODP00000016382  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-QLFK
ENSMODP00000003786  -----RVYIGRLS.YH.V.REKD..IQ....RFF.S.G.......Y........G.....RLL........E.VDLK-
ENSMODP00000017322  -EPPYTAYVGNLP.FN.T.VQGD..ID....AIF.K.D.......L........-.....SVR........S.VRLVR
ENSMODP00000020165  -----VLFVRNLA.TT.V.TEEI..LE....KSF.S.E.......F........G.....KLE........R.VKKLK
ENSMODP00000010787  ----TKVYVGNLE.TG.A.GKGE..LE....RAF.S.Y.......Y........G.....PLR........T.VWIAR
ENSMODP00000001412  ---GRNLWVSGLS.ST.T.RATD..LK....NLF.S.K.......Y........G.....KVV........G.AKVVT
ENSMODP00000015013  ----PWIFVGEFP.YE.L.TEGD..II....CVF.S.Q.......Y........G.....EIV........N.INLVQ
ENSMODP00000003000  DRDARTLFVKNLP.YK.V.TQEE..LK....EVF.E.D.......A........-.....--I........E.IRLVC
ENSMODP00000011795  ----HCVHMRGLP.YR.A.TEND..IY....NFF.S.P.......L........N.....PVR........-.VHIEI
ENSMODP00000022875  -----VLFVRNLA.NT.V.TEEI..LE....KAF.S.Q.......F........G.....KLE........R.VKKLK
ENSMODP00000028798  -PSNCTVYCGGVT.SG.L.TEQL..MR....QTF.S.P.......F........G.....QIM........E.IRVFP
ENSMODP00000003337  ----STIFVANLD.FK.V.GWKK..LK....EVF.S.I.......A........G.....TVK........R.ADIKE
ENSMODP00000018401  ----CKLFIGGLN.VQ.T.SESG..LR....GHF.E.A.......F........G.....TLT........D.CVVVV
ENSMODP00000019828  ---PTKVHIGRLT.KN.V.TKDH..IM....EIF.S.T.......Y........G.....KIK........M.IDMPA
ENSMODP00000011039  -PKNCTVYCGGIA.SG.L.TDQL..MR....QTF.S.P.......F........G.....QIM........E.IRVFP
ENSMODP00000010024  ---STKLHVGNIS.SA.C.TNLE..LR....AKF.E.E.......Y........G.....PVI........E.CDIVK
ENSMODP00000023575  -------------.--.-.---K..FE....GLF.R.T.......Y........D.....DCV........T.FQLFK
ENSMODP00000001566  ----ANLYVSGLP.KT.M.TQKE..LE....QLF.S.Q.......Y........G.....RII........T.SRILV
ENSMODP00000031345  ----HKLFISGLP.FS.C.TKEE..LE....DIC.K.V.......H........G.....NVK........D.LRLVT
ENSMODP00000011039  ---PRTLYVGNLS.RD.V.TEVL..IL....QLF.S.Q.......I........G.....PCK........S.CKMIT
ENSMODP00000017614  -------------.--.-.--ED..LR....TEC.E.K.......F........G.....QVK........K.VLLF-
ENSMODP00000011435  ----CRVYVGSIY.YE.L.GEDT..IR....QAF.A.P.......F........G.....PIK........S.IDMSW
ENSMODP00000011432  ----CRVYVGSIY.YE.L.GEDT..IR....QAF.A.P.......F........G.....PIK........S.IDMSW
ENSMODP00000035735  PPRGCEVFVGKIP.RD.V.YEDE..LV....PVF.E.S.......V........G.....RIY........E.MRLMM
ENSMODP00000001944  --------ISNIP.FN.I.TKMD..IL....QFL.E.E.......I........Pv....DEN........A.VHILV
ENSMODP00000036858  ----TEIFVGKIP.RD.L.FEDE..LV....PLF.E.K.......A........G.....PIW........D.LRLMM
ENSMODP00000005193  ----LRIIIDNMY.YP.V.TLDV..LH....QIF.S.K.......F........G.....AVL........K.IITFT
ENSMODP00000028751  DPENSAIYVQGLN.ES.V.TADE..LA....DFF.K.Q.......C........G.....VVKmnkrtgqpV.INIYL
ENSMODP00000039173  ----HCVHMRGLP.YR.V.TEND..IY....NFF.S.P.......F........N.....PVR........E.HIEIG
ENSMODP00000006815  ---VLRIIVENLF.YP.V.TLEV..LY....QIF.S.K.......F........G.....TVL........R.IITFT
ENSMODP00000020576  ----KILYVRNLM.LS.T.SEET..LE....KEF.N.S.......Ikp......G.....SVE........R.VKKIR
ENSMODP00000025722  ----KILYVRNLM.IK.T.SEET..IR....KTF.S.Q.......F........G.....CVE........R.VKKIR
ENSMODP00000002300  -SDNNTIFVQGLG.EN.V.TIES..VA....DYF.K.Q.......I........G.....IIKtnkktgqpM.INLYT
ENSMODP00000003786  ---EYRLIVENLS.SR.C.SWQD..LK....DFM.R.Q.......A........G.....EVT........Y.ADAHK
ENSMODP00000023826  --------LRGLP.YS.C.NEKD..IV....DFF.A.G.......L........-.....NII........D.ITFVM
ENSMODP00000033056  -----KIFVGNVS.AA.C.TSQE..LR....SLF.E.R.......H........G.....PVI........E.CDVVK
ENSMODP00000009807  -----KIFVGNVS.AA.C.TSQE..LR....SLF.E.R.......H........G.....PVI........E.CDVVK
ENSMODP00000018415  ----NTVFVGGID.VR.M.DETE..IR....SFF.A.R.......Y........G.....SVK........E.VKIIT
ENSMODP00000000175  -----VVYLGHLP.RG.L.YEPQ..LK....EYF.T.Q.......F........G.....TVK........R.LRLSR
ENSMODP00000039175  ----NTVFVGGID.VR.M.DETE..IR....SFF.A.R.......Y........G.....SVK........E.VKIIT
ENSMODP00000036858  -----VLFVRNLA.NT.V.TEEI..LE....KAF.S.Q.......F........G.....KLE........R.VKKLK
ENSMODP00000008249  -DSKTNLIVNYLP.QN.M.TQEE..FK....SLF.G.S.......I........G.....EIE........S.CKLVR
ENSMODP00000032411  ---KTNLYIRGLP.PG.T.TDQD..LI....KLC.Q.P.......Y........G.....KIV........S.TKAIL
ENSMODP00000001944  -EPGFCVYLKGLP.FE.A.ENKH..VI....DFF.K.K.......L........D.....IVE........D.SIYIA
ENSMODP00000009227  -----CIYIRNFP.FD.V.TKVE..VQ....KFF.A.G.......F........Si....DED........D.VYLLY
ENSMODP00000007480  ---SRKVFVGGLP.PD.I.DEDE..IT....ASF.R.R.......F........G.....PLI........V.DWPHK
ENSMODP00000011795  ------VRLRGLP.FG.C.SKEE..IV....QFF.S.G.......L........E.....IVPn.......G.ITLPV
ENSMODP00000002604  ----RILYIRNLP.YK.I.TAEE..MY....DIF.G.K.......Y........G.....PIR........Q.IRVG-
ENSMODP00000021564  ------VHMRGLP.FR.A.TEND..IA....NFF.S.P.......L........N.....PIR........-.VHIDI
ENSMODP00000036078  ---SRKVFVGGLP.PD.I.DEDE..IT....ASF.R.R.......F........G.....PLV........V.DWPHK
ENSMODP00000010024  -----KLFIGNLP.RE.A.TEQE..IR....ALF.E.Q.......Y........G.....KVL........E.CDIIK
ENSMODP00000013583  DPSTTNLYLGNIN.PQ.V.NEEM..LC....QEF.G.R.......F........G.....PLA........S.VKIMW
ENSMODP00000013581  DPSTTNLYLGNIN.PQ.V.NEEM..LC....QEF.G.R.......F........G.....PLA........S.VKIMW
ENSMODP00000001370  ---SRKVFVGGLP.PD.I.DEDE..IT....ASF.R.R.......F........G.....PLV........V.DWPHK
ENSMODP00000010502  ----GVVYLGHLP.RG.L.YEPQ..LK....EYF.T.Q.......F........G.....TVK........R.LMLSR
ENSMODP00000018934  ---GKTVFIRNLS.FD.S.EEED..LG....EIL.Q.Q.......F........G.....DLK........Y.VRIVL
ENSMODP00000031808  ----RHLWVGNLP.EN.V.REEK..II....EHF.K.R.......Y........G.....RVE........S.VKILP
ENSMODP00000013458  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000004397  ----SKILVRNIP.FQ.A.NVRE..IR....ELF.S.T.......F........G.....ELK........T.VRLPK
ENSMODP00000002817  -EPNKVLYLKNLS.PR.V.TEKE..LV....SLF.A.R.......F........Q.....EKK........G.PLIQF
ENSMODP00000024842  --DSIKMFVGQVP.RS.W.SEKD..LR....ELF.E.Q.......Y........G.....AVY........E.INVLR
ENSMODP00000021564  -----TVRLRGLP.FG.C.SKEE..IV....QFF.T.G.......L........E.....IVPn.......G.ITLTM
ENSMODP00000035400  DPSTTNLYLGNIN.PQ.M.NEEM..LC....QEF.G.R.......F........G.....PLA........S.VKIMW
ENSMODP00000003000  PSDSKTLVLNNLA.YS.A.TEES..LQ....EVF.E.K.......A........-.....--T........S.ISLPQ
ENSMODP00000007934  --TITTLYVGGLG.DT.I.SEAD..LR....NHF.Y.Q.......F........G.....EIR........T.ITVVQ
ENSMODP00000001484  ----RNFWVSGLS.ST.T.RAID..LK....NLF.S.K.......Y........G.....KVV........G.AKVVT
ENSMODP00000008195  ---NSRVFIGNLN.TLvV.KKTD..VE....AIF.S.K.......Y........G.....KIV........G.CSVH-
ENSMODP00000001568  -----VLYVRNLM.IS.T.TEET..IK....AEF.N.K.......Fkp......G.....AVE........R.VKKLR
ENSMODP00000010946  ---TRNLWVSGLS.SN.T.KAAD..LK....NLF.G.K.......Y........G.....KVL........S.AKVVT
ENSMODP00000003430  ----SRVFIGNLN.TAmV.KKAD..VE....TIF.S.K.......Y........G.....RVA........G.CSVH-
ENSMODP00000007024  --DDRTVYVELLP.KN.V.NHSW..IE....RVF.G.K.......C........G.....NVV........Y.ISIPH
ENSMODP00000011964  --TITTLYVGGLG.DT.I.SETD..LR....NHF.Y.Q.......F........G.....EIR........T.ITVVQ
ENSMODP00000024532  ---RRTVYVGNLN.SQtT.TADQ..LL....EFF.K.Q.......V........G.....EVK........F.VRMAG
ENSMODP00000004397  -----RLIVKNLP.SG.M.KEER..FR....QLF.A.A.......F........G.....TLT........D.CSLKF
ENSMODP00000032411  -QDPTNLYISNLP.IS.M.DEQE..LE....NML.K.P.......F........G.....HVI........S.TRILR
ENSMODP00000010717  -----VVHVRGLC.ES.V.VEAD..LV....EAL.E.K.......F........G.....TIC........Y.VMMMP
ENSMODP00000008758  ----STVYAGPFG.EN.F.CLKP..LK....KLF.A.S.......F........G.....PVH........S.MEVIL
ENSMODP00000021972  ----SRVFIGNLNtLD.I.KKTD..VE....AIF.S.K.......Y........G.....KIV........D.CSVH-
ENSMODP00000035735  ----KILYVRNLM.IE.T.TEET..IK....KSF.G.Q.......Fnp......G.....CVE........R.VKKIR
ENSMODP00000018834  ---GNTLYVSG--.TD.M.TPTL..LR....GAF.S.P.......F........G.....NII........D.ISMDP
ENSMODP00000020165  ----TEVFVGKIP.RD.L.YEDE..LV....PLF.E.K.......A........G.....PIW........D.LRLMM
ENSMODP00000031345  -KDNITVFVSNLP.YG.L.GEPDvkLR....PLF.E.P.......F........G.....EVT........E.IRPIF
ENSMODP00000023979  --DSHQLFVGNLP.HD.I.DENE..LK....EFF.M.S.......F........G.....NVV........E.LRINT
ENSMODP00000015407  --ESKTIMLRGLP.IT.V.TEND..IR....EIM.E.S.......F........Egp...QPA........D.VRLMK
ENSMODP00000014946  ---GRVIHLSNLP.HSgY.SDSA..VI....KLA.E.P.......Y........G.....KIK........N.YILMR
ENSMODP00000003584  -DPNCRIYVKNLA.KQ.V.EEND..LK....FIF.G.R.......YvdfssqteR.....IMF........D.IRLMK
ENSMODP00000007822  ----SVLLVSNLN.PErV.TPQC..LF....ILF.G.V.......Y........G.....DVQ........R.VKILF
ENSMODP00000002891  ----KKIFVGGIK.ED.T.KEHH..-R....DYF.E.Q.......Y........G.....KIK........V.IEIMT
ENSMODP00000016781  -----VVHIRGLI.DG.V.VEAD..LV....EAL.Q.E.......F........G.....PIS........Y.VVVMP
ENSMODP00000009227  --DNRYLFLRGLP.YS.A.TEDE..VR....AFF.P.G.......L........-.....-CV........D.GIILL
ENSMODP00000018934  -----TLFVGRLP.AS.A.STPQ..LE....RLF.S.Q.......V........G.....PVK........Q.CFVVT
ENSMODP00000011795  ----FVVKVRGLP.WS.C.SADE..VQ....RFF.S.E.......C........Kiqn..GAS........G.IRFIY
ENSMODP00000029701  ------------N.YD.T.TESK..LR....REF.E.V.......Y........G.....PIK........R.IHMVY
ENSMODP00000011218  --DSHQLFVGNLP.HD.V.DKAE..LK....DFF.Q.S.......Y........G.....NVV........E.LRINS
ENSMODP00000007822  --PSRVIHVRKLP.GD.V.TEAE..VI....SLG.L.P.......F........G.....KVT........N.LLMLK
ENSMODP00000001901  -RDARTVFCMQLA.AR.I.RPRD..LE....EFF.S.T.......V........G.....KVR........D.VRMIS
ENSMODP00000005193  --PSRVLHIRKLP.GE.V.TETE..VI....ALG.L.P.......F........G.....KVT........N.ILMLK
ENSMODP00000013253  -------------.--.-.-ASY..IL....LQF.A.Q.......Y........G.....NIL........K.HVMSN
ENSMODP00000001062  ------LIVLDLS.WK.T.IEQG..VK....EYF.I.T.......F........G.....EVF........M.VQVKK
ENSMODP00000006815  ------LLVSNLN.PDaI.TPHG..LF....ILF.G.V.......Y........G.....DVQ........R.VKIMF
ENSMODP00000012172  -------------.--.-.TQEQ..LY....SIF.D.I.......V........P.....GLE........Y.CEVQR
ENSMODP00000005193  ---NTVLLVSNLN.EEmV.TPQS..LF....TLF.G.V.......Y........G.....DVQ........R.VKILY
ENSMODP00000000232  --KNTNVYVTGLP.PD.I.TKDE..FV....QLM.S.K.......C........G.....IIMrdpqteeyK.IKLYK
ENSMODP00000034177  -RDARTVFCMQLA.AR.I.RPRD..LE....DFF.S.A.......V........G.....KVR........D.VRIIS
ENSMODP00000006415  -----TVFVNRIP.WT.A.AANE..IK....QHF.S.Q.......F........G.....TIR........K.CFLPF
ENSMODP00000035735  ----CRLFIGGIP.KM.K.KREE..IL....EEI.S.K.......V........Te....GVL........D.VIVYA
ENSMODP00000023866  -SDNNTIFVQGLG.EG.V.STDQ..VG....DFF.K.Q.......I........G.....IIKvsslpgkpM.INLYT
ENSMODP00000026309  ---STTLWVGQLD.KR.T.TQQD..VA....SLL.E.E.......F........G.....PIE........S.INMIP
ENSMODP00000041019  ----SRVFIGNLN.TAiV.KKGD..IE....AIF.A.K.......Y........G.....KIV........G.CSVH-
ENSMODP00000001219  -----KLYIGNLS.DS.V.SPVD..LE....SIF.N.D.......S........K.....IPY........T.GSFLV
ENSMODP00000006815  --PSRVLHLRKIP.ND.V.TETE..VI....SLG.L.P.......F........G.....KVT........N.LLMLK
ENSMODP00000010225  ---NRSIYVKGFP.TD.A.TLDD..IK....EWL.E.G.......K........G.....QVQ........N.IQMRR
ENSMODP00000017514  -------------.--.-.-EEV..FT....ELQ.E.K.......Y........G.....EIE........E.MNVCD
ENSMODP00000039002  -------------.--.-.-EEV..FT....EME.E.K.......Y........G.....EVE........E.MNVCD
ENSMODP00000009010  ---NTIVRARGLP.WQ.S.SDQD..IA....RFF.K.G.......L........N.....IAK........GgAALCL
ENSMODP00000020576  ----CRLFVGGIP.KT.K.KREE..IL....SEM.K.K.......V........Te....GVV........D.VIVYP
ENSMODP00000036858  -----RLFVGSIP.KS.K.TKEQ..IL....EEF.S.K.......V........Te....GLT........D.VILYH
ENSMODP00000029254  ---STTLWVGQVD.KK.A.TQQD..LT....NLF.E.E.......F........G.....QIE........S.INMIP
ENSMODP00000017614  ---NTNVYVTGLP.PD.I.TKDE..FI....QLM.S.K.......C........G.....IIMkdpqteeyK.IKLYK
ENSMODP00000018402  ---------GGLG.NG.V.SRTQ..LL....NIF.E.R.......Y........G.....SVE........A.LLMPP
ENSMODP00000016781  -----VLMVYGLD.QSkM.NCDR..VF....NVF.C.L.......Y........G.....NVE........K.VKFMK
ENSMODP00000013040  ----RVVHICNLP.EGsC.TEND..VI....NLG.L.P.......F........G.....KVT........N.YILMK
ENSMODP00000002441  ---SCKVFLGGVP.WD.I.TEAG..LI....NTF.R.V.......F........G.....SLS........V.EWPGK
ENSMODP00000009010  ------IRLRGLP.YA.A.TIED..IL....EFL.G.E.......F........Stai..QTH........G.VHMVL
ENSMODP00000023826  ------IRAQGLP.WS.C.TVED..VL....KFF.F.D.......Crir.....N.....GEN........G.IHFLL
ENSMODP00000004397  ---AYTVKLRGAP.FN.V.TEQN..VR....EFL.L.P.......L........-.....KPM........A.IRIVR
ENSMODP00000008593  --EGTKMTVNNLH.PR.V.TEED..IV....ELF.C.V.......C........G.....ALK........R.ARLVH
ENSMODP00000014946  -------------.--.-.---Q..LL....QLV.E.P.......F........G.....VIS........N.HLILN
ENSMODP00000020165  -----RLFVGSIP.KN.K.TKEN..IL....EEF.S.K.......Vtglt....E.....GLV........D.VILYH
ENSMODP00000019256  ----KILYVRNLM.IK.T.SEET..IR....KSF.V.Q.......F........G.....---........-.-----
ENSMODP00000001487  ----RKVLLRNLP.PD.T.HSQE..VH....DLL.K.D.......Y........-.....ELK........Y.CYVDR
ENSMODP00000023578  -----------IP.RH.L.EEKD..LK....PIF.E.Q.......F........G.....RIF........E.LTVIK
ENSMODP00000018618  PPGCKTVFVGGLP.EN.A.TEEI..IQ....EVF.E.Q.......C........G.....DIT........A.IRKSK
ENSMODP00000001944  --DDLYVSVHGMP.FS.A.METD..VK....DFF.H.G.......L........-.....RVD........A.VHLLK
ENSMODP00000024562  -------------.--.-.----..LL....KLL.Q.K.......F........G.....KVK........Q.FDFLF
ENSMODP00000010717  ----SVVMVSGLHqLK.M.NCSR..VF....NLF.C.L.......Y........G.....NIE........K.VKFMK
ENSMODP00000033971  ------VYVGNLP.LD.T.KEED..IL....SLL.K.D.......F........G.....PLR........V.QKVQN
ENSMODP00000010437  --PTTTVFVGNIS.EK.A.SDML..IR....QLL.A.K.......C........G.....LVL........S.WKRVQ
ENSMODP00000017391  --DSHQLFVGNLP.HD.V.DKAE..LK....DFF.Q.SfcvsfkgY........G.....NVV........E.LRINS
ENSMODP00000016781  -------------.YS.I.TTDV..LY....TIC.N.P.......C........G.....PVQ........R.IVIFR
ENSMODP00000031445  -----------LN.DN.I.RENF..LT....DMC.K.K.......Y........G.....EVE........E.VEILY
ENSMODP00000017592  -----LVFVVGLS.QR.L.ADPE..VLkrp.EYF.G.K.......F........G.....KIH........K.VVINN
ENSMODP00000003000  ---NFNLFAGNLN.FN.K.TAAE..LK....TAI.T.D.......F........F.....AKK........D.LTVV-
ENSMODP00000021460  -------------.--.-.--ED..VL....PEF.K.N.......V........G.....KVI........Q.FKVSC
ENSMODP00000030260  --DSYQLFVGNLP.HD.V.DKAE..LK....DFF.R.S.......H........G.....NVV........E.LQIHS
ENSMODP00000010225  ---------KELD.DQ.T.CRED..LH....TLF.S.N.......H........G.....EIK........W.IDFIR
ENSMODP00000005193  -PPSATLHLSNIP.PS.V.AEED..LR....TLF.A.N.......T........G.....GTV........K.AFKFF
ENSMODP00000006917  ----RKILIRGLP.GD.V.TNQE..VH....DLL.S.D.......Y........-.....ELK........Y.CFVDK
ENSMODP00000023718  -EEVRTLFVSGLP.LD.I.KPRE..LY....LLF.R.P.......F........K.....GYE........G.SLIKL
ENSMODP00000006381  ------VRLRGLP.YT.A.SIDD..IL....GFL.G.Ea......A........G.....DIRph......G.VHMVL
ENSMODP00000013139  -EEVRTLFVSGLP.VD.I.KPRE..LY....LLF.R.P.......F........K.....GYE........G.SLIKL
ENSMODP00000011106  -DRSYLIHVGSLC.PS.V.SETD..LM....SHF.Q.K.......Y........-.....QVS........E.VSICT
ENSMODP00000011084  -------------.--.-.----..--....---.-.-.......-........-.....---........R.VTIMK
ENSMODP00000033409  ------VYVGSFS.WW.T.TDQQ..LI....QII.R.S.......V........Gvy...DVV........E.LKFAE
ENSMODP00000007822  -PPSATLHLSNIP.PS.I.SEED..LK....MLF.S.S.......N........Gg....MVK........G.FKFFQ
ENSMODP00000000011  ----HCVHMRGLP.YQ.A.IEND..IY....NFF.L.T.......T........Q.....LCV........H.IEIGP
ENSMODP00000019244  PPGCKTVFVGGLP.EN.G.TEQI..IV....EVF.E.Q.......C........G.....DII........A.IRKSK
ENSMODP00000013327  ----HIIMLRMLP.QA.A.AEND..IR....AQL.Q.S.......H........Gi....QAR........E.VRLMR
ENSMODP00000009227  ----FYVHLKNLS.LS.V.EKRD..IK....NFF.R.D.......T........-.....DLA........S.DQIKF
ENSMODP00000020775  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000008836  ------LYIGNLT.WW.T.TDED..LT....EAV.H.S.......L........Gvn...DIL........E.IKFFE
ENSMODP00000018496  -------------.--.-.----..--....---.-.-.......-........-.....---........-.--LMF
ENSMODP00000012937  ----YKVEIQNVP.RY.V.GFSD..VK....KFL.A.K.......F........Gl....QPH........K.TKLFG
ENSMODP00000024766  -------------.--.-.----..--....---.-.-.......-........-.....---........S.VKVMT
ENSMODP00000006381  ----TVVRARGLP.WQ.S.SDQD..IA....RFF.K.G.......L........N.....IAK........G.GRGPC
ENSMODP00000010717  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000009664  -------------.--.-.--AE..LM....QTL.G.N.......Y........G.....TII........L.VRIN-
ENSMODP00000010490  ---KRTVFVGNLP.VT.C.KKKE..LK....SFF.K.E.......Y........G.....QIE........C.VRFRS
ENSMODP00000024054  -------------.--.-.TCRD..LH....TLF.S.N.......H........G.....EIK........W.IDFIR
ENSMODP00000002114  ---------ARLN.DN.V.RETF..LK....DMC.R.K.......Y........G.....EVE........E.VEILL
ENSMODP00000028156  ----TIIHVSELP.TDgY.TEQD..II....KIV.Q.P.......F........G.....KVS........D.LLIVP
ENSMODP00000003584  -RANRTLLVRHLP.AE.L.TAEE..KE....HLL.K.H.......F........G.....A-Q........A.VRVLS
ENSMODP00000036903  -------------.--.-.----..--....---.-.-.......-........-.....---........-.---MT
ENSMODP00000003337  -------------.--.-.----..--....-KF.E.Q.......V........S.....HVM........F.AEIKM
ENSMODP00000014333  ---RRVVFIGKIP.GC.M.TRSE..LK....HRF.S.V.......F........G.....EIE........E.CTIHF
ENSMODP00000008714  ---NRSIYVKGFP.TD.A.TLDD..IK....EWL.E.G.......K........G.....QVQ........N.IQMRQ
ENSMODP00000013327  -----TIILRNLN.PH.S.TMDS..IL....GAL.A.P.......Y........Avl...SSS........N.VRVIK
ENSMODP00000006050  ------------P.KE.W.KTSD..LY....QLF.S.A.......F........G.....NIQ........V.SWIDD
ENSMODP00000013604  --TITTLYIGGLQ.-D.T.SDTY..LR....NHW.E.Q.......F........G.....EIL........K.VIIGQ
ENSMODP00000000664  --ERRVIYVGKIR.PD.I.TRTE..LR....DRF.E.V.......F........G.....EIE........E.CTVNL
ENSMODP00000012747  ---NTKLEVRKIP.QE.LnNITK..LN....EHF.S.K.......F........G.....TIV........N.IQVAF
ENSMODP00000026351  -------------.--.-.--NE..LL....QEF.G.N.......H........G.....EVI........L.IRFVE
ENSMODP00000018934  ----TRLCLHNLP.KA.V.DDKQ..LR....KLL.L.T.......At.......GggravRLK........E.CRVMR
ENSMODP00000015407  -----TIILRNIA.PH.T.VVDS..IM....TAL.S.P.......Y........Asl...AVN........N.IRLIK
ENSMODP00000009575  ----RSVFVSGFP.RG.L.DPTQ..LS....EYF.Q.A.......F........G.....PVA........S.VVMDK
ENSMODP00000005447  ------IQISNID.YR.L.SRKE..LQqvmqEAF.S.R.......H........G.....KVK........S.IELSP
ENSMODP00000005596  ---VTTVYVGNIP.QD.A.RVSD..MK....RTL.R.E.......Y........N.....AV-........-.---PL
ENSMODP00000007024  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000024054  ---NKSIYVKGFP.TD.A.TLDD..IK....EWL.E.G.......K........G.....QVQ........N.IQMRQ
ENSMODP00000001919  -------------.--.-.-ISK..LN....EHF.S.R.......F........G.....TLV........N.LQVAY
ENSMODP00000011172  --PSYWLVLHNLT.PQ.I.DGST..LR....TIC.M.Q.......H........G.....PLL........T.FHLNL
ENSMODP00000006381  -----IIRMRGLP.FT.A.TPGD..VL....AFL.G.P.......E........C.....PVTggpe....G.LLFVH
ENSMODP00000009227  ----------GLP.VI.A.GPVD..IR....HFF.S.G.......L........N.....IPDg.......G.VHII-
ENSMODP00000001242  -------------.--.-.--ED..VK....EEC.Q.K.......Y........G.....PVV........S.LLVPK
ENSMODP00000024718  -------------.--.-.----..--....---.-.-.......-........-.....---........-.---MR
ENSMODP00000026104  ----RRLFVGGLG.PT.V.TQDD..VR....AQL.S.R.......F........G.....AVS........S.VELVS
ENSMODP00000032086  ----SWLVLRNLT.PQ.I.DGST..LR....TLC.L.Q.......H........G.....PLI........T.FHLNL
ENSMODP00000012383  ---GRVVYIRNLS.ST.M.SSSE..LK....KRF.E.V.......F........G.....EIV........E.CQVLK
ENSMODP00000012220  -------------.--.-.---V..IH....KIF.S.K.......F........G.....KIT........N.DYYPE
ENSMODP00000020434  -----WLVLKNLT.PQ.I.DGST..LR....TLC.M.Q.......H........G.....PLI........T.FHLNL
ENSMODP00000000721  -------------.--.-.----..--....---.-.-.......-........-.....---........-.---MR
ENSMODP00000000674  -------------.-S.A.SSEQ..MR....TLF.G.F.......L........G.....KID........E.LRLFP
ENSMODP00000024766  --------VSDLH.SD.G.TKAM..LC....EKF.S.P.......A........G.....PML........S.LRVCR
ENSMODP00000024532  -----VIQVTNLS.SA.V.TSEQ..MR....TLF.T.F.......L........G.....EIE........E.LRLYP
ENSMODP00000014848  -------------.--.-.--ED..VK....EEC.Q.K.......Y........G.....PVV........S.LLVPK
ENSMODP00000008714  ---------GDLD.DQ.I.CREV..LH....TRF.S.N.......Y........G.....EIK........W.IDFIR
ENSMODP00000013897  ----KTLFVWELN.PG.P.GPES..LKhslfTVF.S.Q.......F........G.....LLY........S.VRVFP
ENSMODP00000008570  -PPGRTLFVLNVP.PY.C.PEER..LA....QLF.S.Dc......C........G.....PVQ........S.VKLHP
ENSMODP00000015423  -KPSRLIRLGGVP.EN.A.TKED..IL....NAF.R.T.......Sd.......G.....TPV........K.DLQLK
ENSMODP00000012747  -------------.--.-.-KDE..LL....QHF.S.K.......F........G.....DIE........D.LQ---
ENSMODP00000001919  -------------.--.-.DRED..LL....PHF.A.Q.......Y........G.....EIE........D.CQIDD
ENSMODP00000001944  ----------GLP.IV.A.GTMD..IR....HFF.S.G.......L........T.....IPDg.......G.VHIV-
ENSMODP00000006156  -PQPCIVSVEGLS.SS.T.TDVQ..LK....NLL.M.S.......V........G.....PIQ........S.LQMLP
ENSMODP00000004377  ------IPVGNFN.DE.V.MAGM..LK....NYF.Q.Eank....F........G.....DVE........N.VTYPT
ENSMODP00000003434  -------------.--.-.----..--....-LL.A.Q.......Y........G.....TVE........N.VEQV-
ENSMODP00000021792  ------LGILNIP.AS.V.TRPN..LH....NFL.A.P.......F........Qe....AIN........E.VKIIK
ENSMODP00000000011  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000007341  ----RTLFITGLP.KN.T.RKEV..LE....SHF.R.D.......A........Yptc..TVV........E.VQLCY
ENSMODP00000010183  -----AIQCKNIP.NY.L.NDRMv.LE....KHF.G.R.......F........G.....KVQ........R.IYPRR
ENSMODP00000028156  --EMCIVLISNLP.NKgY.STEE..VS....NLA.K.P.......F........G.....GLK........D.ILILS
ENSMODP00000015423  --ESKTIMLKRIY.RS.T.PPEV..IV....EVL.E.P.......Y........Vrl...STA........N.VRIIK
ENSMODP00000013069  -----IIYLGHIP.PC.L.RPLH..VR....NLL.S.A.......H........G.....EIG........R.VFFQS
ENSMODP00000038791  -------------.--.-.-EEI..LR....VVF.E.S.......F........G.....KIK........N.IDIPM
ENSMODP00000000011  -------------.--.-.----..--....---.-.-.......-........-.....---........-.---PM
ENSMODP00000002674  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000039642  ---------RNLR.PS.L.TQEM..VT....EVL.L.V.......F........G.....PIE........S.VTSMG
ENSMODP00000036724  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000023634  ----RTLFINGIS.KY.A.ESEN..IK....KHF.E.E.......A........Ypnc..TVL........E.ARPCY
ENSMODP00000000087  -------------.--.-.NEEV..LI....KVF.E.T.......F........G.....EIR........N.VDIPM
ENSMODP00000007362  ----CIVILREVP.ES.T.PVEE..VE....ALF.T.Gdn.....L........P.....KFV........N.CEFAY
ENSMODP00000011262  -------------.--.-.--EH..LL....KVF.G.T.......F........G.....VIS........S.VRILK
ENSMODP00000001586  -------------.--.-.----..--....NLF.G.P.......F........G.....ALT........S.IRVLR
ENSMODP00000013441  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000022828  ---TRTILVEDLP.PG.V.NEIF..IS....LFF.E.Nphng...G........G.....PVT........M.VQYFP
ENSMODP00000013444  -------------.--.-.----..--....---.-.-.......-........-.....---........-.-----
ENSMODP00000002674  ------VHMKEFP.YR.A.TENA..IY....NLF.S.Y.......H........S.....TLL........E.V----


                                                                            50           60         
                                                                             |            |         
d1u1qa_               ......................DP......NTK................R..SRGFG.F.VTYA.TVEEVDAAMN...
ENSMODP00000007717  ......................D-......ESG................K..SKGFG.F.VSFE.RHEDAQKAVDe..
ENSMODP00000022014  ......................D-......PSG................K..SKGFG.F.VSFE.KHEDANKAVEe..
ENSMODP00000029058  ......................D-......ENG................Q..SRGFG.F.VNFE.KHEEAQKAVSn..
ENSMODP00000027267  ......................D-......ESG................T..SKGFG.F.VNFE.RHEDAQKAVEe..
ENSMODP00000023398  ......................DR......VTG................Q..HQGYG.F.VEFL.SEEDADYAIKi..
ENSMODP00000037814  ......................D-......DCG................R..SKGFG.F.VSFQ.SHEDAQAAVDd..
ENSMODP00000021348  ......................D-......ESG................T..SKGFG.F.VNFE.RHEDAQKAVEe..
ENSMODP00000027586  ......................D-......ESG................K..SKGFG.F.VSYE.KHEDAQRAVDe..
ENSMODP00000022014  ......................DM......ITR................R..SLGYA.Y.VNFQ.QPADAERALDt..
ENSMODP00000029058  ......................DV......ATR................R..SLGYA.Y.INFQ.QPADAERALDt..
ENSMODP00000021348  ......................DM......ITR................R..SLGYA.Y.VNFQ.QPADAERALEt..
ENSMODP00000027586  ......................DM......LTR................R..SLGYA.Y.VNFQ.QLADAERVLEt..
ENSMODP00000037814  ......................DS......VTQ................H..SLGYA.Y.VNFQ.HRAHAEWVLAt..
ENSMODP00000004837  ......................DQ......VTG................V..SRGVG.F.IRFD.KRIEAEEAIKg..
ENSMODP00000020923  ......................G-......PDG................L..SRGCA.F.VTFS.TRAMAQNAIKt..
ENSMODP00000007717  ......................DM......ITR................R..SLGYA.Y.VNFQ.QPADAERALDt..
ENSMODP00000024842  ......................G-......PDG................L..SRGCA.F.VTFT.TRAMAQTAIKa..
ENSMODP00000006200  ......................DQ......TTG................L..SRGVA.F.IRFD.KRSEAEEAITs..
ENSMODP00000036724  ......................G-......PDG................T..SKGCA.F.VKFG.SQAEAQAAINs..
ENSMODP00000004717  ......................DR......VSG................A..SRGVG.F.ILFD.KKSEAEEAIKa..
ENSMODP00000008249  ......................DQ......VTG................V..SRGVG.F.IRFD.KRIEAEEAIKg..
ENSMODP00000027604  ......................DR......VSG................A..SRGVG.F.ILFD.KKSEAEEAIKa..
ENSMODP00000023901  ......................G-......PDG................N..SKGCA.F.VKFS.SHTEAQAAIHa..
ENSMODP00000023578  ......................G-......PDG................T..SKGCA.F.VKFQ.THAEAQAAINt..
ENSMODP00000007804  ......................D-......PNT................K..WSGFD.F.VTYA.TVEEVDAAMN...
ENSMODP00000034649  ......................DP......QTK................H..SRGFG.F.VTYS.CVEEVDAAMC...
ENSMODP00000018486  ......................R-......--R................G..GPPFA.F.VEFE.DPRDAEDAVYg..
ENSMODP00000006475  ......................DK......TTN................K..CKGYG.F.VDFD.SPAAAQKAVSa..
ENSMODP00000014208  ......................--......---................-..-RGFG.F.VEFE.DPRDADDAVYe..
ENSMODP00000040531  ......................--......---................-..-NGYG.F.VEFD.DLRDADDAVYe..
ENSMODP00000010059  ......................--......---................-..-----.-.----.EDASTAMAIKa..
ENSMODP00000013841  ......................--......---................-..-NGYG.F.VEFD.DLRDADDAVYe..
ENSMODP00000014054  ......................DI......KTG................H..SKGFG.F.VRFT.EYETQVKVMS...
ENSMODP00000009994  ......................D-......---................-..-RGFG.F.IRLE.SRTLAEIAKAe..
ENSMODP00000004654  ......................D-......AEG................K..SRGCA.V.VEFK.MEESMKKAAEv..
ENSMODP00000001901  ......................DS......ETG................R..SKGYG.F.ITFS.DSECAKKALEq..
ENSMODP00000038186  ......................N-......DSSlyp.............H..MFSRA.Y.INFK.NQEDIVLFRDr..
ENSMODP00000029243  ......................DK......VKK................T..ACGFC.F.VEYY.CRADAENAMRy..
ENSMODP00000012172  ......................DK......HTK................E..SKGIA.F.VKFA.RSSQACRAMEe..
ENSMODP00000019849  ......................DK......VKK................T..ACGFC.F.VEYY.CRADAENAMRy..
ENSMODP00000000959  ......................DQ......RTG................R..SRGFA.F.VYFE.RIDDSKEAMEr..
ENSMODP00000003831  ......................R-......--R................G..LAPFA.F.VRFE.DPRDAEDAIYg..
ENSMODP00000016570  ......................DQ......QSR................R..SRGFA.F.VYFE.NVDDAKEAKEr..
ENSMODP00000022371  ......................G-......---................-..-KGFG.F.IKLE.SRALAEIAKAe..
ENSMODP00000034857  ......................DK......VKK................T..ACGFC.F.VEYY.CRADAENAMRy..
ENSMODP00000034858  ......................DK......VKK................T..ACGFC.F.VEYY.CRADAENAMRy..
ENSMODP00000005475  ......................D-......---................-..-KGFG.F.IRLE.TRTLAEIAKVe..
ENSMODP00000022505  ......................DD......ASG................K..SKIFG.L.VSFE.KHEDANKADEe..
ENSMODP00000003848  ....................adPS......LYP................H..LYSRA.Y.INFR.NPDDILLFRDr..
ENSMODP00000004397  ......................DG......LTK................K..PKGFA.F.ITFM.FPEHAVKAYAe..
ENSMODP00000001893  ......................DR......YTK................E..SRGFA.F.VRFH.DKRDAEDAMDa..
ENSMODP00000017573  ......................DR......ETS................K..SRGFA.F.ITFE.SPADAKDAARd..
ENSMODP00000004247  ......................D-......AEG................K..SKGCA.V.VEFK.MEESMKKAAEv..
ENSMODP00000001568  ......................E-......FSG................E..NRGYA.F.VMYT.TKEEAQLAIRi..
ENSMODP00000012202  ......................DQ......QSR................L..SRGFA.F.VYFK.NVADAKEAKEr..
ENSMODP00000031808  ......................--......-VN................G..VPQYA.F.LQYC.DITSVCKAIKk..
ENSMODP00000006523  ......................DR......ETQ................R..SRGFG.F.VTFE.NIDDAKDAMMa..
ENSMODP00000019256  ......................D-......FDG................K..NRGYA.F.IMYT.HKREAKRAVRe..
ENSMODP00000031416  ......................DR......ETG................K..PKGYG.F.CEYQ.DQETALSAMRn..
ENSMODP00000022875  ......................DP......LTG................L..NRGYA.F.VTFC.TKEAAQEAVKl..
ENSMODP00000025722  ......................D-......FDG................K..NRGYA.F.VMYT.HKREAKRAVRe..
ENSMODP00000013678  ......................NR......LTG................I..PAGYC.F.VEFA.DLATAEKCLHk..
ENSMODP00000019066  ......................DQ......QSR................R..SRGFA.F.VYFE.SVDNAKEAREg..
ENSMODP00000014920  ......................P-......ARG................Q..GGAYA.F.LKFQ.NLDMAHRAKVa..
ENSMODP00000011039  ......................DM......ATG................K..SKGYG.F.VSFY.NKLDAENAIVh..
ENSMODP00000025181  ......................DK......DTR................K..SKGVA.F.ILFL.DKESAQNCSRa..
ENSMODP00000006917  ......................SE......RSG................H..SKGYG.F.VEYM.KKDSAARAKSd..
ENSMODP00000028798  ......................DM......ATG................K..SKGYG.F.VSFF.NKWDAENAIQq..
ENSMODP00000031317  ......................DP......LTK................R..SRGFG.F.VTFV.DQAGVDKVLA...
ENSMODP00000001566  ......................DK......ITG................Q..SLGYG.F.VNYI.DPKDAEKAINt..
ENSMODP00000034177  ......................DP......DTG................R..SKGFG.F.LTFS.DSECARRALEq..
ENSMODP00000015039  ......................DK......KTG................K..SKGFC.F.LCYE.DQRSTILAVDn..
ENSMODP00000023377  ......................DR......RTG................Y..LKGYT.L.VEYE.TYKEAQAAMEg..
ENSMODP00000004837  ......................DK......ITG................Q..SLGYG.F.VNYI.DPKDAEKAINt..
ENSMODP00000021002  ......................DW......KTG................E..SLCYA.F.IEFE.KEEDCEKAFFk..
ENSMODP00000027677  ......................--......---................-..-----.F.VEDP.HIASALKAAD...
ENSMODP00000022505  ......................EM......ITR................H..SLGYA.Y.VNFQ.QRADAEPALDt..
ENSMODP00000001487  ......................NE......TTG................H..SKGYG.F.VEYM.KKDSAAKARSe..
ENSMODP00000038918  ......................DA......EKQ................R..PRGFG.F.ITFE.DEQSVDQAVN...
ENSMODP00000011435  ......................DP......TTG................K..HKGYG.F.IEYE.KAQSSQDAVSs..
ENSMODP00000011432  ......................DP......TTG................K..HKGYG.F.IEYE.KAQSSQDAVSs..
ENSMODP00000006345  ......................DA......EKQ................R..PRGFG.F.ITFE.DEQSVDQAVN...
ENSMODP00000024718  ......................DR......QSG................K..KRGFA.F.VTFD.DHDTVDKIVV...
ENSMODP00000009844  ......................S-......--L................K..MRGQA.F.VIFK.EISSATNALRs..
ENSMODP00000003000  ......................DR......ETG................S..SKGFG.F.VDFN.SEEEAKAAKEa..
ENSMODP00000014933  ......................DT......KTN................E..RRGFC.F.ITYT.DEEPVKKLLE...
ENSMODP00000022015  ......................DY......ETE................K..HRGFA.F.VEFE.LAEDAAAAIDn..
ENSMODP00000015618  ......................DV......VTG................F..SKRYA.F.IEYK.EERSLLKAYRd..
ENSMODP00000001920  ......................DR......YTK................E..SRGFA.F.VRFH.DKRDAEDAMDa..
ENSMODP00000027267  ......................D-......-EH................G..SKGYG.F.VHFE.TRDAAERAIDk..
ENSMODP00000026325  ......................S-......---................-..-FKRV.R.INFS.NPLSAADARLq..
ENSMODP00000013647  ......................DR......QTG................K..SRGYG.F.VTMA.DRAAAERACK...
ENSMODP00000020553  ......................DR......QTG................K..SRGYG.F.VTMA.DRAAAERACK...
ENSMODP00000003678  ......................D-......RSG................R..SLGTA.D.VHFE.RKADALKAMKq..
ENSMODP00000029789  ......................DP......NTQ................G..SRGFG.F.VTYA.TVEEVDAAMN...
ENSMODP00000000721  ......................DR......QSG................K..KRGFG.F.VTFD.DHDPVDKIVL...
ENSMODP00000006200  ......................DK......VAG................H..SLGYG.F.VNYV.TAKDAERAINt..
ENSMODP00000004743  ......................DK......YSG................H..PKGYA.Y.IEFA.HEDSVKTAAE...
ENSMODP00000014913  ......................DN......KTN................K..RRGFC.F.ITFK.EEEPVKKIMEkk.
ENSMODP00000038918  ......................DK......TTN................Q..SRGFG.F.VKFK.DPNCVGTVLA...
ENSMODP00000006371  ......................DK......TTG................Q..SKGFA.F.ISFH.RREDAARAIAg..
ENSMODP00000006345  ......................DK......TTN................Q..SRGFG.F.VKFK.DPNCVGTVLA...
ENSMODP00000015438  ......................D-......RAG................V..SKGYG.F.ITFE.TQEDAQKILQe..
ENSMODP00000008450  ......................DT......KTN................E..RRGFC.F.ITYT.DEEPVKKLLE...
ENSMODP00000010490  ......................NK......VTG................V..GKGCG.Y.VLFE.NTDAVQLALR...
ENSMODP00000007208  ......................N-......-ER................G..SKGFG.F.VTFE.NSADADRAREk..
ENSMODP00000024712  ......................DK......KTG................K..SKGFC.F.LCYE.DQRSTILAVDn..
ENSMODP00000017405  ......................D-......KDG................K..PKQFA.F.VNFK.HEESVPYGMNl..
ENSMODP00000001337  ......................N-......-ER................G..SKGFG.F.VTFE.NSADADRAREk..
ENSMODP00000028798  ......................D-......-TA................G..NDPYC.F.VEFY.EHRHAAAALAa..
ENSMODP00000002547  ......................N-......-ER................G..SKGFG.F.VTFE.TSTDADRAREk..
ENSMODP00000005593  ......................DK......FSG................H..PKGFA.Y.IEFS.DKDSVRTSMA...
ENSMODP00000018401  ......................DK......QSG................K..KRGFG.F.VYFQ.SHDAADKAAV...
ENSMODP00000014913  ......................DP......ITG................R..SRGFG.F.VLFK.ESESVDKVVMd..
ENSMODP00000016281  ......................DF......YTR................R..PRGFAyF.FTFE.DVRDAEDALHn..
ENSMODP00000004397  ......................KK......NKAgvs.............L..SMGFG.F.VEYQ.KPEQAQKALKq..
ENSMODP00000000006  ......................--......KTM................K..MRGQA.F.VIFK.ELGSSTNALRq..
ENSMODP00000020576  ......................D-......FNG................N..NRGYA.F.VTFS.NKQEAKNAIKq..
ENSMODP00000005194  ......................DP......KTN................K..RRGFV.F.ITFK.EEDPVKKILE...
ENSMODP00000002993  ......................NA......QTN................R..SRCFG.F.ITFS.SLSEADAAMA...
ENSMODP00000015362  ......................K-......---................-..-SGYA.F.VDCP.DEHWAMKAIEtf.
ENSMODP00000004717  ......................DR......STG................Q..SLGYG.F.VNYV.DPRDAEQAVCl..
ENSMODP00000018934  ......................K-......PDG................K..MRGFA.F.VQFK.NLLEAGKALKg..
ENSMODP00000027604  ......................DR......STG................Q..SLGYG.F.VNYV.DPRDAEQAVCl..
ENSMODP00000002993  ......................NK......QSG................K..KRGFG.F.VHFF.DHDTADKAAV...
ENSMODP00000000363  ......................G-......PDG................N..SKGCA.F.VKYS.SHAEAQAAINa..
ENSMODP00000014933  ......................DP......VTG................R..SRGFG.F.VLFK.DAASVDKVLE...
ENSMODP00000016940  ......................N-......---................-..PPGFA.F.VEFE.DPRDAADAVRe..
ENSMODP00000007822  ......................K-......---................N..NQFQA.L.LQYS.DPVSAQHAKLs..
ENSMODP00000002891  ......................DP......NTK................Q..SRGFA.F.VTYT.TVEEINAVMN...
ENSMODP00000003337  ......................D-......SEG................K..SRGCG.V.VEFK.DEEFVKKALEt..
ENSMODP00000005194  ......................DP......NTG................R..SRGFG.F.ILFK.ESASVDKVLD...
ENSMODP00000008450  ......................DP......VTG................R..SRGFG.F.VLFK.DAASVDKVLE...
ENSMODP00000017452  ......................DK......RTG................K..TKGYG.F.VSFK.DPSDYVRAMRe..
ENSMODP00000010785  ......................N-......---................-..PPGFA.F.VEFE.DPRDAEDAVRg..
ENSMODP00000010799  ......................DK......ETG................K..PKGDA.T.VSYD.DPPTAKAAVEw..
ENSMODP00000004654  ......................E-......-NG................K..SKGCG.V.VKFE.SPEVAERACRm..
ENSMODP00000022797  ......................DF......YTR................R..PRGFA.YlVIFE.DVRDAEDALYn..
ENSMODP00000016382  ......................S-......---................-..-FRRV.R.INFS.KPEAAARARIe..
ENSMODP00000003786  ......................--......---................-..-NGYG.F.VEFE.DSRDADDAVYe..
ENSMODP00000017322  ......................DK......ETD................K..FKGFC.Y.VEFD.EVDSLKEALT...
ENSMODP00000020165  ......................D-......---................-..---YA.F.VHFE.DRGAAVKAMDe..
ENSMODP00000010787  ......................N-......---................-..PPGFA.F.VEFE.DPRDAEDAVQg..
ENSMODP00000001412  ......................NA......RSP................G..ARCYG.F.VTMS.TSDEATKCINh..
ENSMODP00000015013  ......................DR......ETG................K..SKGFC.F.LCYR.DQRSTILTFEn..
ENSMODP00000003000  ......................T-......KDG................T..PKGIA.Y.VEFK.TEADVDKALEe..
ENSMODP00000011795  ......................G-......PDG................R..VTGEA.D.VEFA.THEDAVAAMS...
ENSMODP00000022875  ......................D-......---................-..---YA.F.IHFD.ERDGAVKAMEe..
ENSMODP00000028798  ......................D-......---................-..-KGYS.F.VRFN.SHESAAHAIVs..
ENSMODP00000003337  ......................D-......KDG................K..SRGMG.T.VTFD.QAIEAVQAISm..
ENSMODP00000018401  ......................NP......QTK................R..SRCFG.F.VTYS.NVEEADAAMA...
ENSMODP00000019828  ......................ER......MHPh...............L..SKGYA.Y.VEFE.NPDEAEKALKh..
ENSMODP00000011039  ......................E-......---................-..-KGYS.F.VRFS.THESAAHAIVs..
ENSMODP00000010024  ......................D-......---................-..---YA.F.VHME.RAEDAVEAIRg..
ENSMODP00000023575  ......................S-......---................-..-FRRV.R.INFS.NPKSAARARIe..
ENSMODP00000001566  ......................DQ......VTG................V..SRGVG.F.IRFD.KRIEAEEAIKg..
ENSMODP00000031345  ......................N-......RAG................K..PKGLA.Y.VEYE.NESQASQAVLk..
ENSMODP00000011039  ......................EQ......PDSrrvnssvgfsvlqht.S..NDPYC.F.VEFY.EHRDAAAALAa..
ENSMODP00000017614  ......................--......-DR................H..PDGVA.S.VSYK.EPEEADLCIQa..
ENSMODP00000011435  ......................DS......VTM................K..HKGFA.F.VEYE.VPEAAQLALEq..
ENSMODP00000011432  ......................DS......VTM................K..HKGFA.F.VEYE.VPEAAQLALEq..
ENSMODP00000035735  ......................D-......FDG................K..NRGYA.F.VMYT.HKHEAKRAVRe..
ENSMODP00000001944  ......................D-......NTG................Q..GLGQA.L.VQFK.TEDDAHKAER...
ENSMODP00000036858  ......................DP......LTG................L..NRGYA.F.VTFC.TKEAAQEAVKl..
ENSMODP00000005193  ......................K-......---................N..NQFQA.L.LQYG.DPVNAQQAKLa..
ENSMODP00000028751  ......................DK......ETG................K..PKGDA.T.VSYD.DPPTAKAAVEw..
ENSMODP00000039173  ......................P-......-DG................R..VTGEV.D.VEFA.THEDAVAAMS...
ENSMODP00000006815  ......................K-......---................N..NQFQA.L.LQYA.DPLNAHYAKMt..
ENSMODP00000020576  ......................D-......---................-..---YA.F.VHFN.NRDDAVNAMKa..
ENSMODP00000025722  ......................D-......---................-..---YA.F.VHFT.SREDAIRAMNs..
ENSMODP00000002300  ......................DR......ETG................K..LKGEA.T.VSFD.DPPSAKAAIDw..
ENSMODP00000003786  ......................ER......---................-..-TNEG.V.IEFR.SYSDMKRALDk..
ENSMODP00000023826  ......................DH......RGR................K..KTGEA.Y.VQFE.EPEMANQALL...
ENSMODP00000033056  ......................D-......---................-..---YA.F.VHME.KEADAKAAIEq..
ENSMODP00000009807  ......................D-......---................-..---YA.F.VHME.KEADAKAAIEq..
ENSMODP00000018415  ......................D-......RTG................V..SKGYG.F.VSFY.NDVDVQKIVE...
ENSMODP00000000175  ......................SK......KTG................N..SKGYG.F.LEFE.SDDVAKIVADt..
ENSMODP00000039175  ......................D-......RTG................V..SKGYG.F.VSFY.NDVDVQKIVE...
ENSMODP00000036858  ......................D-......---................-..---YA.F.IHFD.ERDGAVKAMEe..
ENSMODP00000008249  ......................DK......ITG................Q..SLGYG.F.VNYV.DPNDGDKPFNp..
ENSMODP00000032411  ......................DK......NTN................Q..CKGYG.F.VDFD.SPAAAQKAVA...
ENSMODP00000001944  ......................YG......PNG................K..ATGEG.F.VEFR.SESDYKAALC...
ENSMODP00000009227  ......................D-......DKG................V..GLGEA.L.VKFK.SEEQAMKAES...
ENSMODP00000007480  ......................A-......ESKsyf.............P..PKGYA.F.LLFQ.DESSVQALID...
ENSMODP00000011795  ......................D-......FQG................R..STGEA.F.VQFA.SQEIAEKALK...
ENSMODP00000002604  ......................--......NTP................E..TRGTA.Y.VVYE.DIFDAKNACDh..
ENSMODP00000021564  ......................G-......ADG................R..ATGEA.D.VEFV.THEDAVAAMS...
ENSMODP00000036078  ......................A-......ESKsyf.............P..PKGYA.F.LLFQ.EESSVQALID...
ENSMODP00000010024  ......................N-......---................-..---YG.F.VHIE.DKTAAEDAIRn..
ENSMODP00000013583  ...................prtDQ......ERG................R..KRNCG.F.VAFM.NRIDAERALKn..
ENSMODP00000013581  ...................prtDQ......ERG................R..KRNCG.F.VAFM.NRIDAERALKn..
ENSMODP00000001370  ......................A-......ESKsyf.............P..PKGYA.F.LLFQ.EESSVQALID...
ENSMODP00000010502  ......................SK......KTR................N..SKGYG.F.LEFE.SDDVAKIVADr..
ENSMODP00000018934  ......................HQ......DTE................H..SKGCA.F.AQFM.TQEAAQACLAa..
ENSMODP00000031808  ......................K-......RGS................E..GGVAA.F.VDFV.DIKSAQKAHNs..
ENSMODP00000013458  ......................--......---................-..-----.-.----.------D---...
ENSMODP00000004397  ......................KMt.....GTG................P..HRGFG.F.VDFL.TKQDAKRAFNal.
ENSMODP00000002817  ......................RV......LTG................R..MKGQA.F.VTFP.NMEMAQQALLl..
ENSMODP00000024842  ......................DR......SQNpp..............Q..SKGCC.F.VTFY.TRKAALEAQNa..
ENSMODP00000021564  ......................D-......YQG................R..STGEA.F.VQFA.SKEIAENALG...
ENSMODP00000035400  ......................PR......TDEera.............R..ERNCG.F.VAFM.NRRDAERALKn..
ENSMODP00000003000  ......................N-......NQG................R..PKGYA.F.IEFA.SVEDAKEALNs..
ENSMODP00000007934  ......................R-......---................-..-QHCA.F.IQFA.TRQAAEMAAEks.
ENSMODP00000001484  ......................NA......RSP................G..ARCYG.F.VTMS.TSEEATKCINh..
ENSMODP00000008195  ......................--......---................-..-KGFA.F.VQYV.NERNARAAVAg..
ENSMODP00000001568  ......................D-......---................-..---YA.F.VHFF.NREDAVAAMSv..
ENSMODP00000010946  ......................NA......RSP................G..AKCYG.I.VTMS.SSTEVARCIAh..
ENSMODP00000003430  ......................--......---................-..-KGYA.F.VQYA.SERHARAAVLg..
ENSMODP00000007024  ......................YK......STG................D..PKGFA.F.VEFE.TKEQADKAIEf..
ENSMODP00000011964  ......................R-......---................-..-QQCA.F.IQFA.TRQAAEMAAEks.
ENSMODP00000024532  ......................D-......-ET................Q..PTRFA.F.VEFA.DQNSVPRALA...
ENSMODP00000004397  ......................T-......KDG................K..FRKFG.F.IGFK.SEEEAQRALDh..
ENSMODP00000032411  ......................D-......ANG................V..SRGVG.F.ARME.STEKCEVVIQh..
ENSMODP00000010717  ......................F-......---................-..-KRQA.L.VEFE.NIDSAKECVTfaa
ENSMODP00000008758  ......................E-......---................T..DEPYL.C.IHYG.VLEAAQLAIEt..
ENSMODP00000021972  ......................--......---................-..-KGIA.F.VPYV.NERNACAAVAg..
ENSMODP00000035735  ......................D-......---................-..---YA.F.VHFT.SREDAVHAMNs..
ENSMODP00000018834  ......................P-......---................-..-RNCA.F.VTYE.KMESADQAIAe..
ENSMODP00000020165  ......................DP......LSG................Q..NRGYA.F.ITFC.GKDAAQEAVKl..
ENSMODP00000031345  ......................S-......NRG................D..FRGYC.Y.VEFK.EEKAALQALS...
ENSMODP00000023979  ......................KG......VGG................K..LPNFG.F.VVFD.DSEPVQRILVa..
ENSMODP00000015407  ......................R-......KTG................V..SRGFA.F.VEFY.HLQDATSWMEan.
ENSMODP00000014946  ......................M-......---................-..-KSQA.F.IEME.TREDAMAMVEhca
ENSMODP00000003584  ......................E-......--G................R..MKGQA.F.IGFP.DEKAAAKALKe..
ENSMODP00000007822  ......................NK......---................-..-KENA.L.VQMA.DGNQAQLAMSh..
ENSMODP00000002891  ......................DR......GID................K..KKGFA.F.VTFD.GHDSALDKIVf..
ENSMODP00000016781  ......................K-......---................-..-KRQA.L.VEFE.DILGACNAVNyaa
ENSMODP00000009227  ......................KH......PTG................R..NNGDC.L.VKFA.TSHDALGGLQ...
ENSMODP00000018934  ......................EK......GSK................T..CRGFG.Y.VTFS.MLEDAQRAIKe..
ENSMODP00000011795  ......................T-......REG................R..PSGEA.F.VELE.SEDEVKLALK...
ENSMODP00000029701  ......................SK......RSG................K..PRGYA.F.IEYE.HERDMHXXXKh..
ENSMODP00000011218  ......................G-......--G................K..LPNFG.F.VVFD.DPEPVQKILGs..
ENSMODP00000007822  ......................G-......---................-..-KNQA.F.LEMN.TEEASNTMVSy..
ENSMODP00000001901  ......................DR......NSR................R..SKGIA.Y.VEFV.DVSSVPLAIG...
ENSMODP00000005193  ......................G-......---................-..-KNQA.F.LELA.TEESAITMVNy..
ENSMODP00000013253  ......................T-......---................-..-GNWM.H.IRYQ.SKLQARKALS...
ENSMODP00000001062  ......................DI......KTG................H..SKGFG.F.VSFM.EYKMQVKVMS...
ENSMODP00000006815  ......................NK......---................-..-KENA.L.VQMA.DANQAQLAMNh..
ENSMODP00000012172  ......................DP......YSN................-..-YGHG.V.VQYF.NVASAIYAKYk..
ENSMODP00000005193  ......................NK......---................-..-KDSA.L.IQMA.DGNQSQLAMNh..
ENSMODP00000000232  ......................D-......KQG................N..LKGDG.L.CCYL.KRESVDLALRl..
ENSMODP00000034177  ......................DR......NSR................R..SKGIA.Y.VEFC.EIQSVPLAIG...
ENSMODP00000006415  ......................EK......ETG................F..HKGFC.W.IGFS.SEEELQRTLQ...
ENSMODP00000035735  ......................SA......ADKm...............K..NRGFA.F.VEYE.SHRAAAMARRkl.
ENSMODP00000023866  ......................D-......KDT................S..PKGEA.T.VSFD.DPPSAKAIDW...
ENSMODP00000026309  ......................P-......---................-..-RGCA.Y.IVMV.HRQDAYRALQkls
ENSMODP00000041019  ......................--......---................-..-KGYA.F.VQYM.SERHARAAVAg..
ENSMODP00000001219  ......................K-......---................-..-TGYA.F.VDCP.DENWAMKAIEtl.
ENSMODP00000006815  ......................G-......---................-..-KSQA.F.LEMA.SEEAAVTMVNy..
ENSMODP00000010225  ......................T-......LHK................A..FKGSI.F.AVFD.SVESAKKFIE...
ENSMODP00000017514  ......................N-......LGD................H..LVGNV.Y.VKFR.REEDAERAVTe..
ENSMODP00000039002  ......................N-......LGD................H..LVGNV.Y.VKFR.REEDAEKAVId..
ENSMODP00000009010  ......................N-......AQG................R..RNGEA.L.VRFV.SEEHRDLALQ...
ENSMODP00000020576  ......................SA......ADKt...............K..NRGFA.F.VEYE.SHRAAAMGRRkll
ENSMODP00000036858  ......................QP......DDKk...............K..NRGFC.F.LEYE.DHKTAAQARRrl.
ENSMODP00000029254  ......................P-......---................-..-RGCA.Y.VCMV.HRQDSYRALQkls
ENSMODP00000017614  ......................D-......KQG................N..LKGDG.L.CCYL.KKESVDLALKl..
ENSMODP00000018402  ......................N-......---................-..-KPYS.F.VRYR.TKEESQKAYVa..
ENSMODP00000016781  ......................SK......---................-..-PGAA.M.VEMA.DGYAVDRAITh..
ENSMODP00000013040  ......................S-......---................-..-TNQA.F.LEMA.YTEAAQAMVQyyq
ENSMODP00000002441  ......................DG......KHP................RcpPKGYV.Y.LVFE.LEKSVRALLQacs
ENSMODP00000009010  ......................N-......HQG................R..PSGDA.F.IQMK.SADRAFMAAQk..
ENSMODP00000023826  ......................N-......RDG................K..RRGDA.L.VEME.SEQDVKKALE...
ENSMODP00000004397  ......................N-......AHG................N..KTGYV.F.VDFN.SEGDVEKALK...
ENSMODP00000008593  ......................P-......---................-..--GVA.E.VVFV.KKEDAITAYKk..
ENSMODP00000014946  ......................K-......---................-..-INEA.F.IEMS.TTEDAQAAVDyyt
ENSMODP00000020165  ......................QPd.....DKK................K..NRGFC.F.LEYE.DHKSAAQARRrl.
ENSMODP00000019256  ......................--......-FK................K..IRNYA.F.VHFT.SWKGAVRAMNs..
ENSMODP00000001487  ......................N-......---................-..-KRTA.F.VTLL.DGEQAQNAIQt..
ENSMODP00000023578  ......................DK......YTG................L..HKGCA.F.LTYC.ARDSALKAQSa..
ENSMODP00000018618  ......................--......---................-..-KNFC.H.IRFA.EEFMVDKAIY...
ENSMODP00000001944  ......................D-......HVG................R..NNGNG.L.VKFF.SPQDTFEALK...
ENSMODP00000024562  ......................HKsga...LEG................Q..PRGYC.F.VNFE.TKQEAEQAIQc..
ENSMODP00000010717  ......................T-......---................-..IPGTA.L.VEMG.DEYAVERAVTh..
ENSMODP00000033971  ......................G-......---................-..CKCFA.F.VDLA.SVENVHLAVKq..
ENSMODP00000010437  ......................G-......ASG................K..LQAFG.F.CEYK.EPESTLRALRl..
ENSMODP00000017391  ......................G-......--G................K..LPNFG.F.VVFD.DPEPVQKILGs..
ENSMODP00000016781  ......................K-......---................-..NGVQA.M.VEYP.WLLDAQRAKAs..
ENSMODP00000031445  ......................NP......KNK................K..HLGIA.K.VVFA.TVKGAREAVQh..
ENSMODP00000017592  ......................ST......SYAgsq.............G..PSASA.Y.VTYI.RSEDALRAIQc..
ENSMODP00000003000  ......................DV......RIG................A..TRKFG.Y.VEFE.SAEDMEKALE...
ENSMODP00000021460  ......................N-......FEP................H..LRGNV.Y.VQYQ.SEEECQAAFSl..
ENSMODP00000030260  ......................G-......--G................K..LPSLG.F.VVFD.DLKPVQKILGs..
ENSMODP00000010225  ......................G-......---................-..-AKEG.I.ILFK.--EKAKEALEk..
ENSMODP00000005193  ......................Q-......---................R..DHKMA.L.LQMA.TVEEAIQALId..
ENSMODP00000006917  ......................Y-......---................-..-KGTA.F.VTLL.NGEQAESAIRt..
ENSMODP00000023718  ......................T-......---................S..KQPVG.F.VSFD.SRSEAEAAKNa..
ENSMODP00000006381  ......................N-......QQG................R..PSGDA.F.IQMK.SADRALVAAQr..
ENSMODP00000013139  ......................T-......---................S..KQPVG.F.VTFD.SRAGAEAAKNa..
ENSMODP00000011106  ......................S-......---................H..NYRYA.S.LVFK.KANRARLAVEe..
ENSMODP00000011084  ......................DK......DTR................K..SKGVA.F.ILFL.DKESAQNCSRa..
ENSMODP00000033409  ......................NR......ANG................Q..SKGYA.E.VVVA.SENSVHKLLEl..
ENSMODP00000007822  ......................--......---................K..DRKMA.L.IQMG.SVEEAIQSLId..
ENSMODP00000000011  ......................D-......--G................R..VIGEA.D.VEFA.THKDAVAAIS...
ENSMODP00000019244  ......................--......---................-..-KNFC.H.IRFA.EEFMVDKALY...
ENSMODP00000013327  ......................NK......SSG................Q..SRGFA.F.VEFS.HLQDAARWMEan.
ENSMODP00000009227  ......................LY......KDQ................K..RTGSA.F.VMFK.TLRDYNSALA...
ENSMODP00000020775  ......................--......---................-..-----.-.----.----------...
ENSMODP00000008836  ......................NR......ANG................Q..SKGFA.L.VGVG.SEASSKKLMDl..
ENSMODP00000018496  ......................DK......TTN................R..HRGFG.F.VTFE.NEDVVEKVCE...
ENSMODP00000012937  ......................H-......---................-..-RPFA.F.VTFK.SQEERDRAMKv..
ENSMODP00000024766  ......................D-......PTG................K..SKGFG.F.VTFE.KHEDAVKAGEe..
ENSMODP00000006381  ......................AN......AQG................R..RTGEA.L.VRFV.DSEQRDLSLE...
ENSMODP00000010717  ......................--......---................-..-----.-.----.----------...
ENSMODP00000009664  ......................--......---................-..-QGQM.L.VTFA.DSRSALNVLD...
ENSMODP00000010490  .....lipakstlskkiaaikrEV......HPE................Q..KSING.Y.VVFK.EESAAEKALK...
ENSMODP00000024054  ......................G-......---................-..-AKEG.I.ILFK.--EKAKEALEk..
ENSMODP00000002114  ......................HP......RTR................K..HLGLA.R.VLFA.STRGAKETVKh..
ENSMODP00000028156  ......................S-......---................-..-RNEA.Y.LEMK.FKEAVAAAVKyce
ENSMODP00000003584  ......................D-......-KG................R..LKHTA.F.ATFP.NEKATIKALSr..
ENSMODP00000036903  ......................DR......GSG................K..KRGFA.F.VTFD.DHDSVDKIVI...
ENSMODP00000003337  ......................E-......-NG................K..SKGCG.T.VRFD.SPESAEKACRi..
ENSMODP00000014333  ......................R-......F--................E..GDNYG.F.VTYR.YAEEAFAAIE...
ENSMODP00000008714  ......................T-......LHK................A..CKGSI.F.VVFD.KEAE------...
ENSMODP00000013327  ......................DK......QTQ................L..NRGFA.F.IQLS.TIVEAAQLLQi..
ENSMODP00000006050  ......................T-......---................-..---SA.F.VSLS.QPEQ------...
ENSMODP00000013604  ......................Q-......---................-..-QQWT.F.IQFA.RQAAEMTAEKs..
ENSMODP00000000664  ......................R-......DDG................D..--SYG.F.ITYR.YTCDAFAALE...
ENSMODP00000012747  ......................K-......---................G..DPEAA.L.IQYL.TNDEARKAIS...
ENSMODP00000026351  ......................D-......---................-..---QM.W.VTFL.EGSSALKVLN...
ENSMODP00000018934  ......................DLkgahgnVKG................Q..SLGYA.F.VEFE.EHEHALAALRhi.
ENSMODP00000015407  ......................DK......QTQ................Q..NRGFA.F.VQLS.SAMDASQLLQv..
ENSMODP00000009575  ......................DK......---................-..-GVFA.I.VEMG.DTGARDAVLA...
ENSMODP00000005447  ......................H-......--T................D..YQLKA.I.VQME.NLQEAISAVNs..
ENSMODP00000005596  ......................RL......NWQ................G..PQGRA.F.LDYK.DQATAECVISs..
ENSMODP00000007024  ......................--......---................-..-----.-.----.----------...
ENSMODP00000024054  ......................T-......LHK................A..FKGSI.F.AVFD.KE--------...
ENSMODP00000001919  ......................H-......--G................D..-PEGA.L.IQFA.TYEEAKKAIS...
ENSMODP00000011172  ......................T-......---................-..-QGTA.L.IRYS.TKQEAAKAQTa..
ENSMODP00000006381  ......................Y-......PDG................R..PTGDA.F.ALFA.CEELAQGALR...
ENSMODP00000009227  ......................--......--G................G..EIGEA.F.IIFA.TDEDARRAMS...
ENSMODP00000001242  ......................E-......--N................P..GRGQV.F.VEYA.NAEIA-----...
ENSMODP00000024718  ......................DP......QTK................R..SRGFG.F.VTYS.CVEEVDAAMC...
ENSMODP00000026104  ....................rvDV......LGN................P..EKTFA.Y.VNVAlSEAALQRCLSa..
ENSMODP00000032086  ......................T-......---................-..-QGNA.V.VRYS.SKEEAAKAQKs..
ENSMODP00000012383  ......................R-......-NK................R..GEKDG.F.ITYR.CSEHAA----...
ENSMODP00000012220  ......................E-......-DG................K..TKGYI.F.LEYV.SPAHALDAVKn..
ENSMODP00000020434  ......................P-......---................-..-HGNA.L.VRYS.SKEEVVKAQKs..
ENSMODP00000000721  ......................DP......ASK................R..SRGFG.F.VTFS.SMAEVDAAMS...
ENSMODP00000000674  ......................PS......DSPlp..............V..SSRVC.F.VKFH.DPDSAVVAQH...
ENSMODP00000024766  ......................DM......ITS................C..SLEYA.N.VNFQ.QPADAEHAPDt..
ENSMODP00000024532  ......................PD......NAPla..............F..SSKVC.Y.VKFR.DPSSVGVAQH...
ENSMODP00000014848  ......................E-......--N................P..GRGQV.F.VEYA.N---------...
ENSMODP00000008714  ......................G-......---................-..-----.-.----.----------...
ENSMODP00000013897  ......................NA......PGA................T..PGFYA.I.IKFY.SARDACSAQKac.
ENSMODP00000008570  kpdlsqrpgepstaaaselfrpK-......-PV................P..GFQVA.Y.LVFR.KRASVQKAVA...
ENSMODP00000015423  ......................DY......SSG................Y..DYGYV.C.VEFS.LLEEAIGCMEan.
ENSMODP00000012747  ......................--......-EE................E..SPLSV.V.LTYK.SRSEAENAAN...
ENSMODP00000001919  ......................S-......---................-..-SLHA.V.ITFK.TRAEAEAAA-...
ENSMODP00000001944  ......................--......--G................G..ELGEA.F.IVFA.TDEDARLGMM...
ENSMODP00000006156  ......................Q-......---................-..-QRKA.I.AKFK.EPAHALAFQQk..
ENSMODP00000004377  ......................R-......---................-..IKGGA.F.VTFQ.EIKDVENILKk..
ENSMODP00000003434  ......................--......HTD................T..EAAVV.N.VTYA.TRDEARGAIEk..
ENSMODP00000021792  ......................D-......-AT................P..SRYMA.L.IKFN.AKDVADTFYSv..
ENSMODP00000000011  ......................--......--G................R..PSGEA.F.VELE.SKDEVKLALK...
ENSMODP00000007341  ......................D-......---................-..-----.-.----.----VAKLIYl..
ENSMODP00000010183  ......................N-......---................-..-RKLA.I.IHFS.DHVSASLAR-...
ENSMODP00000028156  ......................S-......---................H..KKAYM.E.INRK.SADSMVKFYT...
ENSMODP00000015423  ......................NR......TGP................M..GHTYG.F.IDLD.SHSEALRVVRi..
ENSMODP00000013069  ......................EE......RHGrrkkssglggsrggpsL..DYSEG.W.VEFR.DKRVAKLVVAs..
ENSMODP00000038791  ...ldpyqevmatgsfnhctlgS-......---................L..QTFEA.F.IQYQ.EYADFVKAMEs..
ENSMODP00000000011  ......................D-......-FQ................G..GVGEA.F.LQFA.SQKITEKALK...
ENSMODP00000002674  ......................--......---................-..-----.-.----.----------...
ENSMODP00000039642  ......................--......---................-..-QRSA.L.IIFE.NIISASRAVSa..
ENSMODP00000036724  ......................--......---................-..--GCA.F.LTYC.ARDSALKAQSa..
ENSMODP00000023634  .............nvaklmsleD-......-QR................K..EAERG.R.IYFS.NLRARENTPTm..
ENSMODP00000000087  ......ldpyreemtgrnfhtfS-......FGG................H..LNFEA.Y.VQYR.EYVGFIKAMNa..
ENSMODP00000007362  ......................N-......---................-..--DNW.F.ITFE.SEADAQQAYKylr
ENSMODP00000011262  ......pgkelppdirkfssryS-......--Qv...............G..TQVCA.I.VEFE.EVDAAIRAHEs..
ENSMODP00000001586  .........pgkklppdvlpyaT-......--Rypel............L..HCPCA.L.VQFE.SVEAAGQAFTt..
ENSMODP00000013441  ......................--......---................-..-----.-.----.----------...
ENSMODP00000022828  ......................N-......---................-..-DNSA.L.VEFE.THEVIDTLLT...
ENSMODP00000013444  ......................--......---................-..-----.-.----.----------...
ENSMODP00000002674  ......................--......---................-..-----.-.----.----------...


                                  70                    80        90                                
                                   |                     |         |                                
d1u1qa_               AR......P....H..KV...D...G..R..VVEPKRAVSREDSQRPGAH............................
ENSMODP00000007717  MN......G....K..EL...N...G..K..QIYVGRAQKKVERQTELKRkfeqmkqdritr................
ENSMODP00000022014  MN......G....K..DI...N...G..K..MVFVGRAQKKVERQAELKRkfeqlkqerisr................
ENSMODP00000029058  MN......G....K..EL...G...G..R..VLYVGRAQKRSERQSELKRrfeqmkqervnr................
ENSMODP00000027267  MN......G....K..EL...N...G..K..KIYVGRAQKKGERQTELKRkfeqlkqdritr................
ENSMODP00000023398  MN......M....I..KL...Y...G..K..PIRVNKASAHNKNLD----............................
ENSMODP00000037814  MN......G....K..QL...N...G..K..QIYVGRAQKKRERQTELKRhfeqikqnqhir................
ENSMODP00000021348  MN......G....K..EL...N...G..K..KIYVGRAQKKGERQTELKRkfeqlkqdritr................
ENSMODP00000027586  MN......G....K..EF...N...G..K..RIYVGRAQKKGERQTELKRhfeqvkqerssr................
ENSMODP00000022014  MN......F....D..VI...K...G..K..PIRIMWSQRDPSLRKS---............................
ENSMODP00000029058  MN......F....E..VI...K...G..R..PIRIMWSQRDPGLRKS---............................
ENSMODP00000021348  MN......F....D..VI...K...G..K..PVRIMWSQRDPSLRKS---............................
ENSMODP00000027586  MN......L....D..VI...K...G..K..PVRIMWSQRDPSLRKS---............................
ENSMODP00000037814  MN......L....D..VI...K...G..N..PIRIMWSQRDPGQRKR---............................
ENSMODP00000004837  LN......G....Q..KP...P...GatE..PITVKFANNPSQKTNQAILsqlyqspnrrypgplaqqaqrfrldnll
ENSMODP00000020923  MH......Q....S..QT...MegcS..S..PIVVKFADTQKDKEQRRLQqqlaqqmqqlntatwgnltglggltpqy
ENSMODP00000007717  MN......F....D..VI...K...G..K..PVRIMWSQRDPSLRKS---............................
ENSMODP00000024842  MH......Q....A..QT...MegcS..S..PIVVKFADTQKDKEQKRMAqqlqqqmqqisaasvwgnlaglntlgpq
ENSMODP00000006200  FN......G....H..KP...P...G..SsePITVKFAANPNQNKNVALLsqlyhsparrfggpvhhqaqrfrfspmg
ENSMODP00000036724  LH......G....S..QN...MpgaS..S..SLVVKFADTDKERTLRRMHqmagqlgifhpmtvqfgacgvytqaimq
ENSMODP00000004717  LN......G....Q..KP...C...G..NrvPLIVKFAQHQTQRTPQGYLsqtsrfgqegffnmpygvqnmappsysg
ENSMODP00000008249  LN......G....Q..KP...L...GasE..PITVKFANNPSQKTGQALLthlyqssarryagplhhqtqrfrldnll
ENSMODP00000027604  LN......G....Q..KP...C...G..NrvPLIVKFAQHQTQRTPQGYLsqtsrfgqegffnmpygvqnmappsysg
ENSMODP00000023901  LH......G....S..QT...MpgaS..S..SLVVKFADTDKERTLRRMQqmvgqlgiftpsltlpfspysayaqalm
ENSMODP00000023578  LH......S....S..RT...LpgaS..S..SLVVKFADTEKERGLRRMQqvatqlgmfspialqfgaysaytqalmq
ENSMODP00000007804  TR......L....H..KV...Y...G..R..VIEPKRAVSREDSQRPSTH............................
ENSMODP00000034649  AQ......P....H..KV...D...G..H..VVEPKRSISREDSVKPGAH............................
ENSMODP00000018486  RD......G....Y..DY...D...G..Y..RLRVEFPRSGRGTGRGGGGggggggaprgrygppsr...........
ENSMODP00000006475  LK......A....T..--...-...-..-..--------GVQAQMAKQQE............................
ENSMODP00000014208  LD......G....K..EL...C...S..E..RVTIEHARARSRGGRGRGRysdrfssrrprndrrnappv........
ENSMODP00000040531  LN......G....K..DL...C...G..E..RVIVEHARGPRRDGSYGSGrsgygyrrsgrdkygppt..........
ENSMODP00000010059  VN......H....K..IV...Dre.N..R..RITV---------------............................
ENSMODP00000013841  LN......G....K..DL...C...G..E..RVIVEHARGPRRDGSYGSGrsgygyrrsgrdkygppt..........
ENSMODP00000014054  -Q......R....H..MI...D...G..R..WCDCKLPNSKQSPDEPL--............................
ENSMODP00000009994  LD......G....T..IL...K...S..R..PLRIRFAT-----------............................
ENSMODP00000004654  LN......K....H..SL...S...G..R..PLKVKEDPDGEHARRAMQKvmattggmgmgpggpgminippsilnnp
ENSMODP00000001901  LN......G....F..EL...A...G..R..PMKVGHVTERTDASSASSFldsdelertgidlgttgrlqlmarlaeg
ENSMODP00000038186  FD......G....Y..VF...V...D..H..K------------------............................
ENSMODP00000029243  IN......G....T..RL...D...D..R..IIRTDWDAGFREGRQYGRG............................
ENSMODP00000012172  MH......G....Q..CLspsD...S..K..PIKVFIAQARSSGSHRDVE............................
ENSMODP00000019849  IN......G....T..RL...D...D..R..IIRTDWDAGFKEGRQYGRG............................
ENSMODP00000000959  AN......G....M..EL...D...G..R..RIRVDYSITKRAHTPTPGI............................
ENSMODP00000003831  RN......G....Y..DY...G...Q..C..RLRVELPRNPGGGGPRGRTgppsr.......................
ENSMODP00000016570  AN......G....M..EL...D...G..R..RIRVDFSITKRPHTPTPGI............................
ENSMODP00000022371  LD......D....T..PM...R...G..R..QLRVRFAT-----------............................
ENSMODP00000034857  IN......G....T..HL...D...D..R..IIRTDWDAGFREGRQYGRG............................
ENSMODP00000034858  IN......G....T..HL...D...D..R..IIRTDWDAGFREGRQYGRG............................
ENSMODP00000005475  LD......N....M..PL...R...G..K..QLRVRFAC-----------............................
ENSMODP00000022505  MN......G....K..DI...N...G..K..MVCLGQAQKKVESQAE---............................
ENSMODP00000003848  FD......G....Y..VF...I...D..S..-------------------............................
ENSMODP00000004397  VD......G....Q..IF...Q...G..R..MLHLLPSTIKKETSESSDAvsssykkkkalkdkanstsshnwntlfm
ENSMODP00000001893  MD......G....A..VL...D...G..R..ELRVQMARYGRPPDSHHSR............................
ENSMODP00000017573  MN......G....K..LL...D...G..K..SIKVEQATKPTFESGGRRG............................
ENSMODP00000004247  LN......K....H..SL...S...G..R..PLKVKEDPDGEYDRRARQK............................
ENSMODP00000001568  LN......N....Y..EI...Rp..G..K..FIGVCVSL-----------............................
ENSMODP00000012202  AN......G....M..KL...D...G..R..RIRVDFSITKRPHTPTP--............................
ENSMODP00000031808  MD......G....E..YL...G...N..N..RLKLGFGKSM---------............................
ENSMODP00000006523  MN......G....K..SV...D...G..R..QIRVDQAGKSSENRSR---............................
ENSMODP00000019256  LD......N....H..EI...Rp..G..R..PLGVCCSV-----------............................
ENSMODP00000031416  LN......G....R..EF...S...G..R..ALRVDNAASE---------............................
ENSMODP00000022875  YN......N....H..EI...Rs..G..K..HIGVCISV-----------............................
ENSMODP00000025722  LD......N....H..EI...Rp..G..R..PLGVCCSV-----------............................
ENSMODP00000013678  IN......G....K..PL...P...G..A..TPAKRFKLNYATYGKQPDN............................
ENSMODP00000019066  AD......G....L..EV...D...G..R..RIRVDFSITKRPHTPTPGV............................
ENSMODP00000014920  MS......G....R..VV...G...R..N..PIKIGYGKAN---------............................
ENSMODP00000011039  MG......G....Q..WL...G...G..R..QIRTNWATRKPPAP-----............................
ENSMODP00000025181  LN......N....K..QL...F...G..R..VIKASIAIDNGRAA-----............................
ENSMODP00000006917  LL......G....K..PL...G...P..R..TLYVHWTDASQLTPALL--............................
ENSMODP00000028798  MG......G....Q..WL...G...G..R..QIRTNWATRKPPAP-----............................
ENSMODP00000031317  QS......R....H..EL...D...S..K..TIDPKVAFPRRAQPKMVT-............................
ENSMODP00000001566  LN......G....L..RL...Q...T..K..TIKVSYARPS---------............................
ENSMODP00000034177  LN......G....F..EL...A...G..R..PMRVGHVTER---------............................
ENSMODP00000015039  FN......G....I..KI...R...G..R..TIRVDHVANYRPPQ-----............................
ENSMODP00000023377  LN......G....Q..DM...M...G..Q..PISVDWCFVRGPPKGKRR-............................
ENSMODP00000004837  LN......G....L..RL...Q...T..K..TIKVSYARPS---------............................
ENSMODP00000021002  MD......N....V..LI...D...D..R..RIHVDFSQSVAKVKW----............................
ENSMODP00000027677  HN......I....V..DG...D...N..R..RISIVVN------------............................
ENSMODP00000022505  MN......F....D..VI...K...G..K..PIHIMWSQWDPSLRKSGVRnvfi........................
ENSMODP00000001487  LL......G....K..QL...G...S..F..ILFAQWMDVNQLATDLI--............................
ENSMODP00000038918  MH......F....H..DI...M...G..K..KVEVKRAEPRDSKSQVPG-............................
ENSMODP00000011435  MN......L....F..DL...G...G..Q..YLRVGKAVTPPMPLLTPATpgglppaaavaaaaatakitaqeavaga
ENSMODP00000011432  MN......L....F..DL...G...G..Q..YLRVGKAVTPPMPLLTPATpgglppaaavaaaaatakitaqeavaga
ENSMODP00000006345  MH......F....H..DI...M...G..K..KVEVKRAEPRDSKSQVPG-............................
ENSMODP00000024718  QK......Y....H..TI...N...G..H..NCEVKKALSKQEMQSAGSQ............................
ENSMODP00000009844  MQ......G....F..PF...Y...D..K..PMRIQYAKSDSDIIAKMKGtyverdrkrekrkpkgqetpavkkavpg
ENSMODP00000003000  ME......D....G..EI...D...G..N..KVTLDWAKPSGFGGRGGGR............................
ENSMODP00000014933  NR......Y....H..QI...G...S..G..KCEIKVAQPKEVYRQQQQQ............................
ENSMODP00000022015  MN......E....S..EL...F...G..R..TIRVNLAKPMK--------............................
ENSMODP00000015618  AN......G....L..VI...D...Q..H..EIFVDYELERILKGWIPRR............................
ENSMODP00000001920  MD......G....A..VL...D...G..R..ELRVQMARYGRPPDSH---............................
ENSMODP00000027267  MN......G....M..LL...N...D..R..KVFVGRFKSRKERE-----............................
ENSMODP00000026325  LH......K....T..EF...L...G..K..EMKLYFAQT----------............................
ENSMODP00000013647  DP......N....P..II...D...G..R..KANVNLAYLGAK-------............................
ENSMODP00000020553  DP......N....P..II...D...G..R..KANVNLAYL----------............................
ENSMODP00000003678  YN......G....V..PL...D...G..R..PMNIQLVTSQIDTQRRPAQ............................
ENSMODP00000029789  TR......P....H..KV...D...G..R..VVEPKRAVSREDSQRPGTH............................
ENSMODP00000000721  QK......Y....H..TI...N...G..H..NAEVRKALSRQEMQEVQSS............................
ENSMODP00000006200  LN......G....L..RL...Q...S..K..TIKVSYARPS---------............................
ENSMODP00000004743  LD......E....T..TF...R...G..R..IIKVLPKRTNFPGISTT--............................
ENSMODP00000014913  YH......N....V..GL...S...K..C..EIKVAMSKEQYQQQQQWGS............................
ENSMODP00000038918  SR......P....H..TL...D...G..R..NIDPKPCTPRGMQPERT--............................
ENSMODP00000006371  VS......G....F..GY...D...H..L..ILNVEWAKP----------............................
ENSMODP00000006345  SR......P....H..TL...D...G..R..NIDPKPCTPRGMQPERT--............................
ENSMODP00000015438  AE......K....L..NY...K...D..K..KLNIGPAIRKQQ-------............................
ENSMODP00000008450  NR......Y....H..QI...G...S..G..KCEIKVAQPKEVYRQQQQQ............................
ENSMODP00000010490  LN......N....S..EL...M...G..R..KLRVKRYV-----------............................
ENSMODP00000007208  LH......G....T..VV...E...G..R..KIEVNNATARVM-------............................
ENSMODP00000024712  FN......G....I..KI...R...G..R..TIRVDHVAN----------............................
ENSMODP00000017405  LN......G....I..KL...F...G..R..PIKIQFRSGSSH-------............................
ENSMODP00000001337  LH......G....T..VV...E...G..R..KIEVNNATARVM-------............................
ENSMODP00000028798  MN......G....R..KI...M...G..K..EVKVNWATTPS--------............................
ENSMODP00000002547  LN......G....T..IV...E...G..R..KIEVNNATA----------............................
ENSMODP00000005593  LD......D....S..LF...R...G..R..QIKVIPKRTNRPGIST---............................
ENSMODP00000018401  VK......F....H..PI...Q...G..H..RVEVKKAVPKEDIHPGGG-............................
ENSMODP00000014913  QK......E....H..KL...N...G..K..VIDPKRAKAM---------............................
ENSMODP00000016281  LD......R....K..WI...C...G..R..QIEIQFAQGDRKTPNQMKA............................
ENSMODP00000004397  LQ......G....C..MV...D...D..H..KLEVRISE-----------............................
ENSMODP00000000006  LQ......G....F..PF...Y...G..K..PMRIQYAKTDSDVISKMRGtfadkekkkekkkaksleqtanaankkp
ENSMODP00000020576  LN......N....Y..EI...R...N..G..RL-----------------............................
ENSMODP00000005194  KK......F....H..NV...G...G..S..KCEIKVAQPKEVYQQQHF-............................
ENSMODP00000002993  AS......P....H..EV...D...G..S..RVELKRAVSREDSCKPGAH............................
ENSMODP00000015362  SG......K....V..EL...Q...G..K..RLEIEHSVPKKQ-------............................
ENSMODP00000004717  LN......R....L..QC...P...P..K..TIKVSFARPS---------............................
ENSMODP00000018934  TN......M....K..EI...K...G..R..TVAVDWAVAKDKYN-----............................
ENSMODP00000027604  LN......R....L..QC...P...P..K..TIKVSFARPS---------............................
ENSMODP00000002993  IK......F....H..PI...Q...G..H..RVEVKKALPKE--------............................
ENSMODP00000000363  LH......G....S..QT...MpgaS..S..SLVVKFADTDKERTMRRMQqmagqmgmfnpmaiqfgaygayaqamqq
ENSMODP00000014933  LK......E....H..KL...D...G..K..LIDPKRAK-----------............................
ENSMODP00000016940  LD......G....R..TL...C...G..C..RVRVELSNGEKRSRNRGP-............................
ENSMODP00000007822  LD......G....Q..NI...Y...N..A..CCTLRIDFSKLT-------............................
ENSMODP00000002891  AR......P....H..KF...D...G..R..VIEPKRDISREDSQRPGTD............................
ENSMODP00000003337  MN......K....Y..DL...S...G..R..PLNIKEDPDGENARRAL--............................
ENSMODP00000005194  QK......E....H..RL...D...G..R..VIDPKKAMA----------............................
ENSMODP00000008450  LK......E....H..KL...D...G..K..LIDPKRAK-----------............................
ENSMODP00000017452  MN......G....K..YV...G...S..R..PIKLRKSMWK---------............................
ENSMODP00000010785  LD......G....K..VI...C...G..S..RVRVELSTGMPRRSRYD--............................
ENSMODP00000010799  FD......G....K..DF...Q...G..S..KLKVSLARKKPPMNSMRGG............................
ENSMODP00000004654  MN......G....I..KL...S...G..R..EIDVRI-------------............................
ENSMODP00000022797  LN......K....K..WV...C...G..R..QIEIQFAQGDRKTP-----............................
ENSMODP00000016382  LH......E....T..DF...D...G..K..KLKLYFAQVQMSNE-----............................
ENSMODP00000003786  LN......G....K..DL...C...G..E..RVIVEHARGPRRDRDGYSY............................
ENSMODP00000017322  YD......G....A..LL...G...D..R..SLRVDIAEGRKQDKGGFG-............................
ENSMODP00000020165  MN......G....K..EI...E...G..E..EIEIVLAKPPDKKRKER--............................
ENSMODP00000010787  LD......G....K..VI...C...G..S..RVRVELSTGLPRRSRY---............................
ENSMODP00000001412  LH......R....T..EL...H...G..R..MISVEKAKNE---------............................
ENSMODP00000015013  FN......G....I..KI...R...E..R..TIRVDHV------------............................
ENSMODP00000003000  KQ......G....T..EI...D...G..R..ALILDYTGEKSQGQENS--............................
ENSMODP00000011795  KD......K....A..NM...Q...H..R..YVEL---------------............................
ENSMODP00000022875  MN......G....K..DL...E...G..E..NIEIVFAKPPDQKRKE---............................
ENSMODP00000028798  VN......G....T..TI...E...G..H..VVKCYWGKETLDMLN----............................
ENSMODP00000003337  FN......G....Q..FL...F...D..R..PMHVKMDDKS---------............................
ENSMODP00000018401  AS......P....H..AV...D...G..N..TVELKRAVSREDSAR----............................
ENSMODP00000019828  MD......G....G..QI...D...G..Q..EITATAVLAPWPRPPPRRF............................
ENSMODP00000011039  VN......G....T..TI...E...G..H..VVKCYWGKES---------............................
ENSMODP00000010024  LD......N....T..EF...Q...G..K..RMHVQLSTSRLRTAPGMG-............................
ENSMODP00000023575  LH......E....T..QF...R...G..K..KLKLYFAQVQTP-------............................
ENSMODP00000001566  LN......G....Q..KP...S...GatE..PITVKFANNPS--------............................
ENSMODP00000031345  MD......G....M..TI...K...Q..N..VIKVAISNPPQRKLPD---............................
ENSMODP00000011039  MN......G....R..KI...L...G..K..EVKVNWATTP---------............................
ENSMODP00000017614  LN......G....R..WF...G...G..R..QLHVEV-------------............................
ENSMODP00000011435  MN......S....V..ML...G...G..R..NIKVGR-------------............................
ENSMODP00000011432  MN......S....V..ML...G...G..R..NIKVGR-------------............................
ENSMODP00000035735  LN......N....Y..EI...Rp..G..R..L------------------............................
ENSMODP00000001944  LH......R....K..KL...N...G..R..EALLHVITLEDMREIEKNPpsqvkkglkiplpgnatvpgmpnaggde
ENSMODP00000036858  YN......N....H..EI...Rs..G..K..HIGVC--------------............................
ENSMODP00000005193  LD......G....Q..NI...Y...N..A..CCTLRIDFSKL--------............................
ENSMODP00000028751  FD......G....K..DF...Q...G..S..KLKVSLARGGMPPREGR--............................
ENSMODP00000039173  KD......K....A..NM...Q...H..R..YVKLF--------------............................
ENSMODP00000006815  LD......G....Q..NI...Y...N..A..CCTLRIDFSKLT-------............................
ENSMODP00000020576  LN......G....K..VL...D...G..S..PIEVTLAKPVDKDSYVR--............................
ENSMODP00000025722  LN......G....T..EL...E...G..S..CLGVTLAKPVD--------............................
ENSMODP00000002300  FD......G....K..EF...S...G..N..PIKVSFATRRADFNRGGG-............................
ENSMODP00000003786  LD......G....T..EI...N...G..R..NIRLIEDKPRTSHRRSY--............................
ENSMODP00000023826  KH......K....E..EI...G...N..R..YIEIFPSRRNEVRTHVGSHkgkkvapsllkggpepgpsldehdrsee
ENSMODP00000033056  LN......G....K..EV...K...G..K..RINVELSIKGQ--------............................
ENSMODP00000009807  LN......G....K..EV...K...G..K..RINVELSIKGQ--------............................
ENSMODP00000018415  -S......Q....I..NF...H...G..K..KLKLGPAIRKQ--------............................
ENSMODP00000000175  MN......N....Y..LF...C...E..R..LLKCHFVPPE---------............................
ENSMODP00000039175  -S......Q....I..NF...H...G..K..KLKLGPAIRKQ--------............................
ENSMODP00000036858  MN......G....K..DL...E...G..E..NIEIVFAKPPD--------............................
ENSMODP00000008249  LN......G....P..KL...Q...P..K..PFKVSYARPS---------............................
ENSMODP00000032411  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000001944  RH......K....Q..YM...G...N..R..FIQVHPITKKGMLE-----............................
ENSMODP00000009227  LN......R....R..RF...L...G..T..EVLLRLISEEQMQEFGVNIssipsekmqdhsqtrdrdehshsvdpqg
ENSMODP00000007480  AC......I....E..ED...G...K..L..YLCVSSPTIKDKPVQIRPWnlsdsdfvmdgsqpl.............
ENSMODP00000011795  KH......K....E..RI...G...H..R..YIEIFKSSRAEVR------............................
ENSMODP00000002604  LS......G....F..NV...C...N..R..Y------------------............................
ENSMODP00000021564  KD......K....N..NM...Q...H..R..YIELF--------------............................
ENSMODP00000036078  AC......L....E..ED...G...K..L..YLCVSSPTIKDKPVQIRPWnlsdsdfvmdgsqpl.............
ENSMODP00000010024  LH......H....Y..KL...H...G..V..NINVEASKNK---------............................
ENSMODP00000013583  LH......G....K..MI...M...S..F..EMKLGWGK-----------............................
ENSMODP00000013581  LH......G....K..MI...M...S..F..EMKLGWGK-----------............................
ENSMODP00000001370  AC......I....E..ED...G...K..L..YLCVSSPTIKDKPVQIRPWnlsdsdfvmdgsqpl.............
ENSMODP00000010502  MN......N....Y..LF...C...E..R..LLKCNFVPP----------............................
ENSMODP00000018934  ASaetedgG....L..KL...D...G..R..KLKVDLAVTR---------............................
ENSMODP00000031808  VN......K....-..-M...G...D..R..DLRTDYNEPGTIPSAARGLddtvsiasrsrevsgfrgggggptygpp
ENSMODP00000013458  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000004397  CH......S....T..HL...Y...G..R..RLVLEWADT----------............................
ENSMODP00000002817  VN......G....Y..NL...L...G..K..TLVIEFGKNK---------............................
ENSMODP00000024842  LH......N....M..KIlpgM...H..H..PIQMKPA------------............................
ENSMODP00000021564  KH......K....E..RI...G...H..R..YIEIFKSSRSEIK------............................
ENSMODP00000035400  LN......G....K..MI...M...S..F..EMKLGWGK-----------............................
ENSMODP00000003000  CN......N....I..EI...E...G..R..AIRLEL-------------............................
ENSMODP00000007934  FN......K....L..IL...N...G..R..RLNVKWGRSQAA-------............................
ENSMODP00000001484  LH......K....T..EL...H...G..K..MISVEKTKNEPA-------............................
ENSMODP00000008195  ED......G....R..MI...A...G..Q..VLDINLAAEPK--------............................
ENSMODP00000001568  MN......G....K..CI...D...G..A..SIEVTLAKPVNKESTW---............................
ENSMODP00000010946  LH......R....T..EL...H...G..Q..QISVEKVKGDPS-------............................
ENSMODP00000003430  EN......G....R..VL...A...G..Q..TLDINMAGEPKP-------............................
ENSMODP00000007024  LN......N....-..--...-...-..-..-------------------............................
ENSMODP00000011964  FN......K....L..IV...N...G..R..RLNVKWGRSQAA-------............................
ENSMODP00000024532  FN......G....V..MF...G...D..R..PLKINHSN-----------............................
ENSMODP00000004397  FH......R....S..FI...D...T..A..RVTVEFCKSFGDPSKPR--............................
ENSMODP00000032411  FN......G....K..YL...K...T..-..-------------------............................
ENSMODP00000010717  DE......P....V..YI...A...G..Q..QAFFNYSTSKRITRP----............................
ENSMODP00000008758  LN......G....A..CV...Q...G..S..RIKVQRPVQELTLDCDTIVstletdp.....................
ENSMODP00000021972  ED......G....R..MI...A...G..Q..VLDINLAAEPK--------............................
ENSMODP00000035735  LN......G....T..EL...E...G..S..CLEVTLAKPVDKE------............................
ENSMODP00000018834  LN......G....T..KV...E...S..V..QLKVSIARKQP--------............................
ENSMODP00000020165  CD......S....Y..EI...Rp..G..K..-------------------............................
ENSMODP00000031345  LD......R....K..MV...D...G..R..PMFVSPCVDKNKNP-----............................
ENSMODP00000023979  KP......I....M..FR...G...E..V..RLNVEEKKTRAARERET--............................
ENSMODP00000015407  QK......K....L..VI...Q...G..K..HIAMH--------------............................
ENSMODP00000014946  KK......A....L..WF...Q...G..R..YVKVDLSE-----------............................
ENSMODP00000003584  AN......G....Y..VL...F...G..K..PMVVQFARSARPKQ-----............................
ENSMODP00000007822  LN......G....Q..KL...H...G..K..PIRITLSKHQTVQL-----............................
ENSMODP00000002891  QK......Y....H..TV...N...G..H..NCEVRKALSKQEMASASS-............................
ENSMODP00000016781  DN......Q....I..YI...A...G..H..PAFVNYSTSQKISRP----............................
ENSMODP00000009227  RH......R....H..YM...G...S..R..FVEVSPASEQQW-------............................
ENSMODP00000018934  V-......-....T..TF...E...G..C..KINVTVAKRKLK-------............................
ENSMODP00000011795  KD......R....E..TM...G...H..R..YVEVFKSNNV---------............................
ENSMODP00000029701  AD......G....K..EM...M...P..S..GVLVDVERGRTRGWRPRR-............................
ENSMODP00000011218  RP......I....M..FR...G...E..V..RLNVEEKKTRAAREGDRR-............................
ENSMODP00000007822  YT......T....VtpVL...R...S..Q..PIYIQFSNHKEL-------............................
ENSMODP00000001901  LT......G....Q..RV...L...G..V..PIIVQ--------------............................
ENSMODP00000005193  YS......A....V..TPhl.R...N..Q..PIYIQYSNHK---------............................
ENSMODP00000013253  KD......G....R..IF...Ge..S..I..MIGVKPC------------............................
ENSMODP00000001062  Q-......H....H..MI...Y...G..Q..WYDYKLPNSKQSPNEP---............................
ENSMODP00000006815  LS......G....Q..RL...Y...G..K..VLRATLSKHQLVQLPREGQedqgltkdfsnsplhrfkkpgsknfqni
ENSMODP00000012172  LH......G....F..QY...Pp..G..N..RIGVSFLDDGSNGTDLLRKmatqmvaaqlasmvwnnpgqqqflaslq
ENSMODP00000005193  LN......G....Q..KM...Y...G..K..IIRVTLSKHQTV-------............................
ENSMODP00000000232  LD......D....D..EI...R...G..Y..KLHVEMAKF----------............................
ENSMODP00000034177  LT......G....Q..RL...L...G..V..PIIVQASQAEK--------............................
ENSMODP00000006415  QE......N....H..FI...D...G..V..KVR----------------............................
ENSMODP00000035735  MP......Gr...I..QL...W...G..H..QIAVDWAEPE---------............................
ENSMODP00000023866  FD......G....K..EF...H...G..N..IIKVSFATRRPEFLRGGGS............................
ENSMODP00000026309  RG......N....Y..KV...N...Q..K..SIKIAWA------------............................
ENSMODP00000041019  EN......A....R..II...A...G..Q..PL-----------------............................
ENSMODP00000001219  SG......K....V..EV...H...G..K..LIEVEHSVPKRQRSRKIQIrnipphlqweltvdl.............
ENSMODP00000006815  YT......P....V..T-...-...-..-..-------------------............................
ENSMODP00000010225  TP......G....Q..KY...K...D..T..ELLILFKED----------............................
ENSMODP00000017514  LN......N....R..WF...N...G..Q..AVQAE--------------............................
ENSMODP00000039002  LN......N....R..WF...N...G..Q..PIHAELS------------............................
ENSMODP00000009010  RH......K....H..HM...G...N..R..YIEVYKATGEDFLKIAGGTsnevaqflsk..................
ENSMODP00000020576  PG......R....I..QL...W...G..H..PIAVDWAEPE---------............................
ENSMODP00000036858  MS......G....Kv.KV...W...G..N..VGTVEWADPIE--------............................
ENSMODP00000029254  SG......S....Y..KI...G...S..K..VIKIAWA------------............................
ENSMODP00000017614  LD......D....D..VI...R...G..Y..KLHVEKAKF----------............................
ENSMODP00000018402  LN......G....K..EM...-...-..-..-------------------............................
ENSMODP00000016781  LN......N....N..FM...F...G..Q..KLNVCV-------------............................
ENSMODP00000013040  EK......S....A..VI...N...G..E..KLLIRMSKR----------............................
ENSMODP00000002441  QD......P....L..SP...D...G..L..SEYYFKMSSRRMRCKEVQVipwvladsnfvrspsqrl..........
ENSMODP00000009010  CH......K....K..TM...K...D..R..YVEVFQCSA----------............................
ENSMODP00000023826  KH......H....L..YM...G...Q..R..YVEVYEI------------............................
ENSMODP00000004397  RN......K....D..YM...G...G..R..YIEVFRE------------............................
ENSMODP00000008593  YN......N....R..CL...D...G..Q..PMKCNLHM-----------............................
ENSMODP00000014946  TT......P....A..LV...F...G..K..PVRVHLSQK----------............................
ENSMODP00000020165  MS......G....Kv.KV...W...G..N..VVTVEWADPVEE-------............................
ENSMODP00000019256  LN......G....T..EL...E...G..S..CLEVTLAKPVDKE------............................
ENSMODP00000001487  FH......Q....Y..SL...R...G..K..EITVQL-------------............................
ENSMODP00000023578  LH......E....Q..KTlpgM...N..R..PIQVKPADS----------............................
ENSMODP00000018618  LS......G....Y..RM...-...-..-..-------------------............................
ENSMODP00000001944  RN......R....M..LM...I...Q..R..YVEVSPATERQ--------............................
ENSMODP00000024562  LN......G....K..LA...L...S..K..KLVVRWAHAQVKR------............................
ENSMODP00000010717  LN......N....V..KL...F...G..K..RLNVCVSKQH---------............................
ENSMODP00000033971  LN......G....Q..MF...H...N..R..KLYL---------------............................
ENSMODP00000010437  LH......D....L..QI...G...E..K..KLLVKV-------------............................
ENSMODP00000017391  RP......I....M..FR...G...E..V..HLNVEEKKTRAAREGDR--............................
ENSMODP00000016781  LN......G....A..DI...Ysg.C..C..TLKIEYAKPTRLN------............................
ENSMODP00000031445  LH......N....T..SV...M...G..N..IIHVELDTKGETRMR----............................
ENSMODP00000017592  VN......N....V..VV...D...G..R..TLK----------------............................
ENSMODP00000003000  LS......G....S..KV...L...G..S..EMKLEKAKENKK-------............................
ENSMODP00000021460  FN......G....R..WY...A...G..R..QLQCEFS------------............................
ENSMODP00000030260  RP......I....M..FR...G...E..A..RLNVEEKKTRALREGDR--............................
ENSMODP00000010225  AN......E....A..NS...G...N..L..KLR----------------............................
ENSMODP00000005193  LH......N....Y..NL...Ge..N..H..HLRVSFSK-----------............................
ENSMODP00000006917  FH......Q....S..HL...R...D..K..ELSVQL-------------............................
ENSMODP00000023718  LN......G....I..RF...DpeiP..Q..TLRLEFAKANTKMA-----............................
ENSMODP00000006381  CH......K....K..MM...K...E..R..YVEVFPCSG----------............................
ENSMODP00000013139  LN......G....I..RF...DpenP..Q..TLRLEFAKANTKMA-----............................
ENSMODP00000011106  MN......G....K..EI...N...G..K..SVNVRLVKTPAENVPPLSW............................
ENSMODP00000011084  LN......N....K..QL...F...G..R..VIKASIAIDNGRAA-----............................
ENSMODP00000033409  LP......G....K..IL...N...G..E..KVDVRLATRQNLSQ-----............................
ENSMODP00000007822  LH......N....H..DL...Ge..N..H..HLRVSFSK-----------............................
ENSMODP00000000011  KD......K....A..NM...Q...H..R..YEE----------------............................
ENSMODP00000019244  LS......G....Y..RI...R...-..-..-------------------............................
ENSMODP00000013327  QH......S....L..SI...L...G..Q..KV-----------------............................
ENSMODP00000009227  LH......K....F..IL...F...H..R..QVLIDPISKKTM-------............................
ENSMODP00000020775  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000008836  LP......K....R..EL...H...G..Q..NPVVTPCNKQFLS------............................
ENSMODP00000018496  IH......F....H..EI...N...N..K..MVECKKAQPKEVMFP----............................
ENSMODP00000012937  LH......G....A..LW...K...G..R..CLSIRLAKPKADPMAK---............................
ENSMODP00000024766  MN......G....K..DI...N...G..K..R------------------............................
ENSMODP00000006381  RH......K....H..HM...G...A..R..YIEVYKASGE---------............................
ENSMODP00000010717  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000009664  VD......G....M..KV...K...G..R..AVKIRP-------------............................
ENSMODP00000010490  RN......G....A..QIa..E...G..F..PVRVE--------------............................
ENSMODP00000024054  VN......E....A..NS...G...N..L..KLR----------------............................
ENSMODP00000002114  LH......H....T..PV...M...G..N..IIH----------------............................
ENSMODP00000028156  TT......P....V..QV...K...G..K..RVKISTAGK----------............................
ENSMODP00000003584  LH......Q....L..KV...L...G..H..TLVVEFAKEQD--------............................
ENSMODP00000036903  QK......Y....H..TV...N...G..H..NCEVRKALSKQEMASASSS............................
ENSMODP00000003337  MN......G....I..KI...S...G..R..EIDVRL-------------............................
ENSMODP00000014333  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000008714  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000013327  LQalhp..P....L..TI...D...G..K..TINVEFAKGSKR-------............................
ENSMODP00000006050  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000013604  FN......K....L..VV...K...G..R..KLPVKWARSQ---------............................
ENSMODP00000000664  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000012747  ST......E....A..VL...N...N..R..FIRVLWHRE----------............................
ENSMODP00000026351  LN......G....K..EF...L...D..R..LISITLK------------............................
ENSMODP00000018934  NN......N....P..DI...F...G..-..-------------------............................
ENSMODP00000015407  LQslhp..P....L..KI...D...G..K..TIGVDFAKSAR--------............................
ENSMODP00000009575  QA......Q....H..VL...S...G..H..RLRIRPREQKEFQ------............................
ENSMODP00000005447  LH......R....Y..KI...G...S..K..RIQVSLATG----------............................
ENSMODP00000005596  LK......G....L..SF...G...G..N..SLWVKLAKKQ---------............................
ENSMODP00000007024  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000024054  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000001919  ST......E....A..VF...N...N..R..FIKVYWHR-----------............................
ENSMODP00000011172  LH......M....C..VL...G...N..T..TILAEFATD----------............................
ENSMODP00000006381  KH......K....G..IL...G...K..R..YIELS--------------............................
ENSMODP00000009227  RS......G....G..FI...K...D..S..PVELFLSSKTEM-------............................
ENSMODP00000001242  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000024718  AR......P....H..KV...D...G..R..VVEPKRAVSREDSV-----............................
ENSMODP00000026104  LN......K....T..AW...K...G..G..TLQVQLAKES---------............................
ENSMODP00000032086  LH......M....C..VL...G...N..T..TILAEFA------------............................
ENSMODP00000012383  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000012220  AD......G....Y..KL...D...K..Q..-------------------............................
ENSMODP00000020434  LH......M....C..VL...G...N..T..TILAEFASE----------............................
ENSMODP00000000721  AR......P....H..SI...D...G..R..VVEPKRAVAREESGK----............................
ENSMODP00000000674  LT......N....T..VF...V...D..R..ALIVVP-------------............................
ENSMODP00000024766  MN......-....-..--...-...-..-..-------------------............................
ENSMODP00000024532  LT......N....T..VF...I...D..R..ALIVVPC------------............................
ENSMODP00000014848  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000008714  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000013897  DQ......K....Q..LF...Q...N..S..PVKVR--------------............................
ENSMODP00000008570  LQ......-....-..--...-...-..-..-------------------............................
ENSMODP00000015423  QG......T....L..KI...C...D..K..EV-----------------............................
ENSMODP00000012747  -Q......G....S..KF...K...D..R..RLQISWHKPK---------............................
ENSMODP00000001919  IH......G....S..RF...K...G..Q..DLKL---------------............................
ENSMODP00000001944  RT......G....G..TI...K...G..S..KVTLLLSSKTEM-------............................
ENSMODP00000006156  FH......R....H..MI...D...L..S..HIN----------------............................
ENSMODP00000004377  K-......K....-..--...-...-..-..-------------------............................
ENSMODP00000003434  LS......G....H..QF...E...N..Y..SFRISYIPDEDGHAPQRF-............................
ENSMODP00000021792  YN......G....C..SF...N...Q..K..NNEV---------------............................
ENSMODP00000000011  RD......R....E..TM...G...H..R..YVEVLKSNNI---------............................
ENSMODP00000007341  CN......E....R..KK...A...E..K..SLNYYTNLQTKTGERTLIN............................
ENSMODP00000010183  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000028156  CF......P....M..SM...D...G..N..QLSINMA------------............................
ENSMODP00000015423  LQ......NldppF..SI...D...G..K..MVAVNLATGKRRN------............................
ENSMODP00000013069  LH......N....T..PM...-...-..-..-------------------............................
ENSMODP00000038791  LR......G....M..KL...M...-..-..-------------------............................
ENSMODP00000000011  KP......K....K..RI...G...H..S..DIEIFKSSW----------............................
ENSMODP00000002674  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000039642  FP......H....D..GI...L...N..R..-------------------............................
ENSMODP00000036724  LH......E....Q..KTlpgM...N..R..PIQVKPADSE---------............................
ENSMODP00000023634  IN......P....K..PC...G...H..L..CCCVVRGCEEVEAIQ----............................
ENSMODP00000000087  LR......G....M..KL...M...-..-..-------------------............................
ENSMODP00000007362  EE......L....K..IF...Q...G..K..PIK----------------............................
ENSMODP00000011262  M-......-....-..--...-...-..-..-------------------............................
ENSMODP00000001586  L-......-....-..--...-...-..-..-------------------............................
ENSMODP00000013441  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000022828  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000013444  --......-....-..--...-...-..-..-------------------............................
ENSMODP00000002674  --......-....-..--...-...-..-..-------------------............................


                                                                                                    
                                                                                                    
d1u1qa_               ..............................................................................
ENSMODP00000007717  ..............................................................................
ENSMODP00000022014  ..............................................................................
ENSMODP00000029058  ..............................................................................
ENSMODP00000027267  ..............................................................................
ENSMODP00000023398  ..............................................................................
ENSMODP00000037814  ..............................................................................
ENSMODP00000021348  ..............................................................................
ENSMODP00000027586  ..............................................................................
ENSMODP00000022014  ..............................................................................
ENSMODP00000029058  ..............................................................................
ENSMODP00000021348  ..............................................................................
ENSMODP00000027586  ..............................................................................
ENSMODP00000037814  ..............................................................................
ENSMODP00000004837  nmaygvksrfspmtidgmtslaginipgha................................................
ENSMODP00000020923  lallqqatsssnlgafsgiqqmagmnalqlqnlatlaaaaaaaqtsatttnanplsttssalgaltspvaastpnsta
ENSMODP00000007717  ..............................................................................
ENSMODP00000024842  ylalylqllqqtassgnlntlgslhpmgglnamqlqnlaalaaaasaaqntpsgtnalttsssplsvltssgsspsss
ENSMODP00000006200  vdhmtglsgvnvpgna..............................................................
ENSMODP00000036724  qqaalmaaqgtclnpmaaiaaaqmqqmaafnvsglvatpvtpssgtstppgistgtvpsiaapigvngfspltphtng
ENSMODP00000004717  apnmagitypght.................................................................
ENSMODP00000008249  nmaygvkrfspitidgmsslagvslsggas................................................
ENSMODP00000027604  apnmagitypght.................................................................
ENSMODP00000023901  qqqttvlstshgsylspgvafspchiqqigavslngipatpiapasglhsppllgtaavpglvtpitngfagvvpfpg
ENSMODP00000023578  qqaalvaahsaylnpmatmaavqmqhmaainangliatpitpssgtstppaiaatpvsaipaalgvngyspvptqpag
ENSMODP00000007804  ..............................................................................
ENSMODP00000034649  ..............................................................................
ENSMODP00000018486  ..............................................................................
ENSMODP00000006475  ..............................................................................
ENSMODP00000014208  ..............................................................................
ENSMODP00000040531  ..............................................................................
ENSMODP00000010059  ..............................................................................
ENSMODP00000013841  ..............................................................................
ENSMODP00000014054  ..............................................................................
ENSMODP00000009994  ..............................................................................
ENSMODP00000004654  nipneiihalqag.................................................................
ENSMODP00000001901  tglqippaaqqalqmsgslafgavaakiffpffidlqtrlsqqsevtalaaaasvqplatqcfqls............
ENSMODP00000038186  ..............................................................................
ENSMODP00000029243  ..............................................................................
ENSMODP00000012172  ..............................................................................
ENSMODP00000019849  ..............................................................................
ENSMODP00000000959  ..............................................................................
ENSMODP00000003831  ..............................................................................
ENSMODP00000016570  ..............................................................................
ENSMODP00000022371  ..............................................................................
ENSMODP00000034857  ..............................................................................
ENSMODP00000034858  ..............................................................................
ENSMODP00000005475  ..............................................................................
ENSMODP00000022505  ..............................................................................
ENSMODP00000003848  ..............................................................................
ENSMODP00000004397  gtnavadavaqkynatksqvfdhetkgsvavrvalgetelvqevrhflikngvsldsfsqaage..............
ENSMODP00000001893  ..............................................................................
ENSMODP00000017573  ..............................................................................
ENSMODP00000004247  ..............................................................................
ENSMODP00000001568  ..............................................................................
ENSMODP00000012202  ..............................................................................
ENSMODP00000031808  ..............................................................................
ENSMODP00000006523  ..............................................................................
ENSMODP00000019256  ..............................................................................
ENSMODP00000031416  ..............................................................................
ENSMODP00000022875  ..............................................................................
ENSMODP00000025722  ..............................................................................
ENSMODP00000013678  ..............................................................................
ENSMODP00000019066  ..............................................................................
ENSMODP00000014920  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000025181  ..............................................................................
ENSMODP00000006917  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000031317  ..............................................................................
ENSMODP00000001566  ..............................................................................
ENSMODP00000034177  ..............................................................................
ENSMODP00000015039  ..............................................................................
ENSMODP00000023377  ..............................................................................
ENSMODP00000004837  ..............................................................................
ENSMODP00000021002  ..............................................................................
ENSMODP00000027677  ..............................................................................
ENSMODP00000022505  ..............................................................................
ENSMODP00000001487  ..............................................................................
ENSMODP00000038918  ..............................................................................
ENSMODP00000011435  avlgtlatpglvspaltlaqplgalpqavmaaqapgvitgvtparppipvtipsvgvvnpilaspptlgllepkkeke
ENSMODP00000011432  avlgtlatpglvspaltlaqplgalpqavmaaqapgvitgvtparppipvtipsvgvvnpilaspptlgllepkkeke
ENSMODP00000006345  ..............................................................................
ENSMODP00000024718  ..............................................................................
ENSMODP00000009844  gaaapvvaavqpvpgmppmtqaprimhhlpgqppympppgmipppglapgqippgamppqqmmpgqmppaqplsen..
ENSMODP00000003000  ..............................................................................
ENSMODP00000014933  ..............................................................................
ENSMODP00000022015  ..............................................................................
ENSMODP00000015618  ..............................................................................
ENSMODP00000001920  ..............................................................................
ENSMODP00000027267  ..............................................................................
ENSMODP00000026325  ..............................................................................
ENSMODP00000013647  ..............................................................................
ENSMODP00000020553  ..............................................................................
ENSMODP00000003678  ..............................................................................
ENSMODP00000029789  ..............................................................................
ENSMODP00000000721  ..............................................................................
ENSMODP00000006200  ..............................................................................
ENSMODP00000004743  ..............................................................................
ENSMODP00000014913  ..............................................................................
ENSMODP00000038918  ..............................................................................
ENSMODP00000006371  ..............................................................................
ENSMODP00000006345  ..............................................................................
ENSMODP00000015438  ..............................................................................
ENSMODP00000008450  ..............................................................................
ENSMODP00000010490  ..............................................................................
ENSMODP00000007208  ..............................................................................
ENSMODP00000024712  ..............................................................................
ENSMODP00000017405  ..............................................................................
ENSMODP00000001337  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000002547  ..............................................................................
ENSMODP00000005593  ..............................................................................
ENSMODP00000018401  ..............................................................................
ENSMODP00000014913  ..............................................................................
ENSMODP00000016281  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000000006  gqatpnsantqgnstqnpqtsqsttsqsktsrlpppppqtllslrkpskfpplsshiyqslpgsvipsisivpdy...
ENSMODP00000020576  ..............................................................................
ENSMODP00000005194  ..............................................................................
ENSMODP00000002993  ..............................................................................
ENSMODP00000015362  ..............................................................................
ENSMODP00000004717  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000027604  ..............................................................................
ENSMODP00000002993  ..............................................................................
ENSMODP00000000363  qaaimasvaqggylnpmaafaaaqmqqmaalnmnglaaapmtptsggstppgitapavpsipspigvngftglppqan
ENSMODP00000014933  ..............................................................................
ENSMODP00000016940  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000002891  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000005194  ..............................................................................
ENSMODP00000008450  ..............................................................................
ENSMODP00000017452  ..............................................................................
ENSMODP00000010785  ..............................................................................
ENSMODP00000010799  ..............................................................................
ENSMODP00000004654  ..............................................................................
ENSMODP00000022797  ..............................................................................
ENSMODP00000016382  ..............................................................................
ENSMODP00000003786  ..............................................................................
ENSMODP00000017322  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000010787  ..............................................................................
ENSMODP00000001412  ..............................................................................
ENSMODP00000015013  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000022875  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000018401  ..............................................................................
ENSMODP00000019828  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000010024  ..............................................................................
ENSMODP00000023575  ..............................................................................
ENSMODP00000001566  ..............................................................................
ENSMODP00000031345  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000017614  ..............................................................................
ENSMODP00000011435  ..............................................................................
ENSMODP00000011432  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000001944  hafltvgskeanngppfnfpsnfsgsnafgpplpppglggafgdarpgipsvgnsglpglgidvqgfgsgpnnlsgps
ENSMODP00000036858  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000028751  ..............................................................................
ENSMODP00000039173  ..............................................................................
ENSMODP00000006815  ..............................................................................
ENSMODP00000020576  ..............................................................................
ENSMODP00000025722  ..............................................................................
ENSMODP00000002300  ..............................................................................
ENSMODP00000003786  ..............................................................................
ENSMODP00000023826  lrammtfesekegelhkeapeksaeaadfgtm..............................................
ENSMODP00000033056  ..............................................................................
ENSMODP00000009807  ..............................................................................
ENSMODP00000018415  ..............................................................................
ENSMODP00000000175  ..............................................................................
ENSMODP00000039175  ..............................................................................
ENSMODP00000036858  ..............................................................................
ENSMODP00000008249  ..............................................................................
ENSMODP00000032411  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000009227  psvhsfgppgkfrhppedfrqqpdnfrhppddfrhppdrhppddfrhppdrhppddfrhppdrhppddfrqpdnfrpp
ENSMODP00000007480  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000002604  ..............................................................................
ENSMODP00000021564  ..............................................................................
ENSMODP00000036078  ..............................................................................
ENSMODP00000010024  ..............................................................................
ENSMODP00000013583  ..............................................................................
ENSMODP00000013581  ..............................................................................
ENSMODP00000001370  ..............................................................................
ENSMODP00000010502  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000031808  pslharegryerrldgasdnrerayehsayghhergtggfdrtrhydqdyyrdprertlqhglyytssrsrspnrfda
ENSMODP00000013458  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000002817  ..............................................................................
ENSMODP00000024842  ..............................................................................
ENSMODP00000021564  ..............................................................................
ENSMODP00000035400  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000007934  ..............................................................................
ENSMODP00000001484  ..............................................................................
ENSMODP00000008195  ..............................................................................
ENSMODP00000001568  ..............................................................................
ENSMODP00000010946  ..............................................................................
ENSMODP00000003430  ..............................................................................
ENSMODP00000007024  ..............................................................................
ENSMODP00000011964  ..............................................................................
ENSMODP00000024532  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000032411  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000021972  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000018834  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000031345  ..............................................................................
ENSMODP00000023979  ..............................................................................
ENSMODP00000015407  ..............................................................................
ENSMODP00000014946  ..............................................................................
ENSMODP00000003584  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000002891  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000029701  ..............................................................................
ENSMODP00000011218  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000001901  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000013253  ..............................................................................
ENSMODP00000001062  ..............................................................................
ENSMODP00000006815  y.............................................................................
ENSMODP00000012172  fggssgsqlpqiqtdivlpsckkkappet.................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000000232  ..............................................................................
ENSMODP00000034177  ..............................................................................
ENSMODP00000006415  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000023866  ..............................................................................
ENSMODP00000026309  ..............................................................................
ENSMODP00000041019  ..............................................................................
ENSMODP00000001219  ..............................................................................
ENSMODP00000006815  ..............................................................................
ENSMODP00000010225  ..............................................................................
ENSMODP00000017514  ..............................................................................
ENSMODP00000039002  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000020576  ..............................................................................
ENSMODP00000036858  ..............................................................................
ENSMODP00000029254  ..............................................................................
ENSMODP00000017614  ..............................................................................
ENSMODP00000018402  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000013040  ..............................................................................
ENSMODP00000002441  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000023826  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000008593  ..............................................................................
ENSMODP00000014946  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000019256  ..............................................................................
ENSMODP00000001487  ..............................................................................
ENSMODP00000023578  ..............................................................................
ENSMODP00000018618  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000024562  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000033971  ..............................................................................
ENSMODP00000010437  ..............................................................................
ENSMODP00000017391  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000031445  ..............................................................................
ENSMODP00000017592  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000021460  ..............................................................................
ENSMODP00000030260  ..............................................................................
ENSMODP00000010225  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000006917  ..............................................................................
ENSMODP00000023718  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000013139  ..............................................................................
ENSMODP00000011106  ..............................................................................
ENSMODP00000011084  ..............................................................................
ENSMODP00000033409  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000019244  ..............................................................................
ENSMODP00000013327  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000020775  ..............................................................................
ENSMODP00000008836  ..............................................................................
ENSMODP00000018496  ..............................................................................
ENSMODP00000012937  ..............................................................................
ENSMODP00000024766  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000009664  ..............................................................................
ENSMODP00000010490  ..............................................................................
ENSMODP00000024054  ..............................................................................
ENSMODP00000002114  ..............................................................................
ENSMODP00000028156  ..............................................................................
ENSMODP00000003584  ..............................................................................
ENSMODP00000036903  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000014333  ..............................................................................
ENSMODP00000008714  ..............................................................................
ENSMODP00000013327  ..............................................................................
ENSMODP00000006050  ..............................................................................
ENSMODP00000013604  ..............................................................................
ENSMODP00000000664  ..............................................................................
ENSMODP00000012747  ..............................................................................
ENSMODP00000026351  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000015407  ..............................................................................
ENSMODP00000009575  ..............................................................................
ENSMODP00000005447  ..............................................................................
ENSMODP00000005596  ..............................................................................
ENSMODP00000007024  ..............................................................................
ENSMODP00000024054  ..............................................................................
ENSMODP00000001919  ..............................................................................
ENSMODP00000011172  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000001242  ..............................................................................
ENSMODP00000024718  ..............................................................................
ENSMODP00000026104  ..............................................................................
ENSMODP00000032086  ..............................................................................
ENSMODP00000012383  ..............................................................................
ENSMODP00000012220  ..............................................................................
ENSMODP00000020434  ..............................................................................
ENSMODP00000000721  ..............................................................................
ENSMODP00000000674  ..............................................................................
ENSMODP00000024766  ..............................................................................
ENSMODP00000024532  ..............................................................................
ENSMODP00000014848  ..............................................................................
ENSMODP00000008714  ..............................................................................
ENSMODP00000013897  ..............................................................................
ENSMODP00000008570  ..............................................................................
ENSMODP00000015423  ..............................................................................
ENSMODP00000012747  ..............................................................................
ENSMODP00000001919  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000006156  ..............................................................................
ENSMODP00000004377  ..............................................................................
ENSMODP00000003434  ..............................................................................
ENSMODP00000021792  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000007341  ..............................................................................
ENSMODP00000010183  ..............................................................................
ENSMODP00000028156  ..............................................................................
ENSMODP00000015423  ..............................................................................
ENSMODP00000013069  ..............................................................................
ENSMODP00000038791  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000002674  ..............................................................................
ENSMODP00000039642  ..............................................................................
ENSMODP00000036724  ..............................................................................
ENSMODP00000023634  ..............................................................................
ENSMODP00000000087  ..............................................................................
ENSMODP00000007362  ..............................................................................
ENSMODP00000011262  ..............................................................................
ENSMODP00000001586  ..............................................................................
ENSMODP00000013441  ..............................................................................
ENSMODP00000022828  ..............................................................................
ENSMODP00000013444  ..............................................................................
ENSMODP00000002674  ..............................................................................


                                                                                                    
                                                                                                    
d1u1qa_               ..............................................................................
ENSMODP00000007717  ..............................................................................
ENSMODP00000022014  ..............................................................................
ENSMODP00000029058  ..............................................................................
ENSMODP00000027267  ..............................................................................
ENSMODP00000023398  ..............................................................................
ENSMODP00000037814  ..............................................................................
ENSMODP00000021348  ..............................................................................
ENSMODP00000027586  ..............................................................................
ENSMODP00000022014  ..............................................................................
ENSMODP00000029058  ..............................................................................
ENSMODP00000021348  ..............................................................................
ENSMODP00000027586  ..............................................................................
ENSMODP00000037814  ..............................................................................
ENSMODP00000004837  ..............................................................................
ENSMODP00000020923  gaamnsltslgtlqglagatvglnninalavaqmlsgmaalngglgatgltngtagtmdaltqaysgiqqyaaaalpt
ENSMODP00000007717  ..............................................................................
ENSMODP00000024842  ssnsvnpmaslgalqtlagataglnvgslagmaalngglgsgglsngtgstmealtqaysgiqqyaaaalptlynqnl
ENSMODP00000006200  ..............................................................................
ENSMODP00000036724  qptsdtlytngihpypaqspsvadplqqayagmqhyaaaypaayapvnsafppqppvlpqqqreg.............
ENSMODP00000004717  ..............................................................................
ENSMODP00000008249  ..............................................................................
ENSMODP00000027604  ..............................................................................
ENSMODP00000023901  ghpaletvyanglvpypamyptaaitpiahsvpqpppiiqqqqqreg...............................
ENSMODP00000023578  qpapdtlypngvhpypaqspaapvdplqqayagmqhytaaypaayslvtpafpqppalvaqqpppppqqqqqqqqrev
ENSMODP00000007804  ..............................................................................
ENSMODP00000034649  ..............................................................................
ENSMODP00000018486  ..............................................................................
ENSMODP00000006475  ..............................................................................
ENSMODP00000014208  ..............................................................................
ENSMODP00000040531  ..............................................................................
ENSMODP00000010059  ..............................................................................
ENSMODP00000013841  ..............................................................................
ENSMODP00000014054  ..............................................................................
ENSMODP00000009994  ..............................................................................
ENSMODP00000004654  ..............................................................................
ENSMODP00000001901  ..............................................................................
ENSMODP00000038186  ..............................................................................
ENSMODP00000029243  ..............................................................................
ENSMODP00000012172  ..............................................................................
ENSMODP00000019849  ..............................................................................
ENSMODP00000000959  ..............................................................................
ENSMODP00000003831  ..............................................................................
ENSMODP00000016570  ..............................................................................
ENSMODP00000022371  ..............................................................................
ENSMODP00000034857  ..............................................................................
ENSMODP00000034858  ..............................................................................
ENSMODP00000005475  ..............................................................................
ENSMODP00000022505  ..............................................................................
ENSMODP00000003848  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000001893  ..............................................................................
ENSMODP00000017573  ..............................................................................
ENSMODP00000004247  ..............................................................................
ENSMODP00000001568  ..............................................................................
ENSMODP00000012202  ..............................................................................
ENSMODP00000031808  ..............................................................................
ENSMODP00000006523  ..............................................................................
ENSMODP00000019256  ..............................................................................
ENSMODP00000031416  ..............................................................................
ENSMODP00000022875  ..............................................................................
ENSMODP00000025722  ..............................................................................
ENSMODP00000013678  ..............................................................................
ENSMODP00000019066  ..............................................................................
ENSMODP00000014920  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000025181  ..............................................................................
ENSMODP00000006917  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000031317  ..............................................................................
ENSMODP00000001566  ..............................................................................
ENSMODP00000034177  ..............................................................................
ENSMODP00000015039  ..............................................................................
ENSMODP00000023377  ..............................................................................
ENSMODP00000004837  ..............................................................................
ENSMODP00000021002  ..............................................................................
ENSMODP00000027677  ..............................................................................
ENSMODP00000022505  ..............................................................................
ENSMODP00000001487  ..............................................................................
ENSMODP00000038918  ..............................................................................
ENSMODP00000011435  eeelfpeserpemlseqehmsisgssarhmvmqkllrkqest....................................
ENSMODP00000011432  eeelfpeserpemlseqehmsisgssarhmvmqkllrnlqst....................................
ENSMODP00000006345  ..............................................................................
ENSMODP00000024718  ..............................................................................
ENSMODP00000009844  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000014933  ..............................................................................
ENSMODP00000022015  ..............................................................................
ENSMODP00000015618  ..............................................................................
ENSMODP00000001920  ..............................................................................
ENSMODP00000027267  ..............................................................................
ENSMODP00000026325  ..............................................................................
ENSMODP00000013647  ..............................................................................
ENSMODP00000020553  ..............................................................................
ENSMODP00000003678  ..............................................................................
ENSMODP00000029789  ..............................................................................
ENSMODP00000000721  ..............................................................................
ENSMODP00000006200  ..............................................................................
ENSMODP00000004743  ..............................................................................
ENSMODP00000014913  ..............................................................................
ENSMODP00000038918  ..............................................................................
ENSMODP00000006371  ..............................................................................
ENSMODP00000006345  ..............................................................................
ENSMODP00000015438  ..............................................................................
ENSMODP00000008450  ..............................................................................
ENSMODP00000010490  ..............................................................................
ENSMODP00000007208  ..............................................................................
ENSMODP00000024712  ..............................................................................
ENSMODP00000017405  ..............................................................................
ENSMODP00000001337  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000002547  ..............................................................................
ENSMODP00000005593  ..............................................................................
ENSMODP00000018401  ..............................................................................
ENSMODP00000014913  ..............................................................................
ENSMODP00000016281  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000000006  ..............................................................................
ENSMODP00000020576  ..............................................................................
ENSMODP00000005194  ..............................................................................
ENSMODP00000002993  ..............................................................................
ENSMODP00000015362  ..............................................................................
ENSMODP00000004717  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000027604  ..............................................................................
ENSMODP00000002993  ..............................................................................
ENSMODP00000000363  gqpaaeavfangihpypaqsptaadplqqayagvqqyagpaypaaygqisqafpqpppmipqqqreg...........
ENSMODP00000014933  ..............................................................................
ENSMODP00000016940  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000002891  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000005194  ..............................................................................
ENSMODP00000008450  ..............................................................................
ENSMODP00000017452  ..............................................................................
ENSMODP00000010785  ..............................................................................
ENSMODP00000010799  ..............................................................................
ENSMODP00000004654  ..............................................................................
ENSMODP00000022797  ..............................................................................
ENSMODP00000016382  ..............................................................................
ENSMODP00000003786  ..............................................................................
ENSMODP00000017322  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000010787  ..............................................................................
ENSMODP00000001412  ..............................................................................
ENSMODP00000015013  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000022875  ..............................................................................
ENSMODP00000028798  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000018401  ..............................................................................
ENSMODP00000019828  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000010024  ..............................................................................
ENSMODP00000023575  ..............................................................................
ENSMODP00000001566  ..............................................................................
ENSMODP00000031345  ..............................................................................
ENSMODP00000011039  ..............................................................................
ENSMODP00000017614  ..............................................................................
ENSMODP00000011435  ..............................................................................
ENSMODP00000011432  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000001944  afgaapqnfgngpgtlsgppsfgggppglgstaghlsgppsfgpgpgalhiggppgfgttsgk...............
ENSMODP00000036858  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000028751  ..............................................................................
ENSMODP00000039173  ..............................................................................
ENSMODP00000006815  ..............................................................................
ENSMODP00000020576  ..............................................................................
ENSMODP00000025722  ..............................................................................
ENSMODP00000002300  ..............................................................................
ENSMODP00000003786  ..............................................................................
ENSMODP00000023826  ..............................................................................
ENSMODP00000033056  ..............................................................................
ENSMODP00000009807  ..............................................................................
ENSMODP00000018415  ..............................................................................
ENSMODP00000000175  ..............................................................................
ENSMODP00000039175  ..............................................................................
ENSMODP00000036858  ..............................................................................
ENSMODP00000008249  ..............................................................................
ENSMODP00000032411  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000009227  pddfmcppddfrgprpfmnfgppegepfgrfdfgnnnmggfpegrfmpdpnfncgs......................
ENSMODP00000007480  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000002604  ..............................................................................
ENSMODP00000021564  ..............................................................................
ENSMODP00000036078  ..............................................................................
ENSMODP00000010024  ..............................................................................
ENSMODP00000013583  ..............................................................................
ENSMODP00000013581  ..............................................................................
ENSMODP00000001370  ..............................................................................
ENSMODP00000010502  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000031808  hdpryeprareqftlpsvvhrdiyrdeitrevrgrrpersyqhsrsrsphssqsrnqspqrlasqasrparspsgsgs
ENSMODP00000013458  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000002817  ..............................................................................
ENSMODP00000024842  ..............................................................................
ENSMODP00000021564  ..............................................................................
ENSMODP00000035400  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000007934  ..............................................................................
ENSMODP00000001484  ..............................................................................
ENSMODP00000008195  ..............................................................................
ENSMODP00000001568  ..............................................................................
ENSMODP00000010946  ..............................................................................
ENSMODP00000003430  ..............................................................................
ENSMODP00000007024  ..............................................................................
ENSMODP00000011964  ..............................................................................
ENSMODP00000024532  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000032411  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000008758  ..............................................................................
ENSMODP00000021972  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000018834  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000031345  ..............................................................................
ENSMODP00000023979  ..............................................................................
ENSMODP00000015407  ..............................................................................
ENSMODP00000014946  ..............................................................................
ENSMODP00000003584  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000002891  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000011795  ..............................................................................
ENSMODP00000029701  ..............................................................................
ENSMODP00000011218  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000001901  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000013253  ..............................................................................
ENSMODP00000001062  ..............................................................................
ENSMODP00000006815  ..............................................................................
ENSMODP00000012172  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000000232  ..............................................................................
ENSMODP00000034177  ..............................................................................
ENSMODP00000006415  ..............................................................................
ENSMODP00000035735  ..............................................................................
ENSMODP00000023866  ..............................................................................
ENSMODP00000026309  ..............................................................................
ENSMODP00000041019  ..............................................................................
ENSMODP00000001219  ..............................................................................
ENSMODP00000006815  ..............................................................................
ENSMODP00000010225  ..............................................................................
ENSMODP00000017514  ..............................................................................
ENSMODP00000039002  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000020576  ..............................................................................
ENSMODP00000036858  ..............................................................................
ENSMODP00000029254  ..............................................................................
ENSMODP00000017614  ..............................................................................
ENSMODP00000018402  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000013040  ..............................................................................
ENSMODP00000002441  ..............................................................................
ENSMODP00000009010  ..............................................................................
ENSMODP00000023826  ..............................................................................
ENSMODP00000004397  ..............................................................................
ENSMODP00000008593  ..............................................................................
ENSMODP00000014946  ..............................................................................
ENSMODP00000020165  ..............................................................................
ENSMODP00000019256  ..............................................................................
ENSMODP00000001487  ..............................................................................
ENSMODP00000023578  ..............................................................................
ENSMODP00000018618  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000024562  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000033971  ..............................................................................
ENSMODP00000010437  ..............................................................................
ENSMODP00000017391  ..............................................................................
ENSMODP00000016781  ..............................................................................
ENSMODP00000031445  ..............................................................................
ENSMODP00000017592  ..............................................................................
ENSMODP00000003000  ..............................................................................
ENSMODP00000021460  ..............................................................................
ENSMODP00000030260  ..............................................................................
ENSMODP00000010225  ..............................................................................
ENSMODP00000005193  ..............................................................................
ENSMODP00000006917  ..............................................................................
ENSMODP00000023718  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000013139  ..............................................................................
ENSMODP00000011106  ..............................................................................
ENSMODP00000011084  ..............................................................................
ENSMODP00000033409  ..............................................................................
ENSMODP00000007822  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000019244  ..............................................................................
ENSMODP00000013327  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000020775  ..............................................................................
ENSMODP00000008836  ..............................................................................
ENSMODP00000018496  ..............................................................................
ENSMODP00000012937  ..............................................................................
ENSMODP00000024766  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000010717  ..............................................................................
ENSMODP00000009664  ..............................................................................
ENSMODP00000010490  ..............................................................................
ENSMODP00000024054  ..............................................................................
ENSMODP00000002114  ..............................................................................
ENSMODP00000028156  ..............................................................................
ENSMODP00000003584  ..............................................................................
ENSMODP00000036903  ..............................................................................
ENSMODP00000003337  ..............................................................................
ENSMODP00000014333  ..............................................................................
ENSMODP00000008714  ..............................................................................
ENSMODP00000013327  ..............................................................................
ENSMODP00000006050  ..............................................................................
ENSMODP00000013604  ..............................................................................
ENSMODP00000000664  ..............................................................................
ENSMODP00000012747  ..............................................................................
ENSMODP00000026351  ..............................................................................
ENSMODP00000018934  ..............................................................................
ENSMODP00000015407  ..............................................................................
ENSMODP00000009575  ..............................................................................
ENSMODP00000005447  ..............................................................................
ENSMODP00000005596  ..............................................................................
ENSMODP00000007024  ..............................................................................
ENSMODP00000024054  ..............................................................................
ENSMODP00000001919  ..............................................................................
ENSMODP00000011172  ..............................................................................
ENSMODP00000006381  ..............................................................................
ENSMODP00000009227  ..............................................................................
ENSMODP00000001242  ..............................................................................
ENSMODP00000024718  ..............................................................................
ENSMODP00000026104  ..............................................................................
ENSMODP00000032086  ..............................................................................
ENSMODP00000012383  ..............................................................................
ENSMODP00000012220  ..............................................................................
ENSMODP00000020434  ..............................................................................
ENSMODP00000000721  ..............................................................................
ENSMODP00000000674  ..............................................................................
ENSMODP00000024766  ..............................................................................
ENSMODP00000024532  ..............................................................................
ENSMODP00000014848  ..............................................................................
ENSMODP00000008714  ..............................................................................
ENSMODP00000013897  ..............................................................................
ENSMODP00000008570  ..............................................................................
ENSMODP00000015423  ..............................................................................
ENSMODP00000012747  ..............................................................................
ENSMODP00000001919  ..............................................................................
ENSMODP00000001944  ..............................................................................
ENSMODP00000006156  ..............................................................................
ENSMODP00000004377  ..............................................................................
ENSMODP00000003434  ..............................................................................
ENSMODP00000021792  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000007341  ..............................................................................
ENSMODP00000010183  ..............................................................................
ENSMODP00000028156  ..............................................................................
ENSMODP00000015423  ..............................................................................
ENSMODP00000013069  ..............................................................................
ENSMODP00000038791  ..............................................................................
ENSMODP00000000011  ..............................................................................
ENSMODP00000002674  ..............................................................................
ENSMODP00000039642  ..............................................................................
ENSMODP00000036724  ..............................................................................
ENSMODP00000023634  ..............................................................................
ENSMODP00000000087  ..............................................................................
ENSMODP00000007362  ..............................................................................
ENSMODP00000011262  ..............................................................................
ENSMODP00000001586  ..............................................................................
ENSMODP00000013441  ..............................................................................
ENSMODP00000022828  ..............................................................................
ENSMODP00000013444  ..............................................................................
ENSMODP00000002674  ..............................................................................


                                                                                  100              1
                                                                                    |               
d1u1qa_               .........................................................LTVKKIFVGGIKED.T.....
ENSMODP00000007717  .........................................................YQGVNLYVKNLDDG.I.....
ENSMODP00000022014  .........................................................YQGVNLYIKNLDDT.I.....
ENSMODP00000029058  .........................................................YQGVNLYVKNLDDI.I.....
ENSMODP00000027267  .........................................................YQGVNLYVKNLDDG.I.....
ENSMODP00000023398  .........................................................-VGANIFIGNLDPE.I.....
ENSMODP00000037814  .........................................................YQGVNLYIKNLDDT.I.....
ENSMODP00000021348  .........................................................YQGVNLYVKNLDDG.I.....
ENSMODP00000027586  .........................................................YQGVNLYVKNLDDS.I.....
ENSMODP00000022014  .........................................................-GVGNVFIKNLDKS.I.....
ENSMODP00000029058  .........................................................-GIGNIFIKNLDDS.I.....
ENSMODP00000021348  .........................................................-GVGNIFIKNLDKS.I.....
ENSMODP00000027586  .........................................................-GVGNIFIKNLEKS.I.....
ENSMODP00000037814  .........................................................-GVGNVFVKNLEKS.I.....
ENSMODP00000004837  .........................................................GTGWCIFVYNLAPD.A.....
ENSMODP00000020923  ......................................lysqsllqqqsaagsqkegPEGANLFIYHLPQE.F.....
ENSMODP00000007717  .........................................................-GVGNIFIKNLDKS.I.....
ENSMODP00000024842  ..........................................ltqqsigaagsqkegPEGANLFIYHLPQE.F.....
ENSMODP00000006200  .........................................................SSGWCIFIYNLGQD.A.....
ENSMODP00000036724  .........................................................PEGCNLFIYHLPQE.F.....
ENSMODP00000004717  .........................................................SSGWCIFVYNLSPD.S.....
ENSMODP00000008249  .........................................................GAGWCIFVYNLSPE.A.....
ENSMODP00000027604  .........................................................SSGWCIFVYNLSPD.S.....
ENSMODP00000023901  .........................................................PEGCNLFIYHLPQE.F.....
ENSMODP00000023578  ..................................................plsdspgPDGCNIFIYHLPQE.F.....
ENSMODP00000007804  .........................................................LTVKKIFVGGIKED.T.....
ENSMODP00000034649  .........................................................LTMKKIFVGGIKED.A.....
ENSMODP00000018486  .........................................................RSEYRVVVSGLPPS.G.....
ENSMODP00000006475  .........................................................QDPTNLYISNLPLS.M.....
ENSMODP00000014208  .........................................................RTENRLIVENLSSR.V.....
ENSMODP00000040531  .........................................................RTEYRLIVENLSSR.C.....
ENSMODP00000010059  .........................................................--------------.-.....
ENSMODP00000013841  .........................................................RTEYRLIVENLSSR.C.....
ENSMODP00000014054  .........................................................-RSRKVFVGRCTED.M.....
ENSMODP00000009994  .........................................................-HGAALTVKNLSPV.V.....
ENSMODP00000004654  .........................................................RLGSTVFVANLDYK.V.....
ENSMODP00000001901  .........................................................NMFNPQTEDELGWD.T.....
ENSMODP00000038186  .........................................................--------------.-.....
ENSMODP00000029243  .........................................................--------------.-.....
ENSMODP00000012172  .........................................................DEELTRIFVMIPKS.Y.....
ENSMODP00000019849  .........................................................--------------.-.....
ENSMODP00000000959  .........................................................YMGRPTHSGG----.-.....
ENSMODP00000003831  .........................................................RSEFRVLVSGLPPS.G.....
ENSMODP00000016570  .........................................................YMGR----------.-.....
ENSMODP00000022371  .........................................................-HAAALSVRNLSPY.V.....
ENSMODP00000034857  .........................................................--------------.-.....
ENSMODP00000034858  .........................................................--------------.-.....
ENSMODP00000005475  .........................................................-HSASLTVRNLPQF.V.....
ENSMODP00000022505  .........................................................-LKWKFEVKNLDDT.I.....
ENSMODP00000003848  .........................................................--------------.-.....
ENSMODP00000004397  .........................................................RSRSVILVKNLPSG.T.....
ENSMODP00000001893  .........................................................RGPP----------.-.....
ENSMODP00000017573  .........................................................--------------.-.....
ENSMODP00000004247  .........................................................ARRLGSTVANLDYK.V.....
ENSMODP00000001568  .........................................................-DNCRLFIGAIPKE.K.....
ENSMODP00000012202  .........................................................--------------.-.....
ENSMODP00000031808  .........................................................-PTNCVWLDGLSTN.I.....
ENSMODP00000006523  .........................................................--------------.-.....
ENSMODP00000019256  .........................................................-DNCRLFIGGIPKM.K.....
ENSMODP00000031416  .........................................................--------------.-.....
ENSMODP00000022875  .........................................................-ANNRLFVGSIPKS.K.....
ENSMODP00000025722  .........................................................-DNCRLFIGGIPKM.K.....
ENSMODP00000013678  .........................................................SPEYSLFVRDLSPD.V.....
ENSMODP00000019066  .........................................................YMGR----------.-.....
ENSMODP00000014920  .........................................................-PTTRLWVGGLGPN.T.....
ENSMODP00000011039  .........................................................--------------.-.....
ENSMODP00000025181  .........................................................--------------.-.....
ENSMODP00000006917  .........................................................-HSRCLCVDHLPQG.Y.....
ENSMODP00000028798  .........................................................--------------.-.....
ENSMODP00000031317  .........................................................-RTKKIFVGGLSVN.T.....
ENSMODP00000001566  .........................................................--------------.-.....
ENSMODP00000034177  .........................................................--------------.-.....
ENSMODP00000015039  .........................................................--------------.-.....
ENSMODP00000023377  .........................................................--------------.-.....
ENSMODP00000004837  .........................................................--------------.-.....
ENSMODP00000021002  .........................................................--------------.-.....
ENSMODP00000027677  .........................................................--------------.-.....
ENSMODP00000022505  .........................................................KKPNNVFVKNLDKA.I.....
ENSMODP00000001487  .........................................................-HSKCLCVDKLPRD.L.....
ENSMODP00000038918  .........................................................--------------.-.....
ENSMODP00000011435  .........................................................VMVLRNMVDPKDIDdD.....
ENSMODP00000011432  .........................................................VMVLRNMVDPKDIDdD.....
ENSMODP00000006345  .........................................................--------------.-.....
ENSMODP00000024718  .........................................................--------------.-.....
ENSMODP00000009844  .........................................................PPNHILFLTNLPEE.T.....
ENSMODP00000003000  .........................................................GGGGRGGFGGRG--.-.....
ENSMODP00000014933  .........................................................--------------.-.....
ENSMODP00000022015  .........................................................--------------.-.....
ENSMODP00000015618  .........................................................--------------.-.....
ENSMODP00000001920  .........................................................--------------.-.....
ENSMODP00000027267  .........................................................--------------.-.....
ENSMODP00000026325  .........................................................--------------.-.....
ENSMODP00000013647  .........................................................--------------.-.....
ENSMODP00000020553  .........................................................--------------.-.....
ENSMODP00000003678  .........................................................SVNRGGMTRNRG--.-.....
ENSMODP00000029789  .........................................................LTVKKTFCRGHQ--.-.....
ENSMODP00000000721  .........................................................RSG-----------.-.....
ENSMODP00000006200  .........................................................--------------.-.....
ENSMODP00000004743  .........................................................--------------.-.....
ENSMODP00000014913  .........................................................RGGF----------.-.....
ENSMODP00000038918  .........................................................--------------.-.....
ENSMODP00000006371  .........................................................--------------.-.....
ENSMODP00000006345  .........................................................--------------.-.....
ENSMODP00000015438  .........................................................--------------.-.....
ENSMODP00000008450  .........................................................--------------.-.....
ENSMODP00000010490  .........................................................--------------.-.....
ENSMODP00000007208  .........................................................--------------.-.....
ENSMODP00000024712  .........................................................--------------.-.....
ENSMODP00000017405  .........................................................--------------.-.....
ENSMODP00000001337  .........................................................--------------.-.....
ENSMODP00000028798  .........................................................--------------.-.....
ENSMODP00000002547  .........................................................--------------.-.....
ENSMODP00000005593  .........................................................--------------.-.....
ENSMODP00000018401  .........................................................--------------.-.....
ENSMODP00000014913  .........................................................--------------.-.....
ENSMODP00000016281  .........................................................KEGRNVY-------.-.....
ENSMODP00000004397  .........................................................--------------.-.....
ENSMODP00000000006  .........................................................PPNYILFLNNLPEE.T.....
ENSMODP00000020576  .........................................................--------------.-.....
ENSMODP00000005194  .........................................................--------------.-.....
ENSMODP00000002993  .........................................................ARVKKIFVGG----.-.....
ENSMODP00000015362  .........................................................-RSRKIQIRNIPPQ.L.....
ENSMODP00000004717  .........................................................--------------.-.....
ENSMODP00000018934  .........................................................--------------.-.....
ENSMODP00000027604  .........................................................--------------.-.....
ENSMODP00000002993  .........................................................--------------.-.....
ENSMODP00000000363  .........................................................PEGCNLFIYHLPQE.F.....
ENSMODP00000014933  .........................................................--------------.-.....
ENSMODP00000016940  .........................................................--------------.-.....
ENSMODP00000007822  .........................................................--------------.-.....
ENSMODP00000002891  .........................................................LTVKKIFVGGIKED.T.....
ENSMODP00000003337  .........................................................--------------.-.....
ENSMODP00000005194  .........................................................--------------.-.....
ENSMODP00000008450  .........................................................--------------.-.....
ENSMODP00000017452  .........................................................--------------.-.....
ENSMODP00000010785  .........................................................--------------.-.....
ENSMODP00000010799  .........................................................MPP-----------.-.....
ENSMODP00000004654  .........................................................--------------.-.....
ENSMODP00000022797  .........................................................--------------.-.....
ENSMODP00000016382  .........................................................--------------.-.....
ENSMODP00000003786  .........................................................--------------.-.....
ENSMODP00000017322  .........................................................--------------.-.....
ENSMODP00000020165  .........................................................--------------.-.....
ENSMODP00000010787  .........................................................--------------.-.....
ENSMODP00000001412  .........................................................--------------.-.....
ENSMODP00000015013  .........................................................--------------.-.....
ENSMODP00000003000  .........................................................--------------.-.....
ENSMODP00000011795  .........................................................--------------.-.....
ENSMODP00000022875  .........................................................--------------.-.....
ENSMODP00000028798  .........................................................--------------.-.....
ENSMODP00000003337  .........................................................--------------.-.....
ENSMODP00000018401  .........................................................--------------.-.....
ENSMODP00000019828  .........................................................S-------------.-.....
ENSMODP00000011039  .........................................................--------------.-.....
ENSMODP00000010024  .........................................................--------------.-.....
ENSMODP00000023575  .........................................................--------------.-.....
ENSMODP00000001566  .........................................................--------------.-.....
ENSMODP00000031345  .........................................................--------------.-.....
ENSMODP00000011039  .........................................................--------------.-.....
ENSMODP00000017614  .........................................................--------------.-.....
ENSMODP00000011435  .........................................................--------------.-.....
ENSMODP00000011432  .........................................................--------------.-.....
ENSMODP00000035735  .........................................................--------------.-.....
ENSMODP00000001944  .........................................................PGPTVIKVQNMPFT.V.....
ENSMODP00000036858  .........................................................--------------.-.....
ENSMODP00000005193  .........................................................--------------.-.....
ENSMODP00000028751  .........................................................--------------.-.....
ENSMODP00000039173  .........................................................--------------.-.....
ENSMODP00000006815  .........................................................--------------.-.....
ENSMODP00000020576  .........................................................--------------.-.....
ENSMODP00000025722  .........................................................--------------.-.....
ENSMODP00000002300  .........................................................--------------.-.....
ENSMODP00000003786  .........................................................--------------.-.....
ENSMODP00000023826  .........................................................PSLHFVHMRGLPFQ.A.....
ENSMODP00000033056  .........................................................--------------.-.....
ENSMODP00000009807  .........................................................--------------.-.....
ENSMODP00000018415  .........................................................--------------.-.....
ENSMODP00000000175  .........................................................--------------.-.....
ENSMODP00000039175  .........................................................--------------.-.....
ENSMODP00000036858  .........................................................--------------.-.....
ENSMODP00000008249  .........................................................--------------.-.....
ENSMODP00000032411  .........................................................--------------.-.....
ENSMODP00000001944  .........................................................--------------.-.....
ENSMODP00000009227  .........................................................GRVTPIKIMNLPFK.A.....
ENSMODP00000007480  .........................................................DPRKTIFVGGVPRP.L.....
ENSMODP00000011795  .........................................................--------------.-.....
ENSMODP00000002604  .........................................................--------------.-.....
ENSMODP00000021564  .........................................................--------------.-.....
ENSMODP00000036078  .........................................................DPRKTIFVGGVPRP.L.....
ENSMODP00000010024  .........................................................--------------.-.....
ENSMODP00000013583  .........................................................--------------.-.....
ENSMODP00000013581  .........................................................--------------.-.....
ENSMODP00000001370  .........................................................DPRKTIFVGGVPRP.L.....
ENSMODP00000010502  .........................................................--------------.-.....
ENSMODP00000018934  .........................................................--------------.-.....
ENSMODP00000031808  ksrssssdslssssstssdssdssssssdesparsvqstavpaptsqlppslekeepRKSFGIKVQNLPVR.S.....
ENSMODP00000013458  .........................................................--------------.-.....
ENSMODP00000004397  .........................................................--------------.-.....
ENSMODP00000002817  .........................................................--------------.-.....
ENSMODP00000024842  .........................................................--------------.-.....
ENSMODP00000021564  .........................................................--------------.-.....
ENSMODP00000035400  .........................................................--------------.-.....
ENSMODP00000003000  .........................................................--------------.-.....
ENSMODP00000007934  .........................................................--------------.-.....
ENSMODP00000001484  .........................................................--------------.-.....
ENSMODP00000008195  .........................................................--------------.-.....
ENSMODP00000001568  .........................................................--------------.-.....
ENSMODP00000010946  .........................................................--------------.-.....
ENSMODP00000003430  .........................................................--------------.-.....
ENSMODP00000007024  .........................................................--------------.-.....
ENSMODP00000011964  .........................................................--------------.-.....
ENSMODP00000024532  .........................................................--------------.-.....
ENSMODP00000004397  .........................................................--------------.-.....
ENSMODP00000032411  .........................................................--------------.-.....
ENSMODP00000010717  .........................................................--------------.-.....
ENSMODP00000008758  .........................................................ENESTIYVNGMKES.Y.....
ENSMODP00000021972  .........................................................--------------.-.....
ENSMODP00000035735  .........................................................--------------.-.....
ENSMODP00000018834  .........................................................--------------.-.....
ENSMODP00000020165  .........................................................--------------.-.....
ENSMODP00000031345  .........................................................--------------.-.....
ENSMODP00000023979  .........................................................--------------.-.....
ENSMODP00000015407  .........................................................--------------.-.....
ENSMODP00000014946  .........................................................--------------.-.....
ENSMODP00000003584  .........................................................--------------.-.....
ENSMODP00000007822  .........................................................--------------.-.....
ENSMODP00000002891  .........................................................--------------.-.....
ENSMODP00000016781  .........................................................--------------.-.....
ENSMODP00000009227  .........................................................--------------.-.....
ENSMODP00000018934  .........................................................--------------.-.....
ENSMODP00000011795  .........................................................--------------.-.....
ENSMODP00000029701  .........................................................--------------.-.....
ENSMODP00000011218  .........................................................--------------.-.....
ENSMODP00000007822  .........................................................--------------.-.....
ENSMODP00000001901  .........................................................--------------.-.....
ENSMODP00000005193  .........................................................--------------.-.....
ENSMODP00000013253  .........................................................--------------.-.....
ENSMODP00000001062  .........................................................-LRSRKFVGHCTED.M.....
ENSMODP00000006815  .........................................................PPSATLHLSNIPPS.V.....
ENSMODP00000012172  .........................................................AVKERLFIVFNPHP.L.....
ENSMODP00000005193  .........................................................--------------.-.....
ENSMODP00000000232  .........................................................--------------.-.....
ENSMODP00000034177  .........................................................--------------.-.....
ENSMODP00000006415  .........................................................--------------.-.....
ENSMODP00000035735  .........................................................--------------.-.....
ENSMODP00000023866  .........................................................GGGRRGSRGGY---.-.....
ENSMODP00000026309  .........................................................--------------.-.....
ENSMODP00000041019  .........................................................--------------.-.....
ENSMODP00000001219  .........................................................Y------CGPLSLG.Tqvvfi
ENSMODP00000006815  .........................................................--------------.-.....
ENSMODP00000010225  .........................................................--------------.-.....
ENSMODP00000017514  .........................................................--------------.-.....
ENSMODP00000039002  .........................................................--------------.-.....
ENSMODP00000009010  .........................................................ENQVIVRMRGLPFT.A.....
ENSMODP00000020576  .........................................................--------------.-.....
ENSMODP00000036858  .........................................................--------------.-.....
ENSMODP00000029254  .........................................................--------------.-.....
ENSMODP00000017614  .........................................................--------------.-.....
ENSMODP00000018402  .........................................................--------------.-.....
ENSMODP00000016781  .........................................................--------------.-.....
ENSMODP00000013040  .........................................................--------------.-.....
ENSMODP00000002441  .........................................................DPSRTVFVGALHGM.L.....
ENSMODP00000009010  .........................................................--------------.-.....
ENSMODP00000023826  .........................................................--------------.-.....
ENSMODP00000004397  .........................................................--------------.-.....
ENSMODP00000008593  .........................................................--------------.-.....
ENSMODP00000014946  .........................................................--------------.-.....
ENSMODP00000020165  .........................................................--------------.-.....
ENSMODP00000019256  .........................................................--------------.-.....
ENSMODP00000001487  .........................................................--------------.-.....
ENSMODP00000023578  .........................................................--------------.-.....
ENSMODP00000018618  .........................................................--------------.-.....
ENSMODP00000001944  .........................................................--------------.-.....
ENSMODP00000024562  .........................................................--------------.-.....
ENSMODP00000010717  .........................................................--------------.-.....
ENSMODP00000033971  .........................................................--------------.-.....
ENSMODP00000010437  .........................................................--------------.-.....
ENSMODP00000017391  .........................................................--------------.-.....
ENSMODP00000016781  .........................................................--------------.-.....
ENSMODP00000031445  .........................................................--------------.-.....
ENSMODP00000017592  .........................................................--------------.-.....
ENSMODP00000003000  .........................................................--------------.-.....
ENSMODP00000021460  .........................................................--------------.-.....
ENSMODP00000030260  .........................................................--------------.-.....
ENSMODP00000010225  .........................................................--------------.-.....
ENSMODP00000005193  .........................................................--------------.-.....
ENSMODP00000006917  .........................................................--------------.-.....
ENSMODP00000023718  .........................................................--------------.-.....
ENSMODP00000006381  .........................................................--------------.-.....
ENSMODP00000013139  .........................................................--------------.-.....
ENSMODP00000011106  .........................................................--------------.-.....
ENSMODP00000011084  .........................................................--------------.-.....
ENSMODP00000033409  .........................................................--------------.-.....
ENSMODP00000007822  .........................................................--------------.-.....
ENSMODP00000000011  .........................................................--------------.-.....
ENSMODP00000019244  .........................................................--------------.-.....
ENSMODP00000013327  .........................................................--------------.-.....
ENSMODP00000009227  .........................................................--------------.-.....
ENSMODP00000020775  .........................................................--------------.-.....
ENSMODP00000008836  .........................................................--------------.-.....
ENSMODP00000018496  .........................................................-PGTRGRARGLPYT.M.....
ENSMODP00000012937  .........................................................--------------.-.....
ENSMODP00000024766  .........................................................--------------.-.....
ENSMODP00000006381  .........................................................--------------.-.....
ENSMODP00000010717  .........................................................------------YP.I.....
ENSMODP00000009664  .........................................................--------------.-.....
ENSMODP00000010490  .........................................................--------------.-.....
ENSMODP00000024054  .........................................................--------------.-.....
ENSMODP00000002114  .........................................................--------------.-.....
ENSMODP00000028156  .........................................................--------------.-.....
ENSMODP00000003584  .........................................................--------------.-.....
ENSMODP00000036903  .........................................................--------------.-.....
ENSMODP00000003337  .........................................................--------------.-.....
ENSMODP00000014333  .........................................................--------------.-.....
ENSMODP00000008714  .........................................................--------------.-.....
ENSMODP00000013327  .........................................................--------------.-.....
ENSMODP00000006050  .........................................................--------------.-.....
ENSMODP00000013604  .........................................................--------------.-.....
ENSMODP00000000664  .........................................................--------------.-.....
ENSMODP00000012747  .........................................................--------------.-.....
ENSMODP00000026351  .........................................................--------------.-.....
ENSMODP00000018934  .........................................................--------------.-.....
ENSMODP00000015407  .........................................................--------------.-.....
ENSMODP00000009575  .........................................................--------------.-.....
ENSMODP00000005447  .........................................................--------------.-.....
ENSMODP00000005596  .........................................................--------------.-.....
ENSMODP00000007024  .........................................................--------------.-.....
ENSMODP00000024054  .........................................................--------------.-.....
ENSMODP00000001919  .........................................................--------------.-.....
ENSMODP00000011172  .........................................................--------------.-.....
ENSMODP00000006381  .........................................................--------------.-.....
ENSMODP00000009227  .........................................................--------------.-.....
ENSMODP00000001242  .........................................................--------------.-.....
ENSMODP00000024718  .........................................................--------------.-.....
ENSMODP00000026104  .........................................................--------------.-.....
ENSMODP00000032086  .........................................................--------------.-.....
ENSMODP00000012383  .........................................................--------------.-.....
ENSMODP00000012220  .........................................................--------------.-.....
ENSMODP00000020434  .........................................................--------------.-.....
ENSMODP00000000721  .........................................................--------------.-.....
ENSMODP00000000674  .........................................................--------------.-.....
ENSMODP00000024766  .........................................................--------------.-.....
ENSMODP00000024532  .........................................................--------------.-.....
ENSMODP00000014848  .........................................................--------------.-.....
ENSMODP00000008714  .........................................................--------------.-.....
ENSMODP00000013897  .........................................................--------------.-.....
ENSMODP00000008570  .........................................................--------------.-.....
ENSMODP00000015423  .........................................................--------------.-.....
ENSMODP00000012747  .........................................................--------------.-.....
ENSMODP00000001919  .........................................................--------------.-.....
ENSMODP00000001944  .........................................................--------------.-.....
ENSMODP00000006156  .........................................................--------------.-.....
ENSMODP00000004377  .........................................................--------------.-.....
ENSMODP00000003434  .........................................................--------------.-.....
ENSMODP00000021792  .........................................................--------------.-.....
ENSMODP00000000011  .........................................................--------------.-.....
ENSMODP00000007341  .........................................................PKPCGQFCFCEIQG.C.....
ENSMODP00000010183  .........................................................--------------.-.....
ENSMODP00000028156  .........................................................--------------.-.....
ENSMODP00000015423  .........................................................--------------.-.....
ENSMODP00000013069  .........................................................--------------.-.....
ENSMODP00000038791  .........................................................--------------.-.....
ENSMODP00000000011  .........................................................--------------.-.....
ENSMODP00000002674  .........................................................-----VNLRGFSLG.F.....
ENSMODP00000039642  .........................................................--------------.-.....
ENSMODP00000036724  .........................................................--------------.-.....
ENSMODP00000023634  .........................................................------YYTELEQK.-.....
ENSMODP00000000087  .........................................................--------------.-.....
ENSMODP00000007362  .........................................................--------------.-.....
ENSMODP00000011262  .........................................................--------------.-.....
ENSMODP00000001586  .........................................................--------------.-.....
ENSMODP00000013441  .........................................................--------------.-.....
ENSMODP00000022828  .........................................................--------------.-.....
ENSMODP00000013444  .........................................................-------IQGVPAV.G.....
ENSMODP00000002674  .........................................................--------------.-.....


                      10           120           130             140       150         160        17
                       |             |             |               |         |           |          
d1u1qa_               .EE....HHLRDYFEQ.YGKIEV...IEIMTD....RGS..GKKRGFAFVTFDDHDSVDKIVIQK..YHTV.NGHNCE
ENSMODP00000007717  .DD....ERLRKEFSP.FGTITS...AKVMME....--G..GRSKGFGFVCFSSPEEATKAVTEM..NGRI.VATKPL
ENSMODP00000022014  .DD....EKLRKEFSP.FGSITS...AKVVML....-ED..GRSKGFGFVCFSSPDEATKAVTEM..NGRI.VGSKPL
ENSMODP00000029058  .DD....EKLRKEFSP.YGVITS...AKVMTE....--G..GHSKGFGFVCFSSPEEATKAVTEM..NGRI.VSTKPL
ENSMODP00000027267  .DD....ERLRKEFSP.FGTITS...AKVMME....--G..GRSKGFGFVCFSSPEEATKAVTEM..NGRI.VATKPL
ENSMODP00000023398  .DE....KLLYDTFSA.FGVILQt..PKIMRD....PDT..GNSKGYAFINFASFDASDAAIEAM..NGQY.LCNRPI
ENSMODP00000037814  .ND....EHLRKEFSP.FGTITS...AKVMME....--N..GRSKGFGFVCFSSSKDAAKASREM..NGKL.VASKPL
ENSMODP00000021348  .DD....ERLRKEFSP.FGTITS...AKVMME....--G..GRNKGFGFVCFSSPEEATKAVTEM..NGRI.VATKPL
ENSMODP00000027586  .DD....ERLRKAFSP.FGTITS...AKVMME....--G..GHSRGFGFVCFSAPEEAAKAVSEM..NGKL.VATKPL
ENSMODP00000022014  .DN....KALYDTFSA.FGNILS...CKVVCD....--E..NGSKGYAFVHFETQDAADRAIEKM..NGML.LNDRKV
ENSMODP00000029058  .DN....KALYDTFST.FGNILS...CKVVCD....--E..NGSRGFGFVHFETHEAANQAINTM..NGML.LNDRKV
ENSMODP00000021348  .DN....KALFDTFSA.FGNILS...CKVVCD....--E..HGSKGYGFVHFETRDAAERAIDKM..NGML.LNDRKV
ENSMODP00000027586  .DN....KALYKTFSA.FGNILS...CKVISD....--E..NGSKGYGFVHFENQQAADKAIEKM..NGVR.LNNLKV
ENSMODP00000037814  .DN....KALYDTFST.FGRILS...CKVISD....--E..NGSKGYGFVHFETQESAGKAIEKM..NGML.LNNLKV
ENSMODP00000004837  .DE....SILWQMFGP.FGAVTN...VKVIRD....FNT..NKCKGFGFVTMTNYDEAAMAIASL..NGYR.LGDRVL
ENSMODP00000020923  .GD....QDILQMFMP.FGNVIS...AKVFID....KQT..NLSKCFGFVSYDNPVSAQAAIQAM..NGFQ.IGMKRL
ENSMODP00000007717  .DN....KALYDTFSA.FGNILS...CKVMVC....-DE..NGSKGYGFVH-ETQEAAERAIEKM..NGML.LNDRKV
ENSMODP00000024842  .GD....QDLLQMFMP.FGNVVS...AKVFID....KQT..NLSKCFGFVSYDNPVSAQAAIQSM..NGFQ.IGMKRL
ENSMODP00000006200  .DE....GILWQMFGP.FGAVTN...VKVIRD....FNT..NKCKGFGFVTMTNYEEAAMAIASL..NGYR.LGDKIL
ENSMODP00000036724  .GD....AELMQMFLP.FGTVIS...AKVFVD....RAT..NQSKCFGFVSFDNPASAQTAIQAM..NGFQ.IGMKRL
ENSMODP00000004717  .DE....NVLWQLFGP.FGAVSK...VKIIRD....FNT..NKCKRFGFVTMTSYNEAALAVASL..NGYC.LGGRVL
ENSMODP00000008249  .DE....SVLWQLFGP.FGAVTN...VKVIRD....FTT..NKCKGFGFVTMTNYDEAAMAIASL..NGYR.LGDRIL
ENSMODP00000027604  .DE....NVLWQLFGP.FGAVSK...VKIIRD....FNT..NKCKRFGFVTMTSYNEAALAVASL..NGYC.LGGRVL
ENSMODP00000023901  .GD....SELMQMFLP.FGNIIS...SKVFMD....RAT..NQSKCFGFVSFDNPSSAQTAIQAM..NGFQ.IGMKRL
ENSMODP00000023578  .TD....SEILQMFVP.FGHVIS...AKVFVD....RAT..NQSKCFGFVSFDNPASAQAAIQAM..NGFQ.IGMKRL
ENSMODP00000007804  .EE....HHLRDYFEQ.YGKIEV...IEIMTD....RGS..GKKRGFAFVTFDDHDSVDKIVI--..----.------
ENSMODP00000034649  .EE....YNLRDYFEK.YGKIKT...IEVMED....QQS..GKKRGFAFVTFDDHDTVDKIF---..----.------
ENSMODP00000018486  .SW....QDLKDHMRE.AGDVCY...ADVYRD....---..----GTGVVEFVRKEDMTYAVRKL..DNTK.FR----
ENSMODP00000006475  .DE....QELENMLKP.FGQVIS...TRILRD....-SS..GTSRGVGFARMESTEKCEAVIGHF..NGKF.------
ENSMODP00000014208  .SW....QDLKDFMRQ.AGEVTF...ADAHRP....---..--KLNEGVVEFASYSDLKNAIEKL..SGKE.INGRKI
ENSMODP00000040531  .SW....QDLKDYMRQ.AGEVTY...ADAHKG....---..--RKNEGVIEFVSYSDMKRALEKL..DGTE.VNGRKI
ENSMODP00000010059  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013841  .SW....QDLKDYMRQ.AGEVTY...ADAHKG....---..--RKNEGVIEFVSYSDMKRALEKL..DGTE.VNGRKI
ENSMODP00000014054  .TA....DELRQFFCQ.YGEVVD...VFIPKP....---..--FRAFAFVTFADDQVAQS-----..----.------
ENSMODP00000009994  .SN....ELLEQAFSQ.FGPVEK...AVVVVD....-DR..GRATGKGFVEFAAKPPARKALE--..----.------
ENSMODP00000004654  .GW....KKLKEVFCM.AGVVVR...ADILED....-KD..GKSRGIGTVTFEQSIEAVQAISMF..NGQL.LFDRPM
ENSMODP00000001901  .EIk...DDVIEECNK.HGGVIH...IYVDKN....---..-SAQGNVYVKCPSIAAAIAAVNAL..HGRW.FAGKMI
ENSMODP00000038186  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000029243  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000012172  .TE....EDLRDKFKV.YGDIEY...CSIIKN....KAT..GESRGLGYVRYLKPSQAAQAIEN-..----.------
ENSMODP00000019849  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000959  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003831  .SW....QDLKDHMRE.AGGVCY...ADVQKD....---..----GMGVVEFLRKEDMEYALRRL..DDSK.FR----
ENSMODP00000016570  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022371  .SN....ELLEEAFSQ.FGPIER...AVVIVD....-DR..GRSTGKGIVEFASKPAARKAFE--..----.------
ENSMODP00000034857  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000034858  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005475  .SN....ELLEEAFSV.FGQVER...AVVIVD....-DR..GRPSGKGIVEFSGKPAARKALD--..----.------
ENSMODP00000022505  .DD....KKLRKEYSP.FGSNTT...TKVMLE....--D..GRSRDFGFVCFSSPDEVTKAVTEM..NEPI.VGSKPL
ENSMODP00000003848  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004397  .RP....SELQELFGR.FGSLGR...VLLPEG....---..---GITAIVEYLEPLEARRGFTSL..AYSK.FHDVPL
ENSMODP00000001893  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017573  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004247  .GW....KKLKEVFCM.AGVVVR...ADILEH....-KD..GKSHGMGTVTFEQSIEAVQVILMF..NGQL.LFDRPM
ENSMODP00000001568  .KK....EEILDEMKK.VTEGVV...DVIVYPsa..TDK..TKNRGFAFVEYESHRAAAMARRKLipGTFQ.LWGHTI
ENSMODP00000012202  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031808  .TD....QYLTRHFCR.YGPVVK...VVYDRL....---..---KGMALVLYNEIEYAQAAVKET..KGRK.IGGNKI
ENSMODP00000006523  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000019256  .KR....DEILEEISK.VTEGVL...DVIMYAsa..ADK..TKNRGFAFIEYKSHQAAAMARRKLmpGRIQ.LWGQQI
ENSMODP00000031416  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022875  .TK....EQILEEFSK.VTEGLT...DVILYHqp..DDK..KKNRGFCFLEYEDHKTA-------..----.------
ENSMODP00000025722  .KR....DEILEEISK.VTEGVL...DVIVYAsa..TDK..TKNRGFAFIEYESHRAAAMARRKLmpGRIQ.LWGQQI
ENSMODP00000013678  .DD....GMLYEFFVKvYPSCRG...GKVVLD....-QA..GISKGYGFVKFTDELEQKRALTEC..QGAVgLGSKPV
ENSMODP00000019066  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014920  .SL....AALAREFDR.FGSIRT...IDHVKG....---..---DSFAYIQYESLDAAQAACVQM..RGFP.LGGPER
ENSMODP00000011039  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000025181  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006917  .SDv...DELRQALSS.VHPPTF...CQLAYG....-QD..GQLKGFAVLEYETSQMAEEAQQQA..DGLV.LAGNSV
ENSMODP00000028798  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031317  .TV....EDVKQYFEQ.FGKVVH...VCVCLQ....---..------------------------..----.------
ENSMODP00000001566  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000034177  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015039  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023377  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004837  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000021002  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000027677  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022505  .DN....KVLYDTFSA.FGNILS...CKVVCD....--E..NGSKSYAFVHFETQYTADRAIE--..-GML.LNDRKV
ENSMODP00000001487  .TDs...QELLQIFSF.SHKPVF...GQLAQD....-EG..SYADGFAVVEYDSPEHAEDVQQAA..DGMT.IKGSQV
ENSMODP00000038918  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011435  .LE....GEVTEECGK.FGAVNR...VIIYQEkqgeEED..AEIIVKIFVEFSMASETHKAIQAL..NGRW.FAGRKV
ENSMODP00000011432  .LE....GEVTEECGK.FGAVNR...VIIYQEkqgeEED..AEIIVKIFVEFSMASETHKAIQAL..NGRW.FAGRKV
ENSMODP00000006345  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024718  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009844  .NE....LMLSMLFNQ.FPGFKE...VRLVPG....---..--RHDIAFVEFDNEVQAGAARDAL..QGFK.I-----
ENSMODP00000003000  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014933  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022015  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015618  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001920  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000027267  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000026325  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013647  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020553  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003678  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000029789  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000721  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006200  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004743  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014913  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000038918  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006371  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006345  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015438  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008450  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010490  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007208  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024712  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017405  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001337  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000028798  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002547  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005593  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018401  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014913  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016281  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004397  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000006  .NE....MMLSMLFNQ.YPVFKE...VRLGPG....---..--RHDIAFVEFENDGQAGAARDAL..QGFK.I-----
ENSMODP00000020576  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005194  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002993  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015362  .RW....EVLDSLLAQ.YGTVES...CEQV--....-NT..ESETAVVNVTYSNREQTRQAIMKL..NGHQ.LENHSL
ENSMODP00000004717  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018934  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000027604  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002993  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000363  .GD....AELMQMFLP.FD----...------....---..------------------------..----.------
ENSMODP00000014933  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016940  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007822  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002891  .KE....---------.------...------....---..------------------------..----.------
ENSMODP00000003337  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005194  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008450  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017452  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010785  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010799  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004654  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022797  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016382  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003786  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017322  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020165  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010787  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001412  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015013  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003000  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011795  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000022875  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000028798  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003337  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018401  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000019828  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011039  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010024  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023575  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001566  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031345  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011039  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017614  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011435  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011432  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000035735  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001944  .SV....DEILDFFYG.YQVIPG...SVCLKY....NEK..GMPTGEAMVAFESRDEAMAAVVDL..NDRP.IGSRKV
ENSMODP00000036858  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005193  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000028751  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000039173  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006815  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020576  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000025722  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002300  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003786  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023826  .NA....QDIVNFFAP.LKPVRI...TMEYSS....--S..GKATGEADVHFETHEDAVAAM---..----.------
ENSMODP00000033056  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009807  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018415  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000175  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000039175  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000036858  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008249  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000032411  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001944  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009227  .NV....NEILDFFHG.YGVIPE...SVSIQY....NEQ..GLPLGEAIVAMVNYDEAMAAINDL..NDRP.VGPRKV
ENSMODP00000007480  .RA....VELAMIMDRlYGGVCY...AGIDTD....PEL..KYPKGAGRVAFSNQQSYIAAIS--..----.------
ENSMODP00000011795  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002604  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000021564  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000036078  .RA....VELAMIMDRlYGGVCY...AGIDTD....PEL..KYPKGAGRVAFSNQQSYIAAIS--..----.------
ENSMODP00000010024  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013583  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013581  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001370  .RA....VELAMIMDRlYGGVCY...AGIDTD....PEL..KYPKGAGRVAFSNQQSYIAAIS--..----.------
ENSMODP00000010502  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018934  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031808  .TDtslkDGLFHEFKK.YGKVTS...VQIHGA....---..-SEERYGLVFFRQQEDQEKAQNAS..KGKL.FFGVQI
ENSMODP00000013458  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004397  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002817  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024842  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000021564  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000035400  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003000  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007934  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001484  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008195  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001568  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010946  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003430  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007024  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011964  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024532  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004397  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000032411  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010717  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008758  .TK....EDMSQKFSL.LPSLEA...IFLPVD....PQS..KKHKKYCFLKFRSFECAQSALKIL..QGPT.GLSWKL
ENSMODP00000021972  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000035735  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018834  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020165  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031345  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023979  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015407  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014946  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003584  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007822  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002891  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016781  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009227  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018934  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011795  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000029701  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011218  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007822  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001901  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005193  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013253  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001062  .TA....DELQQCFCQ.YGEVV-...------....---..------------------------..----.------
ENSMODP00000006815  .MV....DDLKNLFTE.AGCTVK...AFKFFQ....---..-KDRKMALIQLGSVEEAIQALIEL..HNHD.LGE---
ENSMODP00000012172  .PL....DILEDIFCR.FGNLIE...VYLVSG....---..---KNVGYAKYADRTSANDAIATL..HGKI.LNGVRL
ENSMODP00000005193  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000232  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000034177  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006415  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000035735  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023866  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000026309  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000041019  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001219  pCW....KVLDSVLAQ.YGSVEN...CEQV--....-NT..DTETAVVNVTYSCKEQARLAIEKL..NGFQ.LEGYTL
ENSMODP00000006815  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010225  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017514  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000039002  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009010  .TA....EEVLAFFGQ.HCPITGgkeGILFVT....YPD..GRPTGDAFVLFACEEYAQNALRK-..----.------
ENSMODP00000020576  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000036858  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000029254  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017614  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018402  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016781  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013040  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002441  .NA....EALAAIVNDlFGGVVY...AGIDTD....-KH..KYPIGSGRVTFNNQRSYLKAVS--..----.------
ENSMODP00000009010  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023826  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004397  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008593  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014946  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020165  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000019256  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001487  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023578  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018618  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001944  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024562  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010717  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000033971  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010437  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017391  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000016781  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000031445  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000017592  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003000  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000021460  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000030260  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010225  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005193  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006917  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023718  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006381  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013139  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011106  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011084  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000033409  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007822  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000011  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000019244  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013327  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009227  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020775  .--....-ETKEECEK.YGKVGK...CVIFEIp...GAP..DDEAVRIFLEFERVESAIKAVVDL..NGRY.FGGRVV
ENSMODP00000008836  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018496  .DA....FMLGMGMLG.YP----...------....---..------------------------..----.------
ENSMODP00000012937  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024766  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006381  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010717  .TV....DVLYTVCNP.VGKVQR...IVIFKR....--N..GIQAMVEYPSFNSFLCAQKAKAAL..NGAD.IYAGCC
ENSMODP00000009664  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000010490  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024054  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002114  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000028156  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003584  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000036903  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003337  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014333  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008714  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013327  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006050  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013604  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000664  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000012747  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000026351  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000018934  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015407  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009575  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005447  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000005596  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007024  .SR....KHLRETLAV.IAEVVY...VDVLEG....---..---DTECHARFKTPEDAQAVIKA-..----.------
ENSMODP00000024054  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001919  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011172  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006381  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000009227  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001242  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024718  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000026104  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000032086  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000012383  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000012220  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000020434  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000721  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000674  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024766  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000024532  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000014848  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008714  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013897  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000008570  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015423  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000012747  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001919  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001944  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000006156  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000004377  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000003434  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000021792  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000011  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007341  .EK....EDAITYYAR.MKDRLL...QRLSQE....EHTvqDHPLGMAFVTFQESSMANFILKDF..NACK.CQG---
ENSMODP00000010183  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000028156  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000015423  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013069  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000038791  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000000011  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000002674  .GK....EEIVYFFSG.LEVVPN...EITLLV....-DF..QGRTGEDCIQFSSQEIARKALKRP..K---.------
ENSMODP00000039642  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000036724  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000023634  .--....--LKEEYKQ.E-----...----QE....KVN..QKPLGMAFVTFHNESIAALILKDF..NAC-.------
ENSMODP00000000087  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000007362  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000011262  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000001586  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013441  .--....---------.------...------....---..---L--------------------..----.------
ENSMODP00000022828  .--....---------.------...------....---..------------------------..----.------
ENSMODP00000013444  .VM....KELIEQFAL.FGAIEQ...YNALDE....YPA..EEFTEVYLIKFQKLQSARIAKRKL..DERS.FFGGLL
ENSMODP00000002674  .--....---------.------...------....---..------------------------..----.------


                      0       180                                                                   
                      |         |                                                                   
d1u1qa_               V-------------rkalskqemasas...................................................
ENSMODP00000007717  YVALAQRKEE----r...............................................................
ENSMODP00000022014  YVALAQRKEE----r...............................................................
ENSMODP00000029058  YVALAQRKEE----r...............................................................
ENSMODP00000027267  YIALAQRKEE----r...............................................................
ENSMODP00000023398  TVSYAFKKD-----sk..............................................................
ENSMODP00000037814  YVSLAQRKEE----r...............................................................
ENSMODP00000021348  YIALAQRKEE----r...............................................................
ENSMODP00000027586  YVALAQRK------rd..............................................................
ENSMODP00000022014  FVGRFKSRK-----er..............................................................
ENSMODP00000029058  FVGHFKSR------qe..............................................................
ENSMODP00000021348  FVGRFKSRK-----er..............................................................
ENSMODP00000027586  YVGRFKSR------ke..............................................................
ENSMODP00000037814  FVGRFKSR------re..............................................................
ENSMODP00000004837  QVSFKTNK------t...............................................................
ENSMODP00000020923  KVQLKRSKN-----d...............................................................
ENSMODP00000007717  FVGRFKSRK-----er..............................................................
ENSMODP00000024842  KVQLKRSKN-----d...............................................................
ENSMODP00000006200  QVSFKTN-------k...............................................................
ENSMODP00000036724  KVQLKRPKDA----n...............................................................
ENSMODP00000004717  QVSFK---------tn..............................................................
ENSMODP00000008249  QVSFKTSK------q...............................................................
ENSMODP00000027604  QVSFK---------tn..............................................................
ENSMODP00000023901  KVQLKRPKD-----a...............................................................
ENSMODP00000023578  KVQLKRPKDA----n...............................................................
ENSMODP00000007804  --------------qkyht...........................................................
ENSMODP00000034649  --------------vk..............................................................
ENSMODP00000018486  --------------sh..............................................................
ENSMODP00000006475  --------------i...............................................................
ENSMODP00000014208  KL------------ie..............................................................
ENSMODP00000040531  RL------------vedrp...........................................................
ENSMODP00000010059  --------------iinpsappqsv.....................................................
ENSMODP00000013841  RL------------vedrp...........................................................
ENSMODP00000014054  --------------lc..............................................................
ENSMODP00000009994  --------------r...............................................................
ENSMODP00000004654  HV------------k...............................................................
ENSMODP00000001901  TA------------ay..............................................................
ENSMODP00000038186  --------------gqeypaivefapfqk.................................................
ENSMODP00000029243  --------------rsggqvrdeyrqdydagrggyg..........................................
ENSMODP00000012172  --------------cd..............................................................
ENSMODP00000019849  --------------rsggqvrdeyrkdydagrggyg..........................................
ENSMODP00000000959  --------------gggggggggggg....................................................
ENSMODP00000003831  --------------she.............................................................
ENSMODP00000016570  --------------ptygssrrrdyyd...................................................
ENSMODP00000022371  --------------rc..............................................................
ENSMODP00000034857  --------------rsggqvrdeyrqdydagrggyg..........................................
ENSMODP00000034858  --------------rsggqvrdeyrqdydagrggyg..........................................
ENSMODP00000005475  --------------r...............................................................
ENSMODP00000022505  FVPLAQRKE-----e...............................................................
ENSMODP00000003848  --------------kgleypavvefapfqk................................................
ENSMODP00000004397  YLEWA---------................................................................
ENSMODP00000001893  --------------prryggggygrrsrr.................................................
ENSMODP00000017573  --------------ppppprsrgpprglrgggrgg...........................................
ENSMODP00000004247  HVK-----------m...............................................................
ENSMODP00000001568  QVDWADP-------e...............................................................
ENSMODP00000012202  --------------giymg...........................................................
ENSMODP00000031808  KVDFAN--------re..............................................................
ENSMODP00000006523  --------------gyrggss.........................................................
ENSMODP00000019256  TVDWAE--------p...............................................................
ENSMODP00000031416  --------------knk.............................................................
ENSMODP00000022875  --------------a...............................................................
ENSMODP00000025722  AVDWAE--------p...............................................................
ENSMODP00000013678  RLSVAIP-------ka..............................................................
ENSMODP00000019066  --------------ptygrrsvffdr....................................................
ENSMODP00000014920  RL------------rvdfak..........................................................
ENSMODP00000011039  --------------ks..............................................................
ENSMODP00000025181  --------------efirr...........................................................
ENSMODP00000006917  RVSFCAP-------g...............................................................
ENSMODP00000028798  --------------k...............................................................
ENSMODP00000031317  --------------................................................................
ENSMODP00000001566  --------------sa..............................................................
ENSMODP00000034177  --------------ld..............................................................
ENSMODP00000015039  --------------ds..............................................................
ENSMODP00000023377  --------------ggrrrsrspdrrr...................................................
ENSMODP00000004837  --------------s...............................................................
ENSMODP00000021002  --------------rgkg............................................................
ENSMODP00000027677  --------------tssppysv........................................................
ENSMODP00000022505  FVG-----------rlks............................................................
ENSMODP00000001487  QVSFCAP-------g...............................................................
ENSMODP00000038918  --------------qpgasqwgsrlm....................................................
ENSMODP00000011435  VAEVY---------dqe.............................................................
ENSMODP00000011432  VAEVY---------dqe.............................................................
ENSMODP00000006345  --------------qpgasqwgsrlm....................................................
ENSMODP00000024718  --------------rgrgggsgnfmgrggnfggggg..........................................
ENSMODP00000009844  --------------t...............................................................
ENSMODP00000003000  --------------ggrggrggf.......................................................
ENSMODP00000014933  --------------qkggrgaaaggrggtrgrgr............................................
ENSMODP00000022015  --------------ik..............................................................
ENSMODP00000015618  --------------lgggfggkkesgqlrfggr.............................................
ENSMODP00000001920  --------------hsrrgpp.........................................................
ENSMODP00000027267  --------------ael.............................................................
ENSMODP00000026325  --------------lhigsshlappnpdkqflisp...........................................
ENSMODP00000013647  --------------primq...........................................................
ENSMODP00000020553  --------------gakprs..........................................................
ENSMODP00000003678  --------------sggfggggg.......................................................
ENSMODP00000029789  --------------rrhrgasl........................................................
ENSMODP00000000721  --------------rggnfgfgdsrggggn................................................
ENSMODP00000006200  --------------s...............................................................
ENSMODP00000004743  --------------nrggprnrlsgrg...................................................
ENSMODP00000014913  --------------agrargrgggps....................................................
ENSMODP00000038918  --------------rpkegwqkgprsdnn.................................................
ENSMODP00000006371  --------------s...............................................................
ENSMODP00000006345  --------------rpkegwqkgprsdn..................................................
ENSMODP00000015438  --------------vgi.............................................................
ENSMODP00000008450  --------------qkgggtaaggrggtrghys.............................................
ENSMODP00000010490  --------------nh..............................................................
ENSMODP00000007208  --------------tnk.............................................................
ENSMODP00000024712  --------------yrp.............................................................
ENSMODP00000017405  --------------asqevsssysqhn...................................................
ENSMODP00000001337  --------------tnk.............................................................
ENSMODP00000028798  --------------sq..............................................................
ENSMODP00000002547  --------------r...............................................................
ENSMODP00000005593  --------------tdrgfpraryraratnysss............................................
ENSMODP00000018401  --------------ggggs...........................................................
ENSMODP00000014913  --------------ktk.............................................................
ENSMODP00000016281  --------------sssrydd.........................................................
ENSMODP00000004397  --------------ra..............................................................
ENSMODP00000000006  --------------t...............................................................
ENSMODP00000020576  --------------lgvc............................................................
ENSMODP00000005194  --------------rrskfgis........................................................
ENSMODP00000002993  --------------................................................................
ENSMODP00000015362  KVSYIP--------deq.............................................................
ENSMODP00000004717  --------------ss..............................................................
ENSMODP00000018934  --------------atq.............................................................
ENSMODP00000027604  --------------ss..............................................................
ENSMODP00000002993  --------------d...............................................................
ENSMODP00000000363  --------------e...............................................................
ENSMODP00000014933  --------------................................................................
ENSMODP00000016940  --------------ppswgrrprddyrrrspppr............................................
ENSMODP00000007822  --------------slnvkynndksrdytrpdlps...........................................
ENSMODP00000002891  --------------h...............................................................
ENSMODP00000003337  --------------qrtggsfpgghvpdmgsg..............................................
ENSMODP00000005194  --------------mkk.............................................................
ENSMODP00000008450  --------------a...............................................................
ENSMODP00000017452  --------------drn.............................................................
ENSMODP00000010785  --------------rpparrp.........................................................
ENSMODP00000010799  --------------regrgmppplrggpggpgg.............................................
ENSMODP00000004654  --------------dr..............................................................
ENSMODP00000022797  --------------gq..............................................................
ENSMODP00000016382  --------------pgdkayllppqpvkqflisp............................................
ENSMODP00000003786  --------------gsrsgggggyssrratgrdky...........................................
ENSMODP00000017322  --------------frkggpddrgmggsresrgg............................................
ENSMODP00000020165  --------------qaarqasrstayedy.................................................
ENSMODP00000010787  --------------drppar..........................................................
ENSMODP00000001412  --------------pag.............................................................
ENSMODP00000015013  --------------an..............................................................
ENSMODP00000003000  --------------rgknnswsgnn.....................................................
ENSMODP00000011795  --------------flnsta..........................................................
ENSMODP00000022875  --------------rkaqrqaaknqmyddyyy..............................................
ENSMODP00000028798  --------------pvqqqnqigypqaygqwgqwyg..........................................
ENSMODP00000003337  --------------vphe............................................................
ENSMODP00000018401  --------------pg..............................................................
ENSMODP00000019828  --------------pprrmlpppp......................................................
ENSMODP00000011039  --------------pd..............................................................
ENSMODP00000010024  --------------dqsgcyrcgkegh...................................................
ENSMODP00000023575  --------------etdgdklhlappqpakqflisp..........................................
ENSMODP00000001566  --------------qkts............................................................
ENSMODP00000031345  --------------rpeagralgamvprqvygarg...........................................
ENSMODP00000011039  --------------s...............................................................
ENSMODP00000017614  --------------wd..............................................................
ENSMODP00000011435  --------------p...............................................................
ENSMODP00000011432  --------------p...............................................................
ENSMODP00000035735  --------------lgvc............................................................
ENSMODP00000001944  K-------------l...............................................................
ENSMODP00000036858  --------------isv.............................................................
ENSMODP00000005193  --------------vnlnvkynndksrdytrpdlps..........................................
ENSMODP00000028751  --------------gmpp............................................................
ENSMODP00000039173  --------------lnsta...........................................................
ENSMODP00000006815  --------------slnvkynndksrdftrldl.............................................
ENSMODP00000020576  --------------ytrgtggrgsglqgey................................................
ENSMODP00000025722  --------------keq.............................................................
ENSMODP00000002300  --------------ngrggr..........................................................
ENSMODP00000003786  --------------sgsrs...........................................................
ENSMODP00000023826  --------------g...............................................................
ENSMODP00000033056  --------------kkg.............................................................
ENSMODP00000009807  --------------kkg.............................................................
ENSMODP00000018415  --------------nlc.............................................................
ENSMODP00000000175  --------------kvh.............................................................
ENSMODP00000039175  --------------nlc.............................................................
ENSMODP00000036858  --------------qk..............................................................
ENSMODP00000008249  --------------sa..............................................................
ENSMODP00000032411  --------------sl..............................................................
ENSMODP00000001944  --------------kidmir..........................................................
ENSMODP00000009227  K-------------l...............................................................
ENSMODP00000007480  --------------a...............................................................
ENSMODP00000011795  --------------thyd............................................................
ENSMODP00000002604  --------------pr..............................................................
ENSMODP00000021564  --------------lnstagggs.......................................................
ENSMODP00000036078  --------------a...............................................................
ENSMODP00000010024  --------------s...............................................................
ENSMODP00000013583  --------------avp.............................................................
ENSMODP00000013581  --------------avp.............................................................
ENSMODP00000001370  --------------................................................................
ENSMODP00000010502  --------------ek..............................................................
ENSMODP00000018934  --------------d...............................................................
ENSMODP00000031808  EVTAW---------vgpe............................................................
ENSMODP00000013458  --------------istarkelsrklssdtmsrivrmcllkgkmgvcfdiptseselmqaewndsdwi..........
ENSMODP00000004397  --------------ee..............................................................
ENSMODP00000002817  --------------t...............................................................
ENSMODP00000024842  --------------dsekn...........................................................
ENSMODP00000021564  --------------gfydpprr........................................................
ENSMODP00000035400  --------------a...............................................................
ENSMODP00000003000  --------------kg..............................................................
ENSMODP00000007934  --------------rgk.............................................................
ENSMODP00000001484  --------------gkkt............................................................
ENSMODP00000008195  --------------vnrg............................................................
ENSMODP00000001568  --------------rqhlngqis.......................................................
ENSMODP00000010946  --------------kke.............................................................
ENSMODP00000003430  --------------nrp.............................................................
ENSMODP00000007024  --------------................................................................
ENSMODP00000011964  --------------rgk.............................................................
ENSMODP00000024532  --------------na..............................................................
ENSMODP00000004397  --------------aws.............................................................
ENSMODP00000032411  --------------ppgvpaptepllckfadggqkkrqnqskytqngrpwpreg........................
ENSMODP00000010717  --------------gntdd...........................................................
ENSMODP00000008758  VCRK----------alt.............................................................
ENSMODP00000021972  --------------vnrg............................................................
ENSMODP00000035735  --------------qytr............................................................
ENSMODP00000018834  --------------mld.............................................................
ENSMODP00000020165  --------------hlgvci..........................................................
ENSMODP00000031345  --------------dfk.............................................................
ENSMODP00000023979  --------------rgggddrrdlrrndrgpggpr...........................................
ENSMODP00000015407  --------------ys..............................................................
ENSMODP00000014946  --------------ky..............................................................
ENSMODP00000003584  --------------dpk.............................................................
ENSMODP00000007822  --------------pregqe..........................................................
ENSMODP00000002891  --------------sqgglssggsyndfsnyn..............................................
ENSMODP00000016781  --------------gdtdds..........................................................
ENSMODP00000009227  --------------idcgg...........................................................
ENSMODP00000018934  --------------nkm.............................................................
ENSMODP00000011795  --------------emdwvlk.........................................................
ENSMODP00000029701  --------------lggglggtrrgga...................................................
ENSMODP00000011218  --------------dnrprgpggprsglgggirg............................................
ENSMODP00000007822  --------------ktdnspnq........................................................
ENSMODP00000001901  --------------a...............................................................
ENSMODP00000005193  --------------el..............................................................
ENSMODP00000013253  --------------idksvm..........................................................
ENSMODP00000001062  --------------vf..............................................................
ENSMODP00000006815  --------------nh..............................................................
ENSMODP00000012172  KVMLADSP------re..............................................................
ENSMODP00000005193  --------------qlpre...........................................................
ENSMODP00000000232  --------------ql..............................................................
ENSMODP00000034177  --------------nr..............................................................
ENSMODP00000006415  --------------................................................................
ENSMODP00000035735  --------------idv.............................................................
ENSMODP00000023866  --------------rgrggfqgrgg.....................................................
ENSMODP00000026309  --------------................................................................
ENSMODP00000041019  --------------................................................................
ENSMODP00000001219  KVAY----------i...............................................................
ENSMODP00000006815  --------------phlrsqpvfiqysnhrel..............................................
ENSMODP00000010225  --------------yfakkneer.......................................................
ENSMODP00000017514  --------------ls..............................................................
ENSMODP00000039002  --------------pvtdf...........................................................
ENSMODP00000009010  --------------hk..............................................................
ENSMODP00000020576  --------------vevd............................................................
ENSMODP00000036858  --------------dpd.............................................................
ENSMODP00000029254  --------------................................................................
ENSMODP00000017614  --------------ql..............................................................
ENSMODP00000018402  --------------vddlgq..........................................................
ENSMODP00000016781  --------------s...............................................................
ENSMODP00000013040  --------------yk..............................................................
ENSMODP00000002441  --------------................................................................
ENSMODP00000009010  --------------eemn............................................................
ENSMODP00000023826  --------------nnedvda.........................................................
ENSMODP00000004397  --------------kg..............................................................
ENSMODP00000008593  --------------ngsi............................................................
ENSMODP00000014946  --------------yk..............................................................
ENSMODP00000020165  --------------pd..............................................................
ENSMODP00000019256  --------------qytr............................................................
ENSMODP00000001487  --------------qptd............................................................
ENSMODP00000023578  --------------en..............................................................
ENSMODP00000018618  --------------rlgsstdkkdsgrlhvdfaqard.........................................
ENSMODP00000001944  --------------wvaa............................................................
ENSMODP00000024562  --------------ydh.............................................................
ENSMODP00000010717  --------------svvp............................................................
ENSMODP00000033971  --------------n...............................................................
ENSMODP00000010437  --------------dak.............................................................
ENSMODP00000017391  --------------rdnrprgpggprsglgggirg...........................................
ENSMODP00000016781  --------------vfkndqdtwdytnpnls...............................................
ENSMODP00000031445  --------------fye.............................................................
ENSMODP00000017592  --------------a...............................................................
ENSMODP00000003000  --------------dr..............................................................
ENSMODP00000021460  --------------pvt.............................................................
ENSMODP00000030260  --------------rdnrprgpggprsgls................................................
ENSMODP00000010225  --------------nkdvtwevlegetekealkkiiedqqeslnkl................................
ENSMODP00000005193  --------------s...............................................................
ENSMODP00000006917  --------------qptd............................................................
ENSMODP00000023718  --------------knk.............................................................
ENSMODP00000006381  --------------eem.............................................................
ENSMODP00000013139  --------------kskl............................................................
ENSMODP00000011106  --------------rgesrpalrgpepatdgr..............................................
ENSMODP00000011084  --------------efirrr..........................................................
ENSMODP00000033409  --------------feaqarkrecvrvpr.................................................
ENSMODP00000007822  --------------s...............................................................
ENSMODP00000000011  --------------iflnsta.........................................................
ENSMODP00000019244  --------------lgsstdkkdtgrlhvdfaqar...........................................
ENSMODP00000013327  --------------smhy............................................................
ENSMODP00000009227  --------------lkfi............................................................
ENSMODP00000020775  KACF----------ynldkf..........................................................
ENSMODP00000008836  --------------qfemqsrkttqsgqmsgegkag..........................................
ENSMODP00000018496  --------------nfvatyg.........................................................
ENSMODP00000012937  --------------krk.............................................................
ENSMODP00000024766  --------------................................................................
ENSMODP00000006381  --------------eflkia..........................................................
ENSMODP00000010717  --------------tlkieyarptrlnvirndndswdytkpylgr.................................
ENSMODP00000009664  --------------kt..............................................................
ENSMODP00000010490  --------------l...............................................................
ENSMODP00000024054  --------------nkdvtwevlegekekealkkiiedqqeslnklkskg............................
ENSMODP00000002114  --------------aq..............................................................
ENSMODP00000028156  --------------kk..............................................................
ENSMODP00000003584  --------------qas.............................................................
ENSMODP00000036903  --------------qrgrsgsgnfgggcgggfgg............................................
ENSMODP00000003337  --------------dr..............................................................
ENSMODP00000014333  --------------sghk............................................................
ENSMODP00000008714  --------------lk..............................................................
ENSMODP00000013327  --------------dma.............................................................
ENSMODP00000006050  --------------vq..............................................................
ENSMODP00000013604  --------------ia..............................................................
ENSMODP00000000664  --------------ngytl...........................................................
ENSMODP00000012747  --------------nn..............................................................
ENSMODP00000026351  --------------np..............................................................
ENSMODP00000018934  --------------pqkrpivefsledgrklkmke...........................................
ENSMODP00000015407  --------------kd..............................................................
ENSMODP00000009575  --------------tpapk...........................................................
ENSMODP00000005447  --------------ta..............................................................
ENSMODP00000005596  --------------kn..............................................................
ENSMODP00000007024  --------------haeikkkynwkfeilsgdheqrywqkilvdrqaklnqprekk......................
ENSMODP00000024054  --------------pel.............................................................
ENSMODP00000001919  --------------eg..............................................................
ENSMODP00000011172  --------------ee..............................................................
ENSMODP00000006381  --------------gaxxxx..........................................................
ENSMODP00000009227  --------------qntiem..........................................................
ENSMODP00000001242  --------------v...............................................................
ENSMODP00000024718  --------------kpg.............................................................
ENSMODP00000026104  --------------flhr............................................................
ENSMODP00000032086  --------------................................................................
ENSMODP00000012383  --------------lslr............................................................
ENSMODP00000012220  --------------htfrvnlftd......................................................
ENSMODP00000020434  --------------ee..............................................................
ENSMODP00000000721  --------------pg..............................................................
ENSMODP00000000674  --------------yae.............................................................
ENSMODP00000024766  --------------................................................................
ENSMODP00000024532  --------------aeg.............................................................
ENSMODP00000014848  --------------................................................................
ENSMODP00000008714  --------------akeeiilfkgkakealekaneansgylklrnkdvtlevlegvmekealkkiiedqqeslnklks
ENSMODP00000013897  --------------l...............................................................
ENSMODP00000008570  --------------gp..............................................................
ENSMODP00000015423  --------------tleys...........................................................
ENSMODP00000012747  --------------................................................................
ENSMODP00000001919  --------------aw..............................................................
ENSMODP00000001944  --------------qnmielsr........................................................
ENSMODP00000006156  --------------v...............................................................
ENSMODP00000004377  --------------hsli............................................................
ENSMODP00000003434  --------------rrgasssrergrspggs...............................................
ENSMODP00000021792  --------------cq..............................................................
ENSMODP00000000011  --------------emdwvlk.........................................................
ENSMODP00000007341  --------------crc.............................................................
ENSMODP00000010183  --------------kk..............................................................
ENSMODP00000028156  --------------s...............................................................
ENSMODP00000015423  --------------dsg.............................................................
ENSMODP00000013069  --------------gt..............................................................
ENSMODP00000038791  --------------lkgedgkalacn....................................................
ENSMODP00000000011  --------------aeypgpynrsgag...................................................
ENSMODP00000002674  --------------eriehkypeicks...................................................
ENSMODP00000039642  --------------ikciwfyky.......................................................
ENSMODP00000036724  --------------grg.............................................................
ENSMODP00000023634  --------------nwqgft..........................................................
ENSMODP00000000087  --------------ykgedg..........................................................
ENSMODP00000007362  --------------ari.............................................................
ENSMODP00000011262  --------------s...............................................................
ENSMODP00000001586  --------------qedp............................................................
ENSMODP00000013441  --------------gvcfdvpaaevksfqdnwqdsrrwqlsva...................................
ENSMODP00000022828  --------------kkllfnnspisvypyy................................................
ENSMODP00000013444  HVCYA---------p...............................................................
ENSMODP00000002674  --------------igegdaefatylvavamskdktnvqhkyvglfl...............................


                        
                        
d1u1qa_               ..
ENSMODP00000007717  ..
ENSMODP00000022014  ..
ENSMODP00000029058  ..
ENSMODP00000027267  ..
ENSMODP00000023398  ..
ENSMODP00000037814  ..
ENSMODP00000021348  ..
ENSMODP00000027586  ..
ENSMODP00000022014  ..
ENSMODP00000029058  ..
ENSMODP00000021348  ..
ENSMODP00000027586  ..
ENSMODP00000037814  ..
ENSMODP00000004837  ..
ENSMODP00000020923  ..
ENSMODP00000007717  ..
ENSMODP00000024842  ..
ENSMODP00000006200  ..
ENSMODP00000036724  ..
ENSMODP00000004717  ..
ENSMODP00000008249  ..
ENSMODP00000027604  ..
ENSMODP00000023901  ..
ENSMODP00000023578  ..
ENSMODP00000007804  ..
ENSMODP00000034649  ..
ENSMODP00000018486  ..
ENSMODP00000006475  ..
ENSMODP00000014208  ..
ENSMODP00000040531  ..
ENSMODP00000010059  ..
ENSMODP00000013841  ..
ENSMODP00000014054  ..
ENSMODP00000009994  ..
ENSMODP00000004654  ..
ENSMODP00000001901  ..
ENSMODP00000038186  ..
ENSMODP00000029243  ..
ENSMODP00000012172  ..
ENSMODP00000019849  ..
ENSMODP00000000959  ..
ENSMODP00000003831  ..
ENSMODP00000016570  ..
ENSMODP00000022371  ..
ENSMODP00000034857  ..
ENSMODP00000034858  ..
ENSMODP00000005475  ..
ENSMODP00000022505  ..
ENSMODP00000003848  ..
ENSMODP00000004397  ..
ENSMODP00000001893  ..
ENSMODP00000017573  ..
ENSMODP00000004247  ..
ENSMODP00000001568  ..
ENSMODP00000012202  ..
ENSMODP00000031808  ..
ENSMODP00000006523  ..
ENSMODP00000019256  ..
ENSMODP00000031416  ..
ENSMODP00000022875  ..
ENSMODP00000025722  ..
ENSMODP00000013678  ..
ENSMODP00000019066  ..
ENSMODP00000014920  ..
ENSMODP00000011039  ..
ENSMODP00000025181  ..
ENSMODP00000006917  ..
ENSMODP00000028798  ..
ENSMODP00000031317  ..
ENSMODP00000001566  ..
ENSMODP00000034177  ..
ENSMODP00000015039  ..
ENSMODP00000023377  ..
ENSMODP00000004837  ..
ENSMODP00000021002  ..
ENSMODP00000027677  ..
ENSMODP00000022505  ..
ENSMODP00000001487  ..
ENSMODP00000038918  ..
ENSMODP00000011435  ..
ENSMODP00000011432  ..
ENSMODP00000006345  ..
ENSMODP00000024718  ..
ENSMODP00000009844  ..
ENSMODP00000003000  ..
ENSMODP00000014933  ..
ENSMODP00000022015  ..
ENSMODP00000015618  ..
ENSMODP00000001920  ..
ENSMODP00000027267  ..
ENSMODP00000026325  ..
ENSMODP00000013647  ..
ENSMODP00000020553  ..
ENSMODP00000003678  ..
ENSMODP00000029789  ..
ENSMODP00000000721  ..
ENSMODP00000006200  ..
ENSMODP00000004743  ..
ENSMODP00000014913  ..
ENSMODP00000038918  ..
ENSMODP00000006371  ..
ENSMODP00000006345  ..
ENSMODP00000015438  ..
ENSMODP00000008450  ..
ENSMODP00000010490  ..
ENSMODP00000007208  ..
ENSMODP00000024712  ..
ENSMODP00000017405  ..
ENSMODP00000001337  ..
ENSMODP00000028798  ..
ENSMODP00000002547  ..
ENSMODP00000005593  ..
ENSMODP00000018401  ..
ENSMODP00000014913  ..
ENSMODP00000016281  ..
ENSMODP00000004397  ..
ENSMODP00000000006  ..
ENSMODP00000020576  ..
ENSMODP00000005194  ..
ENSMODP00000002993  ..
ENSMODP00000015362  ..
ENSMODP00000004717  ..
ENSMODP00000018934  ..
ENSMODP00000027604  ..
ENSMODP00000002993  ..
ENSMODP00000000363  ..
ENSMODP00000014933  ..
ENSMODP00000016940  ..
ENSMODP00000007822  ..
ENSMODP00000002891  ..
ENSMODP00000003337  ..
ENSMODP00000005194  ..
ENSMODP00000008450  ..
ENSMODP00000017452  ..
ENSMODP00000010785  ..
ENSMODP00000010799  ..
ENSMODP00000004654  ..
ENSMODP00000022797  ..
ENSMODP00000016382  ..
ENSMODP00000003786  ..
ENSMODP00000017322  ..
ENSMODP00000020165  ..
ENSMODP00000010787  ..
ENSMODP00000001412  ..
ENSMODP00000015013  ..
ENSMODP00000003000  ..
ENSMODP00000011795  ..
ENSMODP00000022875  ..
ENSMODP00000028798  ..
ENSMODP00000003337  ..
ENSMODP00000018401  ..
ENSMODP00000019828  ..
ENSMODP00000011039  ..
ENSMODP00000010024  ..
ENSMODP00000023575  ..
ENSMODP00000001566  ..
ENSMODP00000031345  ..
ENSMODP00000011039  ..
ENSMODP00000017614  ..
ENSMODP00000011435  ..
ENSMODP00000011432  ..
ENSMODP00000035735  ..
ENSMODP00000001944  ..
ENSMODP00000036858  ..
ENSMODP00000005193  ..
ENSMODP00000028751  ..
ENSMODP00000039173  ..
ENSMODP00000006815  ..
ENSMODP00000020576  ..
ENSMODP00000025722  ..
ENSMODP00000002300  ..
ENSMODP00000003786  ..
ENSMODP00000023826  ..
ENSMODP00000033056  ..
ENSMODP00000009807  ..
ENSMODP00000018415  ..
ENSMODP00000000175  ..
ENSMODP00000039175  ..
ENSMODP00000036858  ..
ENSMODP00000008249  ..
ENSMODP00000032411  ..
ENSMODP00000001944  ..
ENSMODP00000009227  ..
ENSMODP00000007480  ..
ENSMODP00000011795  ..
ENSMODP00000002604  ..
ENSMODP00000021564  ..
ENSMODP00000036078  ..
ENSMODP00000010024  ..
ENSMODP00000013583  ..
ENSMODP00000013581  ..
ENSMODP00000001370  ..
ENSMODP00000010502  ..
ENSMODP00000018934  ..
ENSMODP00000031808  ..
ENSMODP00000013458  ..
ENSMODP00000004397  ..
ENSMODP00000002817  ..
ENSMODP00000024842  ..
ENSMODP00000021564  ..
ENSMODP00000035400  ..
ENSMODP00000003000  ..
ENSMODP00000007934  ..
ENSMODP00000001484  ..
ENSMODP00000008195  ..
ENSMODP00000001568  ..
ENSMODP00000010946  ..
ENSMODP00000003430  ..
ENSMODP00000007024  ..
ENSMODP00000011964  ..
ENSMODP00000024532  ..
ENSMODP00000004397  ..
ENSMODP00000032411  ..
ENSMODP00000010717  ..
ENSMODP00000008758  ..
ENSMODP00000021972  ..
ENSMODP00000035735  ..
ENSMODP00000018834  ..
ENSMODP00000020165  ..
ENSMODP00000031345  ..
ENSMODP00000023979  ..
ENSMODP00000015407  ..
ENSMODP00000014946  ..
ENSMODP00000003584  ..
ENSMODP00000007822  ..
ENSMODP00000002891  ..
ENSMODP00000016781  ..
ENSMODP00000009227  ..
ENSMODP00000018934  ..
ENSMODP00000011795  ..
ENSMODP00000029701  ..
ENSMODP00000011218  ..
ENSMODP00000007822  ..
ENSMODP00000001901  ..
ENSMODP00000005193  ..
ENSMODP00000013253  ..
ENSMODP00000001062  ..
ENSMODP00000006815  ..
ENSMODP00000012172  ..
ENSMODP00000005193  ..
ENSMODP00000000232  ..
ENSMODP00000034177  ..
ENSMODP00000006415  ..
ENSMODP00000035735  ..
ENSMODP00000023866  ..
ENSMODP00000026309  ..
ENSMODP00000041019  ..
ENSMODP00000001219  ..
ENSMODP00000006815  ..
ENSMODP00000010225  ..
ENSMODP00000017514  ..
ENSMODP00000039002  ..
ENSMODP00000009010  ..
ENSMODP00000020576  ..
ENSMODP00000036858  ..
ENSMODP00000029254  ..
ENSMODP00000017614  ..
ENSMODP00000018402  ..
ENSMODP00000016781  ..
ENSMODP00000013040  ..
ENSMODP00000002441  ..
ENSMODP00000009010  ..
ENSMODP00000023826  ..
ENSMODP00000004397  ..
ENSMODP00000008593  ..
ENSMODP00000014946  ..
ENSMODP00000020165  ..
ENSMODP00000019256  ..
ENSMODP00000001487  ..
ENSMODP00000023578  ..
ENSMODP00000018618  ..
ENSMODP00000001944  ..
ENSMODP00000024562  ..
ENSMODP00000010717  ..
ENSMODP00000033971  ..
ENSMODP00000010437  ..
ENSMODP00000017391  ..
ENSMODP00000016781  ..
ENSMODP00000031445  ..
ENSMODP00000017592  ..
ENSMODP00000003000  ..
ENSMODP00000021460  ..
ENSMODP00000030260  ..
ENSMODP00000010225  ..
ENSMODP00000005193  ..
ENSMODP00000006917  ..
ENSMODP00000023718  ..
ENSMODP00000006381  ..
ENSMODP00000013139  ..
ENSMODP00000011106  ..
ENSMODP00000011084  ..
ENSMODP00000033409  ..
ENSMODP00000007822  ..
ENSMODP00000000011  ..
ENSMODP00000019244  ..
ENSMODP00000013327  ..
ENSMODP00000009227  ..
ENSMODP00000020775  ..
ENSMODP00000008836  ..
ENSMODP00000018496  ..
ENSMODP00000012937  ..
ENSMODP00000024766  ..
ENSMODP00000006381  ..
ENSMODP00000010717  ..
ENSMODP00000009664  ..
ENSMODP00000010490  ..
ENSMODP00000024054  ..
ENSMODP00000002114  ..
ENSMODP00000028156  ..
ENSMODP00000003584  ..
ENSMODP00000036903  ..
ENSMODP00000003337  ..
ENSMODP00000014333  ..
ENSMODP00000008714  ..
ENSMODP00000013327  ..
ENSMODP00000006050  ..
ENSMODP00000013604  ..
ENSMODP00000000664  ..
ENSMODP00000012747  ..
ENSMODP00000026351  ..
ENSMODP00000018934  ..
ENSMODP00000015407  ..
ENSMODP00000009575  ..
ENSMODP00000005447  ..
ENSMODP00000005596  ..
ENSMODP00000007024  ..
ENSMODP00000024054  ..
ENSMODP00000001919  ..
ENSMODP00000011172  ..
ENSMODP00000006381  ..
ENSMODP00000009227  ..
ENSMODP00000001242  ..
ENSMODP00000024718  ..
ENSMODP00000026104  ..
ENSMODP00000032086  ..
ENSMODP00000012383  ..
ENSMODP00000012220  ..
ENSMODP00000020434  ..
ENSMODP00000000721  ..
ENSMODP00000000674  ..
ENSMODP00000024766  ..
ENSMODP00000024532  ..
ENSMODP00000014848  ..
ENSMODP00000008714  kg
ENSMODP00000013897  ..
ENSMODP00000008570  ..
ENSMODP00000015423  ..
ENSMODP00000012747  ..
ENSMODP00000001919  ..
ENSMODP00000001944  ..
ENSMODP00000006156  ..
ENSMODP00000004377  ..
ENSMODP00000003434  ..
ENSMODP00000021792  ..
ENSMODP00000000011  ..
ENSMODP00000007341  ..
ENSMODP00000010183  ..
ENSMODP00000028156  ..
ENSMODP00000015423  ..
ENSMODP00000013069  ..
ENSMODP00000038791  ..
ENSMODP00000000011  ..
ENSMODP00000002674  ..
ENSMODP00000039642  ..
ENSMODP00000036724  ..
ENSMODP00000023634  ..
ENSMODP00000000087  ..
ENSMODP00000007362  ..
ENSMODP00000011262  ..
ENSMODP00000001586  ..
ENSMODP00000013441  ..
ENSMODP00000022828  ..
ENSMODP00000013444  ..
ENSMODP00000002674  ..


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0049769 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella denticola F0289
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter heparinus DSM 2366
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Desulfurispirillum indicum S5
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Candidatus Nitrospira defluvii
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Dechlorosoma suillum PS
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Methylibium petroleiphilum PM1
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phymatum STM815
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus metallidurans CH34
NoYes   Burkholderia sp. RPE64
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Saccharophagus degradans 2-40
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes