SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

SH2 domain alignments in Mus musculus 69_38

These alignments are sequences aligned to the 0037781 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                10             20   
                                                                                 |              |   
d1fu6a_               ................................................gm--NNNMSLQDAEWYWGDI.....SREEV
ENSMUSP00000041902  .................................................t----------HPGYMAFL.....TYDEV
ENSMUSP00000110115  .................................................t----------HPGYMAFL.....TYDEV
ENSMUSP00000039955  .................................................n----------HPGYMAFL.....TYDEV
ENSMUSP00000066743  ................................................ll------CLWNDGCIMGFI.....SKERE
ENSMUSP00000027277  .................................................i-----LPLWIDGYIMGFV.....SKEKE
ENSMUSP00000099403  ................................................il------ALWNEGYIMGFI.....SKERE
ENSMUSP00000114188  ................................................iq---------AEEWYFGKL.....GRKDA
ENSMUSP00000019913  .................................................l--------QAEPWFFGAI.....KRADA
ENSMUSP00000072154  ................................................iq---------AEEWYFGKM.....GRKDA
ENSMUSP00000030693  ...............................wwearslssghrgyvpsny-VAPVDSIQAEEWYFGKI.....SRKDA
ENSMUSP00000082855  .................................................l-----KDLWKDGRIMGFV.....SRNQE
ENSMUSP00000119263  .................................................l--------EPEPWFFKNL.....SRKDA
ENSMUSP00000090237  ................................................iq---------AEEWYFGKI.....TRRES
ENSMUSP00000014597  .................................................l--------EVEKWFFRTI.....SRKDA
ENSMUSP00000038838  .................................................l--------ETEEWFFKDI.....TRKDA
ENSMUSP00000003370  .................................................l--------ETEEWFFKGI.....SRKDA
ENSMUSP00000028190  .................................................l--------EKHSWYHGPV.....SRNAA
ENSMUSP00000027888  .................................................l--------EKHSWYHGPV.....SRSAA
ENSMUSP00000016498  .................................................s---------DQPWYFSGI.....SRAQA
ENSMUSP00000089708  .................................................l-----RSYWSDRLIIGFI.....SKQYV
ENSMUSP00000034863  ................................................ls---------LMPWFHGKI.....TREQA
ENSMUSP00000004143  .................................................l-----KPHWNDGAILGFV.....NKQQA
ENSMUSP00000016511  .................................................e---------SEPWFFGCI.....SRSEA
ENSMUSP00000109234  ...........................hwwkardrfgneglipsnyvten---RLANLEIYEWYHKNI.....TRNQT
ENSMUSP00000129397  ...........................hwwkardrfgneglipsnyvten---RLANLEIYEWYHKNI.....TRNQT
ENSMUSP00000107882  .................................................l--------HAYDWFAGNI.....SRSQS
ENSMUSP00000029164  ..................................................----------HGWLYEGL.....SREKA
ENSMUSP00000033617  ..............................wwrardkngqegyipsnyit--EAEDSIEMYEWYSKHM.....TRSQA
ENSMUSP00000117204  .................................................p-------HWNDGAILGFV.....NKQQA
ENSMUSP00000028252  .............................................ssavn----MALHRSQPWFHHRI.....SRDEA
ENSMUSP00000119926  ........................................csgsslsaai-------HRTQPWFHGRI.....SREES
ENSMUSP00000034296  ................................................lp------HHEERTWYVGKI.....NRTQA
ENSMUSP00000004959  ..............................nmeddqnwykaelrgaegfv-PKNYIRVKPHPWYSGRI.....SRQLA
ENSMUSP00000102099  ................................................nl-----PHYDEKTWFVEDI.....NRVQA
ENSMUSP00000060828  ...................................iisqkpqlekliatt------AHEKMPWFHGNI.....SRDES
ENSMUSP00000113221  ................................................ls---------LMPWFHGKI.....SGQEA
ENSMUSP00000098864  .................................................l--------ETYEWYNKSI.....SRDKA
ENSMUSP00000021090  ................................................mk---------PHPWFFGKI.....PRAKA
ENSMUSP00000060828  ................................................hl-----------TYFFGNI.....TREEA
ENSMUSP00000127901  ..................................................----------HGWLFEGL.....GRDKA
ENSMUSP00000091011  .........................................lhpstlnav------IHRTQHWFHGRI.....SREES
ENSMUSP00000098333  ..................................................-----------RWFHGHL.....SGKEA
ENSMUSP00000102099  .................................................k--DSFISLQDAEWYWGDI.....SREEV
ENSMUSP00000079991  ....................................hlrcaefelrltdp-VPNPNPHESKPWYYDSL.....SRGEA
ENSMUSP00000000129  ...............................................vge-----RPLAEHDWYHGAI.....PRIEA
ENSMUSP00000099404  ...................................plrcnefemrlsepv--PQTNAHESKEWYHASL.....TRAQA
ENSMUSP00000047004  ................................................dl-----PHHDEKTWNVGSS.....NRNKA
ENSMUSP00000027291  ....................................isqapqvekliatt------AHERMPWYHSSL.....TREEA
ENSMUSP00000047004  .............................qpapalppkppkpttvannsm--NNNMSLQDAEWYWGDI.....SREEV
ENSMUSP00000034296  .................................................p------SLQDAEWYWGDI.....SREEV
ENSMUSP00000098333  ................................................sr-----------RWFHPNI.....TGVEA
ENSMUSP00000027291  .................................................h----------LPFFYGSI.....SRAEA
ENSMUSP00000071836  ..........................hwwrardkygsegyipsnyvtgkk----SNNLDQYEWYCRNT.....NRSKA
ENSMUSP00000046532  .................................................n----FIDIEFPEWFHEGL.....SRHQA
ENSMUSP00000108103  .................................................r-----------GWFHRDL.....SGPDA
ENSMUSP00000020564  ..................................ledqwpspptrrapia--PTEEQLRQEPWYHGRM.....SRRAA
ENSMUSP00000006293  .................................................s-----------AWYMGPV.....TRQEA
ENSMUSP00000137069  .................................................d----------LPYYHGCL.....TKREC
ENSMUSP00000047656  ................................rtpcstkepwrpqpaerv--DTALALEKQPWFHGPL.....SRAEA
ENSMUSP00000125121  .................................................d----------LPYYHGCL.....TKREC
ENSMUSP00000060433  .................................kpikhgspefcgilger-VDPTIPLEKQIWYHGAI.....SRSDA
ENSMUSP00000119293  ........................................ppppqsmsma-----EQLQGEPWFHGKL.....SRREA
ENSMUSP00000021898  ...................................ecispvtprapdarm----LEELNAEPWYQGEM.....SRKEA
ENSMUSP00000108495  ....................................pqcdyirpsltgkf--------AGNPWYYGKV.....TRHQA
ENSMUSP00000036270  ................................................ys---------CQPWYAGPM.....ERLQA
ENSMUSP00000079733  ......................................sippplqlvpev----QKPLYEQLWYHGAI.....PRAEV
ENSMUSP00000072763  ..................................................-----------GWNHGNI.....TRSKA
ENSMUSP00000005839  ...............................................avt------------VYHGKI.....SRETG
ENSMUSP00000106160  ....................................plgmepssplgewt--DPALPLENQVWYHGAI.....SRTDA
ENSMUSP00000105179  .................................................d------PHEGKIWFHGKI.....SKQEA
ENSMUSP00000070301  ...............pvwksylyqlqqeaphprrvtctcevenrpkyygr------------EYHGMI.....SREET
ENSMUSP00000035908  ..............piwksylyqlqqeaprpkriicprevenrpkyygre-------------FHGII.....SREQA
ENSMUSP00000099404  .................................................h--------SSEKWFHGKLgagrdGRHIA
ENSMUSP00000064929  .................................................e---ELKKLAKQGWYWGPI.....TRWEA
ENSMUSP00000029806  .................................................q---------DLGWYHGNL.....TRHAA
ENSMUSP00000083611  pewwkcknargqvglvpknyvvvlsdgpalhpahtpqisytgpsasgrfa---------GREWYYGNV.....TRHQA
ENSMUSP00000105179  ....................................eeeevaipltappt----------NQWYHGKL.....DRTIA
ENSMUSP00000048057  .................................................a------------WYHRDL.....SRAAA
ENSMUSP00000071970  .................................................p-----------EWFHGTI.....SREAA
ENSMUSP00000017920  ................................................rs-----------SWYWGRL.....SRQEA
ENSMUSP00000079991  ..........................................eepvqdtp---PTELHFGEKWFHKKVe....SRTSA
ENSMUSP00000038591  .................................................v--PDLLQITGNPCYWGVM.....DRYEA
ENSMUSP00000064708  ......................plsrevivrwfkeeqlprragferntks---------IAPWFHGII.....SRESA
ENSMUSP00000059658  ............................phhwqktlkptlsdhgdgekvd---PGLALEKQPWYHGSI.....SRAEA
ENSMUSP00000108103  .........................................tiihlkypl---NCSDPTSERWYHGHI.....SGGQA
ENSMUSP00000108491  ........................wwegrntatnevgwfpcnrvhpyvhg---PPQDLSVHLWYAGPM.....ERAGA
ENSMUSP00000052625  ................................................ak---ALRELSQTGWYWGSM.....TVNEA
ENSMUSP00000103207  ................................................pl------------WFHGFI.....TRREA
ENSMUSP00000032978  .................................................g----------YPWFHGML.....SRLKA
ENSMUSP00000066031  .................................................v--PDLLQISNNPCYWGVM.....DKYAA
ENSMUSP00000029766  ..........................................eeelllss-----EDLRSHAWYHGRI.....PRQVS
ENSMUSP00000020215  ..................................................------------WYWGSM.....TVNEA
ENSMUSP00000043146  .............................................lphir-----QQLWDEECFHGKL.....SRGAA
ENSMUSP00000040896  ................................................as----LRELEKCGWYWGPM.....NWEDA
ENSMUSP00000082183  ................................................ak---TFSYLRESGWYWGSI.....TASEA
ENSMUSP00000062782  .................................................y--------TAYPWFAGNM.....ERQQT
ENSMUSP00000113808  ................................................hf-------LSCYPWFHGPI.....SRVRA
ENSMUSP00000073866  ...........................................eelklss-----TDLRSHAWYHGRI.....PREVS
ENSMUSP00000070825  .............................irwfkeeqlpfragyqknsdt---------IAPWFHGIL.....TLKKA
ENSMUSP00000129146  ..............................................vqdt---------SKFWYKPHL.....SRDQA
ENSMUSP00000038121  ..............................................rtsa------LLDACGFYWGPL.....SVHGA
ENSMUSP00000020695  ...........................................ivkfvqd--------TSKFWYKADI.....SREQA
ENSMUSP00000059129  ...............................................qlv-VNAVRKLQESGFYWSAV.....TGGEA
ENSMUSP00000005188  .................................................d----------YPWFHGTL.....SRVKA
ENSMUSP00000128473  ..................................mlpyentnsekpdptk--PDEKDVWQNEWYIGEY.....SRQAV
ENSMUSP00000132779  ..................................mlpyentnsekpdptk--PDEKDVWQNEWYIGEY.....SRQAV
ENSMUSP00000056621  .......................................vpnrpqppspg---EEETPLDEEWYVSYI.....TRPEA
ENSMUSP00000127715  ..........................pdfskysmpdnspetrakvkfvqd--------TSKYWYKPEI.....SREQA
ENSMUSP00000112473  .....................................gpfhsfpfnstfa--DQEAELLGKPWYAGAC.....DRKSA
ENSMUSP00000017751  ......................................kdmqptmkfvmd--------TSKYWFKPSI.....TREQA
ENSMUSP00000087117  ................................rlsassiapalsssvaen-----GSLLGQPWYSGNC.....DRQSV
ENSMUSP00000025705  ..............................................ihsn-------------CHGPI.....SMDFA
ENSMUSP00000105632  ..............................................thpi------------WLQLSL.....SEEEA
ENSMUSP00000099842  ........................................hylctdvapp----LIVHNIQNGCHGPI.....CTEYA
ENSMUSP00000101449  ................................fpaaweawprgpggpscl-VENEGSLTENIWAFAGL.....SRSCA
ENSMUSP00000060073  ...............................................ael-------------CHGPI.....TLDFA
ENSMUSP00000038130  ..............................................rraa---------EVPWCFLQV.....SRLEA
ENSMUSP00000123177  ...................ekvplpnsvfvnttesceverlfkatdprge------------------.....-----
ENSMUSP00000025818  ....................................erllitrpvwlqlr-----------------A.....NAAAA
ENSMUSP00000031171  ..........................................dvlnplpe-------------CFYAV.....SRKEA
ENSMUSP00000060771  ..........................................tcpvwlql----------------GL.....GQAEA
ENSMUSP00000002121  ........................................ikrviahpsf---------------HNI.....NFKQA
ENSMUSP00000001036  ................................qngihgplmdpfvqaklw------------------.....-----
ENSMUSP00000058447  ................................................we--------------VPEL.....DAQYA


                           30              40         50                              60            
                            |               |          |                               |            
d1fu6a_               NEKLRDTA......DGTFLVRDASTKM.HGDYTLTLRK..................GGN....NKSIKIFHR......
ENSMUSP00000041902  KARLQKFIhk....PGSYIFRLSCTR-.LGQWAIGYVT..................ADG....NILQTIPHN......
ENSMUSP00000110115  KARLQKYStk....PGSYIFRLSCTR-.LGQWAIGYVT..................GDG....NILQTIPHN......
ENSMUSP00000039955  QTRLQAYRdk....PGSYIFRPSCTR-.LGQWAIGYVS..................SDG....SI-------......
ENSMUSP00000066743  RALLKDQQ......PGTFLLRFSESSR.EGAITFTWVErsqn..............GGE....PDF---HAV......
ENSMUSP00000027277  RLLLKDKM......PGTFLLRFSESH-.LGGITFTWVD..................QSE....NGEVRFHSV......
ENSMUSP00000099403  RAILSTKP......PGTFLLRFSESSK.EGGVTFTWVE..................KDI....SGKTQIQSV......
ENSMUSP00000114188  ERQLLSFGnp....RGTFLIRESETT-.KGAYSLSIRDwddmk.............GDH....VKHYKIRKL......
ENSMUSP00000019913  EKQLLYSEnq....TGAFLIRESESQ-.KGDFSLSVLD..................EGV....VKHYRIRRL......
ENSMUSP00000072154  ERLLLNPGnq....RGIFLVRESETT-.KGAYSLSIRDwdevr.............GDN....VKHYKIRKL......
ENSMUSP00000030693  ERQLLSSGnp....QGAFLIRESETT-.KGAYSLSIRDwdqnr.............GDH....IKHYKIRKL......
ENSMUSP00000082855  RRLLKKML......SGTFLLRFSETS-.EGGITCSWVE..................HQD....DDKVEIYSV......
ENSMUSP00000119263  ERQLLAPGnt....HGSFLIRESEST-.AGSFSLSVRDfdqnq.............GEV....VKHYKIRNL......
ENSMUSP00000090237  ERLLLNAEnp....RGTFLVRESETT-.KGAYCLSVSDfdnak.............GLN....VKHYKIRKL......
ENSMUSP00000014597  ERQLLAPMnk....AGSFLIRESESN-.KGAFSLSVKDittq..............GEV....VKHYKIRSL......
ENSMUSP00000038838  ERQLLAPGns....AGAFLIRESETL-.KGSFSLSVRDydpmh.............GDV....IKHYKIRSL......
ENSMUSP00000003370  ERHLLAPGnm....LGSFMIRDSETT-.KGSYSLSVRDfdpqh.............GDT....VKHYKIRTL......
ENSMUSP00000028190  EYLLSSGI......NGSFLVRESESS-.PGQRSISLRY..................EGR....VYHYRINTA......
ENSMUSP00000027888  EYLLSSLI......NGSFLVRESESS-.PGQLSISLRY..................EGR....VYHYRINTT......
ENSMUSP00000016498  QQLLLSPAna....PGAFLIRPSESS-.IGGYSLSVRA..................QAK....VCHYRICMA......
ENSMUSP00000089708  TSLLLNEP......DGTFLLRFSDSE-.IGGITIAHVI..................RGQ....DGSSQIENI......
ENSMUSP00000034863  ERLLYPPE......TGLFLVRESTNY-.PGDYTLCVSC..................EGK....VEHYRIMYH......
ENSMUSP00000004143  HDLLINKP......DGTFLLRFSDSE-.IGGITIAWKF..................DSQ....ER-------......
ENSMUSP00000016511  MHRLQAEDns....KGAFLIRVSQKP-.GADYVLSVRD..................AQA....VRHYRIWKN......
ENSMUSP00000109234  ERLLRQEAk.....EGAFIVRDSRH--.LGSYTISVFTrarrht............QSS....IKHYQIKKN......
ENSMUSP00000129397  ERLLRQEAk.....EGAFIVRDSRH--.LGSYTISVFTrarrht............QSS....IKHYQIKKN......
ENSMUSP00000107882  EQLLRQKGk.....EGAFMVRNSSQ--.MGMYTVSLFSkavndk............KGT....VKHYHVHTN......
ENSMUSP00000029164  EELLLLPGnp....GGAFLIRESQTR-.RGCYSLSVRLsrpas.............WDR....IRHYRIQRL......
ENSMUSP00000033617  EQLLKQEGk.....EGGFIVRDSSK--.AGKYTVSVFAkstgep............QGV....IRHYVVCST......
ENSMUSP00000117204  HDLLINKP......DGTFLLRFSDSE-.IGGITIAWKF..................DSP....DRNL-----......
ENSMUSP00000028252  QRLIIRQGpv....DGVFLVRDSQSN-.PRTFVLSMSH..................GQK....IKHYQIIPV......
ENSMUSP00000119926  QRLIGQQGlv....DGVFLVRESQRN-.PQGFVLSLCH..................LQK....VKHYLILPS......
ENSMUSP00000034296  EEMLSGKR......DGTFLIRESSQ--.RGCYACSVVV..................DGD....TKHCVIYRT......
ENSMUSP00000004959  EETLMKRNh.....LGAFLIRESESS-.PGEFSVSVNY..................GDQ....VQHFKVLRE......
ENSMUSP00000102099  EDLLYGKP......DGAFLIRESSK--.KGCYACSVVA..................DGE....VKHCVIYST......
ENSMUSP00000060828  EQTVLIGSkt....NGKFLIRARDN--.SGSYALCLLH..................EGK....VLHYRIDRD......
ENSMUSP00000113221  IQQLQPPE......DGLFLVRESARH-.PGDYVLCVSF..................GRD....VIHYRVLHR......
ENSMUSP00000098864  EKLLLDTGk.....EGAFMVRDSRT--.PGTYTVSVFTkaiise............NPC....IKHYHIKET......
ENSMUSP00000021090  EEMLSKQRh.....DGAFLIRESESA-.PGDFSLSVKF..................GND....VQHFKVLRD......
ENSMUSP00000060828  EDYLVQGGmt....DGLYLLRQSRNY-.LGGFALSVAH..................NRK....AHHYTIEREl.....
ENSMUSP00000127901  EELLQLPDtk....IGSFMIRESETK-.KGFYSLSVRH..................RQ-....VKHYRIFRL......
ENSMUSP00000091011  HRIIKQQGlv....DGLFLLRDSQSN-.PKAFVLTLCH..................HQK....IKNFQILPC......
ENSMUSP00000098333  EKLLTEKGk.....HGSFLVRESQSH-.PGDFVLSVRTgddkgesndg........KSK....VTHVMIRCQ......
ENSMUSP00000102099  NDKLRDMP......DGTFLVRDASTKM.QGDYTLTLRK..................GGN....NKLIKIYHR......
ENSMUSP00000079991  EDMLMRIPr.....DGAFLIRKREG--.TNSYAITFRA..................RGK....VKHCRINRD......
ENSMUSP00000000129  QELLKQ--......QGDFLVRESHGK-.PGEYVLSVYS..................DGQ....RRHFIIQFV......
ENSMUSP00000099404  EHMLMRVPr.....DGAFLVRKRNE--.PNSYAISFRA..................EGK....IKHCRVQQ-......
ENSMUSP00000047004  ENLLRGKR......DGTFLVRESSK--.QGCYACSVVV..................DGE....VKHCVINKT......
ENSMUSP00000027291  ERKLYSGQqt....DGKFLLRPRKE--.QGTYALSLVY..................GKT....VYHYLISQD......
ENSMUSP00000047004  NEKLRDTA......DGTFLVRDASTKM.HGDYTLTLRK..................GGN....NKLIKIFHR......
ENSMUSP00000034296  NERLRDTP......DGTFLVRDASSKI.QGEYTLTLRK..................GGN....NKLIKVFHR......
ENSMUSP00000098333  ENLLLTRGv.....DGSFLARPSKSN-.PGDFTLSVRR..................NGA....VTHIKIQNT......
ENSMUSP00000027291  EEHLKLAGma....DGLFLLRQCLRS-.LGGYVLSLVH..................DVR....FHHFPIERQl.....
ENSMUSP00000071836  EQLLRTEDk.....EGGFMVRDSSQ--.PGLYTVSLYTkfggeg............SSG....FRHYHIKET......
ENSMUSP00000046532  ENLLMGKD......IGFFIIRASQSS-.PGDFSISVRH..................EDD....VQHFKVMRD......
ENSMUSP00000108103  ETLLKGRGv.....PGSFLARPSRKN-.QGDFSLSVRV..................DDQ....VTHIRIQNS......
ENSMUSP00000020564  EKLLRA--......DGDFLVRDSVTN-.PGQYVLTGMH..................AGQ....PKHLLLV-D......
ENSMUSP00000006293  QTRLQGQR......HGMFLVRDSSTC-.PGDYVLSVSE..................NSR....VSHYIINSL......
ENSMUSP00000137069  EALLLKGGv.....DGNFLIRDSESV-.PGALCLCVSF..................KKL....VYSYRIFRE......
ENSMUSP00000047656  ENLLSLCK......EGSYLVRLSETR-.AQDCILSLRS..................NQG....SMHLKFART......
ENSMUSP00000125121  EALLLKGGv.....DGNFLIRDSESV-.PGALCLCVSF..................KKL....VYNYRIFRE......
ENSMUSP00000060433  ENLLRLCK......ECSYLVRNSQTS-.KHDYSLSLKS..................NQG....FMHMKLAKT......
ENSMUSP00000119293  EALLQL--......NGDFLVRESTTT-.PGQYVLTGLQ..................SGQ....PKHLLLV-D......
ENSMUSP00000021898  EALLRE--......DGDFLVRKSTTN-.PGSFVLTGMH..................NGQ....AKHLLLV-D......
ENSMUSP00000108495  EMALNERGh.....EGDFLIRDSESS-.PNDFSVSLKA..................QGK....NKHFKVQLK......
ENSMUSP00000036270  ETELINRV......NSTYLVRHRTKE-.SGEYAISIKY..................NNE....AKHIKILTR......
ENSMUSP00000079733  AELLTH--......SGDFLVRESQG--.KQEYVLSVMW..................DGQ....PRHFIIQSS......
ENSMUSP00000072763  EELLSRAGk.....DGSFLVRASESI-.PRAYALCVLF..................RNC....VYTYRILPN......
ENSMUSP00000005839  EKLLLATGl.....DGSYLLRDSESV-.PGVYCLCVLY..................QGY....IYTYRVSQT......
ENSMUSP00000106160  ENLLRLCK......EASYLVRNSETS-.KNDFSLSLKS..................SQG....FMHMKLSRT......
ENSMUSP00000105179  YNLLMTVGq.....VCSFLVRPSDNT-.PGDYSLYFRT..................NEN....IQRFKICPT......
ENSMUSP00000070301  DQLLS-VA......EGSYLIRESQRQ-.PGTYTLALRF..................GSQ....TRNFRLYYD......
ENSMUSP00000035908  DELLGG-V......EGAYILRESQRQ-.PGCYTLALRF..................GNQ....TLNYRLFHD......
ENSMUSP00000099404  ERLLTEYCietgapDGSFLVRESETF-.VGDYTLSFWR..................NGK....VQHCRIHSR......
ENSMUSP00000064929  EGKLANVP......DGSFLVRDSSDD-.RYLLSLSFRS..................HGK....TLHTRIEHS......
ENSMUSP00000029806  EALLLSNGr.....DGSYLLRDSNEQ-.TGLYSLSVRA..................KDS....VKHFHVEYT......
ENSMUSP00000083611  ECALNERGv.....EGDFLIRDSESS-.PSDFSVSLKA..................SGR....NKHFKVQLV......
ENSMUSP00000105179  EERLRQAGk.....SGSYLIRESDRR-.PGSFVLSFLSq.................TNV....VNHFRIIAM......
ENSMUSP00000048057  EELLARAGr.....DGSFLVRDSESV-.AGAFALCVLY..................QKH....VHTYRILPD......
ENSMUSP00000071970  ENMLESQP......LGTFLIRVSHS--.HVGYTLSYKA..................QTC....CRHFMVKLS......
ENSMUSP00000017920  VALLQGQR......HGVFLVRDSSTS-.PGDYVLSVSE..................NSR....VSHYIINSSgprppv
ENSMUSP00000079991  EKLLQEYCaetgakDGTFLVRESETF-.PNDYTLSFWR..................SGR....VQHCRIRSTme....
ENSMUSP00000038591  EALLEGKP......EGTFLLRDSAQE-.DYLFSVSFRR..................YNR....SLHARIEQW......
ENSMUSP00000064708  EDLLENMT......EGAFLVRVSEK--.IWGYTLSYRL..................QRG....FKHFLVDAS......
ENSMUSP00000059658  ESRLQPCK......EAAYLVRNSESG-.NSKYSIALKT..................SQG....CVHIIVAQT......
ENSMUSP00000108103  ESLLQAKGe.....PWTFLVRESLSQ-.PGDFVLSVLNdqpkagpgs.........PLR....VTHIKVMCE......
ENSMUSP00000108491  EGILTNRS......DGTYLVRQRVKD-.TAEFAISIKY..................NVE....VKHIKIMTS......
ENSMUSP00000052625  KEKLKEAP......EGTFLIRDSSHS-.DYLLTIFVKT..................SAG....PTNLRIEYQ......
ENSMUSP00000103207  ERLLQPQP......LGCYLVRFSES--.AVTFVLSYRS..................QTC....CRHFLLAQL......
ENSMUSP00000032978  AQLVLEGGtgs...HGVFLVRQSETR-.RGEYVLTFNF..................QGK....AKHLRLSLN......
ENSMUSP00000066031  EALLEGKP......EGTFLLRDSAQE-.DYLFSVSFRR..................YSR....SLHARIEQW......
ENSMUSP00000029766  ENLVQR--......DGDFLVRDSLSS-.PGNFVLTCQW..................KNL....AQHFKINRTvlrlse
ENSMUSP00000020215  KEKLKEAP......EGTFLIRDSSHS-.DYLLTISVKT..................SAG....PTNLRIEYQ......
ENSMUSP00000043146  EKLLVK--......DGDFLVRESVTS-.PGQFVLSGLQ..................GGQ....AKHLLLV-D......
ENSMUSP00000040896  EMKLKGKP......DGSFLVRDSSDP-.RYILSLSFRS..................QGI....THHTRMEHY......
ENSMUSP00000082183  RQHLQKMP......EGTFLVRDSTHP-.SYLFTLSVKT..................TRG....PTNVRIEYA......
ENSMUSP00000062782  DNLLKSHA......SGTYLIRERPAE-.AERFAISIKF..................NDE....VKHIKVVEK......
ENSMUSP00000113808  AQLVQLQGpda...HGVFLVRQSESR-.RGEYVLTFNL..................QGR....AKHLRLVLT......
ENSMUSP00000073866  ETLVQR--......NGDFLIRDSLTS-.LGDYVLTCRW..................HNQ....ALHFKINKVvvkage
ENSMUSP00000070825  NELLSTGV......PGSFLIRVSEK--.IKGYALSYLS..................EEG....CKHFLIDAS......
ENSMUSP00000129146  IALLKDKD......PGAFLIRDSHSF-.QGAYGLALKVatpppsaqpwkgdps...EQL....VRHFLIETG......
ENSMUSP00000038121  HERLRAEP......VGTFLVRDSRQR-.NCFFALSVKM..................ASG....PTSIRVHFQ......
ENSMUSP00000020695  IAMLKDKA......PGSFIVRDSHSF-.RGAYGLAMKVatpppsvlhlnkkagdlsNEL....VRHFLIECT......
ENSMUSP00000059129  NLLLSAEP......AGTFLIRDSSDQ-.RHFFTLSVKT..................QSG....TKNLRIQCE......
ENSMUSP00000005188  AQLVLAGGprs...HGLFVIRQSETR-.PGECVLTFNF..................QGK....AKHLRLSLN......
ENSMUSP00000128473  EDVLMKENk.....DGTFLVRDCSTKSkAEPYVLVVFY..................GNK....VYNVKIRFL......
ENSMUSP00000132779  EDVLMKENk.....DGTFLVRDCSTKSkAEPYVLVVFY..................GNK....VYNVKIRFL......
ENSMUSP00000056621  EAALRKINq.....DGTFLVRDSSKKTaNNPYVLMVLY..................KDK....VYNIQIRYQ......
ENSMUSP00000127715  IALLKDQE......PGAFIIRDSHSF-.RGAYGLAMKVssppptitqqgkkgdmt.HEL....VRHFLIETG......
ENSMUSP00000112473  EEALHRSNk.....DGSFLIRKSSGHDsKQPYTLVAFF..................NKR....VYNIPVRFI......
ENSMUSP00000017751  INLLRTEK......PGAFVIRDSSSY-.RGSFGLALKVqetsasapnrpgeds...SDL....IRHFLIESS......
ENSMUSP00000087117  ERALLHFQk.....DGAYTVRLSSGPHsSQPFTLAVLL..................RGR....VFNIPIRQL......
ENSMUSP00000025705  ISKLKKAGnq....TGLYVLRCSPKD-.FNKYFLTFAV..................EREnvieYKHCLITKN......
ENSMUSP00000105632  AEVLQAQP......PGIFLVRKSSK--.MQKKVLSLRLpcef..............GAP....LKEFTIKES......
ENSMUSP00000099842  INKLRQEGse....EGMYVLRWSCTD-.FDNILMTVTCfeksevlgg.........QKQ....FKNFQIEVQ......
ENSMUSP00000101449  LSLLRRDV......HGAFLLWPEPGT-.SDQWSLSVRT..................QCG....VVPHQVFRN......
ENSMUSP00000060073  IHKLKAAGsl....PGTYILRRSPQD-.YDSFLLTACVqtpl..............GPD....YKGCLIRQD......
ENSMUSP00000038130  QLLLERYPe.....CGNLLLRPGGDG-.KDSVSVTTRQilng..............SPV....VKHYKVKRA......
ENSMUSP00000123177  -------Pq.....DGLYCIRNSST--.KSGKVLVVWDes................SNK....VRNYRIFEK......
ENSMUSP00000025818  LHVLRTEP......PGTFLVRKSNT--.RQCQALCVRLpeasg.............PSF....VSSHYIEES......
ENSMUSP00000031171  TAMLEKNPs.....WGNMILRPGSD--.SKNYSITIRQeie...............MPR....IKHFKVTRT......
ENSMUSP00000060771  AKILQQEM......AGMFLVCRDNN--.LKQLVLCVHFpslkgs............SAE....VLEYPIKEE......
ENSMUSP00000002121  EKMMETMD......QGDVIIRPSSKG-.ENHLTVTWKVs.................AGI....YQHVDVREE......
ENSMUSP00000001036  -----P-E......DGLYLIQWSTSH-.LHRLILTVAHrnpafsngpr........GLR....LRKFPITQQ......
ENSMUSP00000058447  KAFLELWP......LGSFLVIGHEPG-.---QVLMLKAgps...............SGD....INTYQIQRF......


                                       70               80                              90        10
                                        |                |                               |          
d1fu6a_               ...........D....GKYGFSD.......PLTFNSVVELIN...........H...........YRNESLAQ.YNPK
ENSMUSP00000041902  ...........K....PL-----.......------------...........-...........--------.----
ENSMUSP00000110115  ...........K....PL-----.......------------...........-...........--------.----
ENSMUSP00000039955  ...........-....-------.......------------...........-...........--------.----
ENSMUSP00000066743  ...........E....P--YTKK.......ELSAVTFPDIIR...........N...........YKVMAAEN.I-PE
ENSMUSP00000027277  ...........E....P--YNKG.......RLSALPFADILR...........D...........YKVIMAEN.I-PE
ENSMUSP00000099403  ...........E....P--YTKQ.......QLNNMSFAEIIM...........G...........YKIMDATN.I-LV
ENSMUSP00000114188  ...........Dn...GGYYITT.......RAQFETLQQLVQ...........H...........YSERA---.--AG
ENSMUSP00000019913  ...........De...GGFFLTR.......RKVFSTLNEFVN...........Y...........YTTTS---.--DG
ENSMUSP00000072154  ...........Dn...GGYYITT.......RAQFDTLQKLVK...........H...........YTEHA---.--DG
ENSMUSP00000030693  ...........Dt...GGYYITT.......RAQFDSIQDLVR...........H...........YMEVN---.--DG
ENSMUSP00000082855  ...........Q....P--YTKE.......VLQSLPLTEIIR...........H...........YQVLAEEN.I-PE
ENSMUSP00000119263  ...........Dn...GGFYISP.......RITFPGLHDLVR...........H...........YTNAS---.--DG
ENSMUSP00000090237  ...........Ds...GGFYITS.......RTQFNSLQQLVA...........Y...........YSKHA---.--DG
ENSMUSP00000014597  ...........Dn...GGYYISP.......RITFPTLQALVQ...........H...........YSKKG---.--DG
ENSMUSP00000038838  ...........Dn...GGYYISP.......RITFPCISDMIK...........H...........YQKQS---.--DG
ENSMUSP00000003370  ...........Ds...GGFYISP.......RSTFSSLQELVL...........H...........YKKGK---.--DG
ENSMUSP00000028190  ...........Sd...GKLYVSS.......ESRFNTLAELVH...........H...........HSTVA---.--DG
ENSMUSP00000027888  ...........Td...SKVYVTA.......ESRFSTLAELVH...........H...........HSTVA---.--DG
ENSMUSP00000016498  ...........Ps...GSLYLQE.......GQLFPSLDALLA...........Y...........YKTNW---.--KL
ENSMUSP00000089708  ...........Q....P--FSAK.......DLSIRSLGDRIR...........-...........--------.----
ENSMUSP00000034863  ...........A....SKLSIDE.......EVYFENLMQLVE...........H...........YTTDA---.--DG
ENSMUSP00000004143  ...........-....-------.......------------...........-...........--------.----
ENSMUSP00000016511  ...........Ne...GRLHLNE.......AVSFSNLSELVD...........Y...........HKTQS---.--LS
ENSMUSP00000109234  ...........Ds...GQWYITE.......RHLFPSVPELIQ...........Y...........HQYNA---.--AG
ENSMUSP00000129397  ...........Ds...GQWYITE.......RHLFPSVPELIQ...........Y...........HQYNA---.--AG
ENSMUSP00000107882  ...........Ae...NKLYLAE.......NYCFDSIPKLIH...........Y...........HQHNS---.--AG
ENSMUSP00000029164  ...........Dn...GWLYISP.......RLTFPSLHALVE...........H...........YSELA---.--DG
ENSMUSP00000033617  ...........Pq...SQYYLAE.......KHLFSTIPELIN...........Y...........HQHNS---.--AG
ENSMUSP00000117204  ...........-....-------.......------------...........-...........--------.----
ENSMUSP00000028252  ...........Eddg.ELFHTLDdg.....HTKFTDLIQLVE...........F...........YQLNR---.--GV
ENSMUSP00000119926  ...........Ede..GCLYFSMdeg....QTRFTDLLQLVE...........F...........HQLNR---.--GI
ENSMUSP00000034296  ...........A....TGFGFAEp......YNLYGSLKELVL...........H...........YQHASLVQ.HNDA
ENSMUSP00000004959  ...........A....SGKYFLW.......EEKFNSLNELVD...........F...........YRTTT---.----
ENSMUSP00000102099  ...........A....RGYGFAEp......YNLYSSLKELVL...........H...........YQQTSLVQ.HNDS
ENSMUSP00000060828  ...........Kt...GKLSIPE.......GKKFDTLWQLVE...........H...........YSYKP---.--DG
ENSMUSP00000113221  ...........D....GHLTIDE.......AVCFCNLMDMVE...........H...........YTKDK---.--GA
ENSMUSP00000098864  ...........Ndsp.KRYYVAE.......KYVFDSIPLLIQ...........Y...........HQYNG---.--GG
ENSMUSP00000021090  ...........G....AGKYFLW.......VVKFNSLNELVD...........Y...........HRSTSVSR.----
ENSMUSP00000060828  ...........N....GTYAISG.......GRAHASPADLCH...........Y...........HSQEP---.--DG
ENSMUSP00000127901  ...........Pn...NWYYISP.......RLTFQCLEDLVT...........H...........YSEVA---.--DG
ENSMUSP00000091011  ...........Eddg.QTFFTLDdg.....NTKFSDLIQLVD...........F...........YQLNK---.--GV
ENSMUSP00000098333  ...........E....LKYDVGG.......GERFDSLTDLVE...........H...........YKKNPMVE.T-LG
ENSMUSP00000102099  ...........D....GKYGFSE.......PLTFTSVVELIN...........H...........YHHESLAQ.YNPK
ENSMUSP00000079991  ...........G....RHFVLGT.......SAYFESLVELVS...........Y...........YEKHALY-.----
ENSMUSP00000000129  ...........D....NLYRF-E.......GTGFSNIPQLID...........H...........HFNTKQVI.T-KK
ENSMUSP00000099404  ...........E....GQTVMLG.......NSEFDSLVDLIS...........Y...........YEKHPLYR.----
ENSMUSP00000047004  ...........A....TGYGFAEp......YNLYSSLKELVL...........H...........YQHTSLVQ.HNDS
ENSMUSP00000027291  ...........Ka...GKYCIPE.......GTKFDTLWQLVE...........Y...........LKLKA---.--DG
ENSMUSP00000047004  ...........D....GKYGFSD.......PLTFNSVVELIN...........H...........YRNESLAQ.YNPK
ENSMUSP00000034296  ...........D....GHYGFSE.......PLTFCSVVELIS...........H...........YRHESLAQ.YNAK
ENSMUSP00000098333  ...........G....DYYDLYG.......GEKFATLAELVQ...........Y...........YMEHHGQL.----
ENSMUSP00000027291  ...........N....GTYAIAG.......GKAHCGPAELCQ...........F...........YSQDP---.--DG
ENSMUSP00000071836  ...........Atsp.KKYYLAE.......KHAFGSIPEIIE...........Y...........HKHNA---.--AG
ENSMUSP00000046532  ...........T....KGNYFLW.......TEKFPSLNKLVD...........Y...........YRTTS---.----
ENSMUSP00000108103  ...........G....DFYDLYG.......GEKFATLTELVE...........Y...........YTQQQGILqDRDG
ENSMUSP00000020564  ...........P....EGVVRTK.......DVLFESISHLID...........Y...........HLKNGLPI.V---
ENSMUSP00000006293  ...........P....NRRFKIG.......DQEFDHLPALLE...........F...........YKIHYLDT.T---
ENSMUSP00000137069  ...........K....HGYYRIEtnahtp.RTIFPNLQELVS...........K...........YGKPG---.--QG
ENSMUSP00000047656  ...........R....ENQVVLGqh.....SGPFPSIPELVL...........H...........YSARPLPV.Q-GA
ENSMUSP00000125121  ...........K....NGYYRIEtepstp.KTIFPNLEELIS...........K...........FKTPG---.--QG
ENSMUSP00000060433  ...........K....EKYVLGQn......SPPFDSVPEVIH...........Y...........YTTRKLPI.K-GA
ENSMUSP00000119293  ...........P....EGVVRTK.......DHRFESVSHLIS...........Y...........HMDNHLPI.ISAG
ENSMUSP00000021898  ...........P....EGTIRTK.......DRVFDSISHLIN...........Y...........HLESSLPI.VSAG
ENSMUSP00000108495  ...........E....TV-YCIG.......QRKFSTMEELVE...........H...........YKKAPIF-.----
ENSMUSP00000036270  ...........D....GFFHIAE.......NRKFKSLMELVE...........Y...........YKHHSLKE.GFRT
ENSMUSP00000079733  ...........D....NLYRL-E.......GDGFPSIPLLIT...........H...........LLSSQQPL.T-KK
ENSMUSP00000072763  ...........E....DDKFTVQasegvp.MRFFTKLDQLID...........F...........YKKEN---.--MG
ENSMUSP00000005839  ...........E....TGSWSAEtapgvh.KRFFRKVKNLIS...........A...........FQKPD---.--QG
ENSMUSP00000106160  ...........K....EHKYVLGqn.....SPPFSSVPEIVH...........H...........YASRKLPI.K-GA
ENSMUSP00000105179  ...........P....NNQFMMG.......GRYYNSIGDIID...........H...........YRKEQ---.--IV
ENSMUSP00000070301  ...........G....K--HFVG.......EKRFESIHDLVT...........-...........--------.--DG
ENSMUSP00000035908  ...........G....K--HFVG.......EKRFESIHDLVT...........-...........--------.--DG
ENSMUSP00000099404  ...........QdagtPKFFLTD.......NLVFDSLYDLIT...........H...........YQQVPLRC.--NE
ENSMUSP00000064929  ...........N....GRFSFYEqpd....VEGHTSIVDLIE...........HsirdsengafcYSRSRLPG.S-AT
ENSMUSP00000029806  ...........G....YSFKF-G.......FNEYSSLKDFVK...........H...........FANQPLIG.SETG
ENSMUSP00000083611  ...........D....SVYCI-G.......QRRFHSMDELVE...........H...........YKKAPIFT.S---
ENSMUSP00000105179  ...........C....GDYYI-G.......GRRFSSLSDLIG...........Y...........YSHVSC--.----
ENSMUSP00000048057  ...........G....EDFLAVQtsqgvp.VRRFQTLGELIG...........L...........YAQPN---.--QG
ENSMUSP00000071970  ...........E....DGTCAFAgd.....HMTHASLHALVT...........F...........HQQKPIRP.F---
ENSMUSP00000017920  ppspaqpppgvS....PSRLRIG.......DQEFDSLPALLE...........F...........YKIHYLDT.T---
ENSMUSP00000079991  ...........Ngv..MKYYLTD.......NLTFNSIYALIQ...........H...........YREAHLRC.--AE
ENSMUSP00000038591  ...........N....HNFSFDAhdpc...VFHSSTVTGLLE...........H...........YKDPSSCM.FFEP
ENSMUSP00000064708  ...........G....DFYSFLGvd.....PNRHATLTDLID...........F...........HK------.----
ENSMUSP00000059658  ...........K....DNKYTLNqt.....SAVFDSIPEVVH...........Y...........YSNAKLPF.K-GA
ENSMUSP00000108103  ...........G....GRYTVGG.......SETFDSLTDLVE...........H...........FKKTGIEE.A-SG
ENSMUSP00000108491  ...........E....GLYRITE.......KKAFRGLLELVE...........F...........YQQNSLKD.CFKS
ENSMUSP00000052625  ...........D....GKFRLDSiicvkskLKQFDSVVHLID...........Y...........YVQ-----.----
ENSMUSP00000103207  ...........Gd...GRHVVLGe......DSAHAQLQDLLE...........H...........YTECPLSP.YG--
ENSMUSP00000032978  ...........E....EGQCRVQ.......HLWFQSIFDMLE...........H...........FRVHPIPL.ESGG
ENSMUSP00000066031  ...........N....HNFSFDAhdpc...VFHSPDITGLLE...........H...........YKDPSACM.FFEP
ENSMUSP00000029766  .........ayS....RVQYQFE.......MESFDSIPGLVR...........C...........YVGNRRPI.S-QQ
ENSMUSP00000020215  ...........D....GKFRLDSiicvkskLKQFDSVVHLID...........Y...........YVQ-----.----
ENSMUSP00000043146  ...........P....EGKVRTK.......DHVFDNVGHLIK...........Y...........HMDNNLPI.ISSG
ENSMUSP00000040896  ...........R....GTFSLWChpkf...EDRCQSVVEFIKraimhskngkfL...........--------.----
ENSMUSP00000082183  ...........D....SSFRLDSnclsrprILAFPDVVSLVQ...........H...........YV------.----
ENSMUSP00000062782  ...........D....SWIHITE.......AKKFESLLELVE...........Y...........YQCHSLKE.SFKQ
ENSMUSP00000113808  ...........E....RGQCRVQ.......HLHFPSVVDMLR...........H...........FQRSPIPL.----
ENSMUSP00000073866  .........syT....HIRYLFE.......QESFDHVPALVR...........Y...........HVGSRKAV.S-EQ
ENSMUSP00000070825  ...........A....NSYSFLGvd.....QLQHATLADLVE...........Y...........HKEEPITS.LG--
ENSMUSP00000129146  ...........P....KGVKIKGcpt....EPYFGSLSALVS...........Q...........HSISP---.--IS
ENSMUSP00000038121  ...........A....GRFHLDGs......RETFDCLFELLE...........H...........YVAAPRRM.LGA-
ENSMUSP00000020695  ...........P....KGVRLKGcsn....EPYFGSLTALVC...........Q...........HSITP---.--LA
ENSMUSP00000059129  ...........G....GSFSLQSdprstqpVPRFDCVLKLVH...........H...........YM------.----
ENSMUSP00000005188  ...........G....HGQCHVQ.......HLWFQSVFDMLR...........H...........FHTHPIPL.ESGG
ENSMUSP00000128473  ...........Es...NQQFALGtglrg..NEMFDSVEDIIE...........H...........YTYFPILL.I---
ENSMUSP00000132779  ...........Es...NQQFALGtglrg..NEMFDSVEDIIE...........H...........YTYFPILL.I---
ENSMUSP00000056621  ...........Ee...SQVYLLGtglrg..KEDFLSVSDIID...........Y...........FRKMPLLL.----
ENSMUSP00000127715  ...........P....RGVKLKGcpn....EPNFGSLSALVY...........Q...........HSVIP---.--LA
ENSMUSP00000112473  ...........Ea...TKQYALGkkkng..EEYFGSVVEIVN...........S...........HQHNPLVL.I---
ENSMUSP00000017751  ...........A....KGVHLKGade....EPYFGSLSSFVC...........Q...........HSIMA---.--LA
ENSMUSP00000087117  ...........Dg...GHHYALGregrnh.EELFSSVAAMVQ...........H...........YTKHPLPL.----
ENSMUSP00000025705  ...........E....NGEYNLSgt.....KRNFSNLKDLLN...........C...........YQMETVRS.--DS
ENSMUSP00000105632  ...........T....YTFSLEGs......GISFADLFRLIA...........F...........YCISR---.--DV
ENSMUSP00000099842  ...........K....GRYSLHGs......MDHFPSLRDLMN...........H...........LKKQILRT.--DN
ENSMUSP00000101449  ...........Hl...GRFCLEHl......PAEFPSLEALVE...........S...........HAGVE---.--RS
ENSMUSP00000060073  ...........Ps...GAFSLVGl......SQPHRSLRELLA...........A...........CWNSGLRV.----
ENSMUSP00000038130  ...........G....SKYVIDVed.....PFSCPSLEAVVN...........Y...........FVTHT---.----
ENSMUSP00000123177  ...........D....SKFYLEG.......EVLFASVGSMVE...........H...........YHTHVLPS.H-QS
ENSMUSP00000025818  ...........T....GGVSLEGs......ELMFQDLVQLIC...........G...........YCRTR---.----
ENSMUSP00000031171  ...........G....NNYTIELek.....PVTLPNLFSVID...........Y...........FVKET---.----
ENSMUSP00000060771  ...........K....AILYLEGs......VLVFEDIFRLIA...........F...........YCVSR---.--DL
ENSMUSP00000002121  ...........Gke..NAFSLGAtlwin..SEEFEDLDEIVA...........R...........YV------.----
ENSMUSP00000001036  ...........P....GAFVLDGw......GRSFASLGDL--...........-...........--------.----
ENSMUSP00000058447  ...........P....GGVSLESs......NLCMPDCPHLLA...........F...........LSASR---.--DV


                      0       110                                                                   
                      |         |                                                                   
d1fu6a_               LDVKLLYPVSK-y.................................................................
ENSMUSP00000041902  ------------fqalidgfregfylfpdgrnqnpdlt........................................
ENSMUSP00000110115  ------------fqalidgsregfylypdgrsynpdlt........................................
ENSMUSP00000039955  ------------lqtiplnkpllqvllkgqkdgiflfpdgkkhnpdlt..............................
ENSMUSP00000066743  NPLKYLYPNI--dkdhafgkyysrpkeapepmelddpkrtgyiktelisvs...........................
ENSMUSP00000027277  NPLKYLYPDIP-kdkafgkhyssqpcevsrptergdkgyvpsvfipi...............................
ENSMUSP00000099403  SPLVYLYPDI--pkeeafgkycrpesqehpeadpgsaapylktkficvt.............................
ENSMUSP00000114188  LCCRLVVPCHK-gmprltdlsvktkdvweipreslqlikrlgngqfgevwmgtwn.......................
ENSMUSP00000019913  LCVKLEKPCLK-iqvptpfdlsyktadqweidrnsiqllkrlgsgqfgevweglwn......................
ENSMUSP00000072154  LCHKLTTVC---ptvkpqtqglakdaweipreslrlevklgqgcfgevwmgtwn........................
ENSMUSP00000030693  LCYLLTAPC---..................................................................
ENSMUSP00000082855  NPLRFLYPRIP-rdeafgcyyqekvnf...................................................
ENSMUSP00000119263  LCTKLSRPCQ--tqkpqkpwwedewevpretlklverlgagqfgevwmgyyn..........................
ENSMUSP00000090237  LCHRLTTVCP--tskpqtqglakdaweipreslrlevklgqgcfgevwmgtwn.........................
ENSMUSP00000014597  LCQKLTLPCV--nlapknlwaqdeweiprqslklvrklgsgqfgevwmgyyk..........................
ENSMUSP00000038838  LCRRLEKACI--spkpqkpwdkdaweipresiklvkklgagqfgevwmgyyn..........................
ENSMUSP00000003370  LCQKLSVPCV--spkpqkpwekdaweipreslqmekklgagqfgevwmaty...........................
ENSMUSP00000028190  LITTLHYPAPK-rnkptiygvspnydkwemertditmkhklgggqygevyegvwk.......................
ENSMUSP00000027888  LVTTLHYPAPK-cnkptvygvspihdkwemertditmkhklgggqygevyvgvwk.......................
ENSMUSP00000016498  IQNPLLQPCIP-qiplvqdewerprsefvlrrklgegffgevweglw...............................
ENSMUSP00000089708  ------------dlaqlknlypkkpkdeafrshykpeqmgkdgrgyvsttikm.........................
ENSMUSP00000034863  LCTRLIKPK---vmegtvaaqdefyrsgwalnmkelkllqtigkgefgdvmlgd........................
ENSMUSP00000004143  ------------mfwnlmpfttrdfsirsladrlgdlnyliyvfpdrpkdevyskyytpvpcepatakaadgyvkpqi
ENSMUSP00000016511  HGLQLSMPCWK-hkteplphwddwerpreeftlckklgagyfgevfealwk...........................
ENSMUSP00000109234  LISRLRYPI---..................................................................
ENSMUSP00000129397  LISRLRYPI---..................................................................
ENSMUSP00000107882  MITRLRHPVS--tkankvpvsvalgsgiwelkreeitllkelgngqfgvvqlgqwk......................
ENSMUSP00000029164  ICCPLREPCV--lq................................................................
ENSMUSP00000033617  LISRLKYPV---s.................................................................
ENSMUSP00000117204  ------------wnlkpfttrdfsirsladrlgdlnyliyvfpdrpkdevfakyytpvl...................
ENSMUSP00000028252  LPCKLKHYCA--r.................................................................
ENSMUSP00000119926  LPCLLRHCCA--r.................................................................
ENSMUSP00000034296  LTVTLAHPVR--a.................................................................
ENSMUSP00000004959  ------------i.................................................................
ENSMUSP00000102099  LNVRLAYPVH--aqm...............................................................
ENSMUSP00000060828  LLRVLTVPC---q.................................................................
ENSMUSP00000113221  ICTKLVKPRRK-qgaksaeeelakagwlldlqhltlgaqigegefgavlqg...........................
ENSMUSP00000098864  LVTRLRYPVC--swrqkapvtaglrygkwviqpseltfvqeigsgqfglvhlgyw.......................
ENSMUSP00000021090  ------------nqqiflrdieqmpqqptyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprn
ENSMUSP00000060828  LICLLKKPFNR-ppgvqpktgpfedlkenlireyvkqtwn......................................
ENSMUSP00000127901  LCCVLTTPCL--aqnipaptsh........................................................
ENSMUSP00000091011  LPCKLKHHCIR-..................................................................
ENSMUSP00000098333  TVLQLKQP----l.................................................................
ENSMUSP00000102099  LDVKLTYPVSR-..................................................................
ENSMUSP00000079991  RKMRLRYPV---t.................................................................
ENSMUSP00000000129  SGVVLLNPIPK-dkkwvlnhedvslgellgkgnfgevykg......................................
ENSMUSP00000099404  -KMKLRYPI---n.................................................................
ENSMUSP00000047004  LNVTLAYPVY--aq................................................................
ENSMUSP00000027291  LIYRLKEVC---p.................................................................
ENSMUSP00000047004  LDVKLLYPVSK-yqqdqvv...........................................................
ENSMUSP00000034296  LDTRLLYPVSK-..................................................................
ENSMUSP00000098333  ------------kekngdvielkyplncad................................................
ENSMUSP00000027291  LPCNLRKPCNR-ppglepqpgvfdclrdamvrdyvrqtwk......................................
ENSMUSP00000071836  LVTRLRYPV---s.................................................................
ENSMUSP00000046532  ------------is................................................................
ENSMUSP00000108103  TIIHLKYPL---ncsdp.............................................................
ENSMUSP00000020564  ------------aaese.............................................................
ENSMUSP00000006293  ---TLIEP----aprypsppvgsvsapnlptaeenleyvrtlydfpgndaedlpfkkgellviiekpeeqwwsarnkd
ENSMUSP00000137069  LVVHLSNPIMR-..................................................................
ENSMUSP00000047656  EHLALLYPVT--ssq...............................................................
ENSMUSP00000125121  MVVHLSNPIMR-..................................................................
ENSMUSP00000060433  EHLSLLYPV---..................................................................
ENSMUSP00000119293  SEL---------cl................................................................
ENSMUSP00000021898  SEL---------cl................................................................
ENSMUSP00000108495  ------------ts................................................................
ENSMUSP00000036270  LDTTLQFPYK--epeqpagqrgnrtgnsllspkvlgiaiarydfcardmrelsllkgdmvkiytkmsangwwrgevng
ENSMUSP00000079733  SGVVLFRAVP--kdkwvlkhedlvlgeqigrgnfgevfsg......................................
ENSMUSP00000072763  LVTHLQYPVP--..................................................................
ENSMUSP00000005839  IVTPLQYPV---e.................................................................
ENSMUSP00000106160  EHMSLLYP----..................................................................
ENSMUSP00000105179  EGYYLKEPVP--mqdqg.............................................................
ENSMUSP00000070301  LITL--------yietkaaeyiakmtinpiyehigyt.........................................
ENSMUSP00000035908  LITL--------yietkaaeyiakmttnpiyehigya.........................................
ENSMUSP00000099404  FEMRLSEPVPQ-t.................................................................
ENSMUSP00000064929  YPVRLTNPVS--rf................................................................
ENSMUSP00000029806  TLMVLKHPYPR-..................................................................
ENSMUSP00000083611  ------------ehg...............................................................
ENSMUSP00000105179  ------------llk...............................................................
ENSMUSP00000048057  LVCALLLPV---..................................................................
ENSMUSP00000071970  ------------gelltqacgq........................................................
ENSMUSP00000017920  ---TLIEPV---arsrqgsgvilrqeeaeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipv
ENSMUSP00000079991  FELRLTDPV---p.................................................................
ENSMUSP00000038591  ------------llti..............................................................
ENSMUSP00000064708  ------------..................................................................
ENSMUSP00000059658  EHMTLLHPVHK-..................................................................
ENSMUSP00000108103  AFVYLRQPY---..................................................................
ENSMUSP00000108491  LDTTLQFPY---..................................................................
ENSMUSP00000052625  ------------m.................................................................
ENSMUSP00000103207  --EILT------qplar.............................................................
ENSMUSP00000032978  ------------ssdvvlvsyvpsqr....................................................
ENSMUSP00000066031  L-----------lstplir...........................................................
ENSMUSP00000029766  SGAIIFQPINR-tv................................................................
ENSMUSP00000020215  ------------m.................................................................
ENSMUSP00000043146  SEVRLKQPI---r.................................................................
ENSMUSP00000040896  ------------yflrsrvpglpptpvqllypvsr...........................................
ENSMUSP00000082183  ------------as................................................................
ENSMUSP00000062782  LDTTLKFPY---ksrerttsrassrspascasynfsflspqglsfapqapsapfwsvftprvigtavarynfaardmr
ENSMUSP00000113808  ------------ecg...............................................................
ENSMUSP00000073866  SGAIIYCPVNR-tf................................................................
ENSMUSP00000070825  ------------kellly............................................................
ENSMUSP00000129146  LPCCLRIPS---kdpleetpeapv......................................................
ENSMUSP00000038121  ------------plrqrrvr..........................................................
ENSMUSP00000020695  LPCKLLIPE---rdpleeiaen........................................................
ENSMUSP00000059129  ------------p.................................................................
ENSMUSP00000005188  S-----------aditlrsyvraqgp....................................................
ENSMUSP00000128473  ------------dgkdkaa...........................................................
ENSMUSP00000132779  ------------dgkdkaa...........................................................
ENSMUSP00000056621  ------------i.................................................................
ENSMUSP00000127715  LPCKLVIPS---rdptd.............................................................
ENSMUSP00000112473  ------------dsq...............................................................
ENSMUSP00000017751  LPCKLTIP----q.................................................................
ENSMUSP00000087117  ------------v.................................................................
ENSMUSP00000025705  IIFQFT------kccppkpkdksnllvfrtngisdvqisptlqrhnnvnqmvfhkirnedlifneslgqgtftkifkg
ENSMUSP00000105632  LPFTLKLPY---aistaktesqleelaqlglnfwss..........................................
ENSMUSP00000099842  ISFVLK------rccqp.............................................................
ENSMUSP00000101449  LF----------cplsm.............................................................
ENSMUSP00000060073  ------------dgaalnltsccaprpkeksnlivvrrgctpapapgcspsccaltqlsfhtiptdslewhenlghgs
ENSMUSP00000038130  ------------k.................................................................
ENSMUSP00000123177  LLL---------rhpy..............................................................
ENSMUSP00000025818  ------------a.................................................................
ENSMUSP00000031171  ------------rgn...............................................................
ENSMUSP00000060771  LPFTLRLP----..................................................................
ENSMUSP00000002121  ------------q.................................................................
ENSMUSP00000001036  ------------rlalqgcslragddcfplhhcclprpreisnlvimrgsrahtrplnlsqlsfhrvhqdeitqlshl
ENSMUSP00000058447  LPRTLLLPT---pt................................................................


                                                             
                                                             
d1fu6a_               .......................................
ENSMUSP00000041902  .......................................
ENSMUSP00000110115  .......................................
ENSMUSP00000039955  .......................................
ENSMUSP00000066743  .......................................
ENSMUSP00000027277  .......................................
ENSMUSP00000099403  .......................................
ENSMUSP00000114188  .......................................
ENSMUSP00000019913  .......................................
ENSMUSP00000072154  .......................................
ENSMUSP00000030693  .......................................
ENSMUSP00000082855  .......................................
ENSMUSP00000119263  .......................................
ENSMUSP00000090237  .......................................
ENSMUSP00000014597  .......................................
ENSMUSP00000038838  .......................................
ENSMUSP00000003370  .......................................
ENSMUSP00000028190  .......................................
ENSMUSP00000027888  .......................................
ENSMUSP00000016498  .......................................
ENSMUSP00000089708  .......................................
ENSMUSP00000034863  .......................................
ENSMUSP00000004143  kqv....................................
ENSMUSP00000016511  .......................................
ENSMUSP00000109234  .......................................
ENSMUSP00000129397  .......................................
ENSMUSP00000107882  .......................................
ENSMUSP00000029164  .......................................
ENSMUSP00000033617  .......................................
ENSMUSP00000117204  .......................................
ENSMUSP00000028252  .......................................
ENSMUSP00000119926  .......................................
ENSMUSP00000034296  .......................................
ENSMUSP00000004959  .......................................
ENSMUSP00000102099  .......................................
ENSMUSP00000060828  .......................................
ENSMUSP00000113221  .......................................
ENSMUSP00000098864  .......................................
ENSMUSP00000021090  yv.....................................
ENSMUSP00000060828  .......................................
ENSMUSP00000127901  .......................................
ENSMUSP00000091011  .......................................
ENSMUSP00000098333  .......................................
ENSMUSP00000102099  .......................................
ENSMUSP00000079991  .......................................
ENSMUSP00000000129  .......................................
ENSMUSP00000099404  .......................................
ENSMUSP00000047004  .......................................
ENSMUSP00000027291  .......................................
ENSMUSP00000047004  .......................................
ENSMUSP00000034296  .......................................
ENSMUSP00000098333  .......................................
ENSMUSP00000027291  .......................................
ENSMUSP00000071836  .......................................
ENSMUSP00000046532  .......................................
ENSMUSP00000108103  .......................................
ENSMUSP00000020564  .......................................
ENSMUSP00000006293  grvgmipvpyv............................
ENSMUSP00000137069  .......................................
ENSMUSP00000047656  .......................................
ENSMUSP00000125121  .......................................
ENSMUSP00000060433  .......................................
ENSMUSP00000119293  .......................................
ENSMUSP00000021898  .......................................
ENSMUSP00000108495  .......................................
ENSMUSP00000036270  rvgwfpstyv.............................
ENSMUSP00000079733  .......................................
ENSMUSP00000072763  .......................................
ENSMUSP00000005839  .......................................
ENSMUSP00000106160  .......................................
ENSMUSP00000105179  .......................................
ENSMUSP00000070301  .......................................
ENSMUSP00000035908  .......................................
ENSMUSP00000099404  .......................................
ENSMUSP00000064929  .......................................
ENSMUSP00000029806  .......................................
ENSMUSP00000083611  .......................................
ENSMUSP00000105179  .......................................
ENSMUSP00000048057  .......................................
ENSMUSP00000071970  .......................................
ENSMUSP00000017920  pyv....................................
ENSMUSP00000079991  .......................................
ENSMUSP00000038591  .......................................
ENSMUSP00000064708  .......................................
ENSMUSP00000059658  .......................................
ENSMUSP00000108103  .......................................
ENSMUSP00000108491  .......................................
ENSMUSP00000052625  .......................................
ENSMUSP00000103207  .......................................
ENSMUSP00000032978  .......................................
ENSMUSP00000066031  .......................................
ENSMUSP00000029766  .......................................
ENSMUSP00000020215  .......................................
ENSMUSP00000043146  .......................................
ENSMUSP00000040896  .......................................
ENSMUSP00000082183  .......................................
ENSMUSP00000062782  elslregdvvkiysriggdqgwwkgetngrigwfpstyv
ENSMUSP00000113808  .......................................
ENSMUSP00000073866  .......................................
ENSMUSP00000070825  .......................................
ENSMUSP00000129146  .......................................
ENSMUSP00000038121  .......................................
ENSMUSP00000020695  .......................................
ENSMUSP00000059129  .......................................
ENSMUSP00000005188  .......................................
ENSMUSP00000128473  .......................................
ENSMUSP00000132779  .......................................
ENSMUSP00000056621  .......................................
ENSMUSP00000127715  .......................................
ENSMUSP00000112473  .......................................
ENSMUSP00000017751  .......................................
ENSMUSP00000087117  .......................................
ENSMUSP00000025705  v......................................
ENSMUSP00000105632  .......................................
ENSMUSP00000099842  .......................................
ENSMUSP00000101449  .......................................
ENSMUSP00000060073  ftkifrgr...............................
ENSMUSP00000038130  .......................................
ENSMUSP00000123177  .......................................
ENSMUSP00000025818  .......................................
ENSMUSP00000031171  .......................................
ENSMUSP00000060771  .......................................
ENSMUSP00000002121  .......................................
ENSMUSP00000001036  gqgtrtnvyegll..........................
ENSMUSP00000058447  .......................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0037781 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Nostoc punctiforme PCC 73102
NoYes   Simkania negevensis Z
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Legionella longbeachae NSW150
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]