SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

RNA bacteriophage capsid protein alignments

These alignments are sequences aligned to the 0036638 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                         10        20        30     
                                                                          |         |         |     
d1dwna_ .........................................................SKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLV
d1frsa_ .........................asnfeefvlvdnggtgdvkvapsnfangvaew-----------------------------------
d1qbea_ akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsr-----------------------------------

           40        50        60        70        80        90       100       110       120       
            |         |         |         |         |         |         |         |         |       
d1frsa_ --------ISSNSRSQAYKVTCSVRQSSANNRKYTVKVEVPKVATQ----------------------------------------------
d1qbea_ -------------NRKNYKVQVKIQNPTACTANGSCDPSVTRQ-------------------------------------------------

d1dwna_ ...........................................................
d1frsa_ vqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaansgiy
d1qbea_ ayadvtfsftqystdeerafvrtelaallaspllidaidqlnpay..............

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0036638 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]