SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Nomascus leucogenys 76_1.0

These alignments are sequences aligned to the 0053854 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                           10                    20 
                                                                            |                     | 
d2dtge6               .......................dicpgtakgktncpatvingqf----------.....-------....-...--.
ENSNLEP00000000606  ...........................................sv----------.....-------....C...HP.
ENSNLEP00000002426  .............................................----------.....----CKP....C...HA.
ENSNLEP00000002426  ............................................r----------.....---HCVP....C...HK.
ENSNLEP00000002426  ............................................k----------.....---SCKK....C...DI.
ENSNLEP00000010151  ............................................r----------.....----CKV....C...HN.
ENSNLEP00000002426  ...........................................gp----------.....-------....C...DP.
ENSNLEP00000010151  ............................................h----------.....---SCAV....C...HE.
ENSNLEP00000002426  .............................................----------.....---ECEP....C...HQ.
ENSNLEP00000002426  ............................................g----------.....--NTCLP....C...PD.
ENSNLEP00000010151  ............................................d----------.....-NHVCQP....C...NT.
ENSNLEP00000010419  ............................................v----------.....-------....C...HA.
ENSNLEP00000008878  .................................fvhcepcdekal----------.....-------....-...--.
ENSNLEP00000010151  ............................................y----------.....----CAD....C...HP.
ENSNLEP00000010925  .......................................dernch----------.....-INECLS....Kk..VS.
ENSNLEP00000002317  ..........................................aih----------.....-------....-...--.
ENSNLEP00000008780  ............................................v----------.....-------....C...NH.
ENSNLEP00000001285  .............................................----------.....-------....-...--.
ENSNLEP00000021313  ............................................v----------.....-------....C...DP.
ENSNLEP00000002426  .............................................----------.....----CER....C...NR.
ENSNLEP00000017341  ..........................................gee----------.....---NCNV....N...NG.
ENSNLEP00000001645  ............................................d----------.....-VNECAE....N...PG.
ENSNLEP00000019565  ............................................d----------.....-INECLV....N...NG.
ENSNLEP00000010419  ............................................s----------.....----CQK....C...DP.
ENSNLEP00000021313  ............................................n----------.....-GRSCPP....C...HE.
ENSNLEP00000002401  .............................................-CPVGFSMTEta...VGIRCTDide.Cv..SS.
ENSNLEP00000005281  ............................................w----------.....-------....-...--.
ENSNLEP00000001645  ...........................................cm----------.....DVDECAR....D...PL.
ENSNLEP00000021306  ...........................................id----------.....---ECQT....R...NG.
ENSNLEP00000010151  .............................................----------.....-------....-...--.
ENSNLEP00000008780  .............................................----------.....----CGR....C...HK.
ENSNLEP00000008875  lfrcppctperlaacgpppvappaavaavaggarmpcaelvrepg----------.....-------....-...--.
ENSNLEP00000004633  ............................................y----------.....----CAS....E...NH.
ENSNLEP00000015039  ............................................e----------.....----CIQ....N...GV.
ENSNLEP00000021907  .............................................QCPSGFTLDS.....VGPFCADede.Caa.AN.
ENSNLEP00000007349  ............................................q--------CN.....DRNECQE....I...PN.
ENSNLEP00000015130  ..........................................ank----------.....--ETCEH....N...HR.
ENSNLEP00000015039  ............................................d----------.....-VNECLE....S...PG.
ENSNLEP00000017005  ............................................g----------.....---MCQR....N...PQ.
ENSNLEP00000001645  .........................................phht-------VLL.....DVDECSQ....V...PK.
ENSNLEP00000020776  ............................................n----------.....-------....-...--.
ENSNLEP00000001645  ............................................c----------.....-------....-...--.
ENSNLEP00000002426  .............................................----------.....-------....-...--.
ENSNLEP00000007349  ...........................................cm----------.....DIDECQR....D...PL.
ENSNLEP00000015039  ...........................................cv----------.....DRNECLE....I...PN.
ENSNLEP00000019565  ............................................g-----LTGSV.....DVDECSE....G...TD.
ENSNLEP00000007349  ............................................l----------.....--NECNQ....A...PK.
ENSNLEP00000001645  ............................................i----------.....--NECRV....R...NG.
ENSNLEP00000017005  ...........................................vd----------.....---ECTQ....T...PG.
ENSNLEP00000003819  ..........................................dsr----------.....--QTCAN....N...RH.
ENSNLEP00000015039  .........................................cssg-----VGITVdgr..DINECAL....D...PD.
ENSNLEP00000010460  ...........................................id----------.....---ECRL....N...NG.
ENSNLEP00000014132  ..........................................sqa-CAKGCELCS.....EVNGCLK....C...SP.
ENSNLEP00000010925  ..........................................cqq----------.....-------....-...-L.
ENSNLEP00000000953  ............ivgnkppkecgdlcpgtmeekpmcekttinney----------.....-------....-...--.
ENSNLEP00000001285  ...........................................sr----------.....---ACQP....C...SP.
ENSNLEP00000005364  ...........................................la----------.....---QCAP....P...PT.
ENSNLEP00000007349  ........................................clqng----------.....-------....-...-R.
ENSNLEP00000007349  ...........................................nv----------.....-TDYCQL....V...RY.
ENSNLEP00000011454  ..........................................cti----------.....-------....-...PP.
ENSNLEP00000001645  .............................................-CSSGLGITMdgr..DINECAL....D...PE.
ENSNLEP00000007349  ........................................decke----------.....-------....-...PD.
ENSNLEP00000003819  .......................................cetglh----------.....------N....C...DI.
ENSNLEP00000017155  .........................................vsqg----------.....-------....-...--.
ENSNLEP00000015039  ............................................d----------.....---ECSQ....S...PK.
ENSNLEP00000019359  ........................................cqhrh----------.....-------....-...--.
ENSNLEP00000001645  ...........................................ln---------Q.....TIDICRH....F...TN.
ENSNLEP00000007349  ..........................................ffk----------.....DINECKM....I...PS.
ENSNLEP00000007155  ........................................cvdid----------.....------E....Cr..YR.
ENSNLEP00000015039  ...........................................fy---------K.....DINECKA....F...PG.
ENSNLEP00000005810  .......................................kycstt----------.....------L....Cs..AL.
ENSNLEP00000001645  ...........................................vg----------.....-RNECRE....I...PN.
ENSNLEP00000011444  ............................................g----------.....-------....-...--.
ENSNLEP00000021306  ............................................e----------.....----CAQ....G...LD.
ENSNLEP00000001645  ...........................................dv----------.....--DECIV....S...GG.
ENSNLEP00000015039  ............................................k----GTTGCT.....DVDECEI....G...AH.
ENSNLEP00000015039  ...........................................dr------QGCT.....DIDECMI....M...NG.
ENSNLEP00000010925  .........................................riap----------.....TEYTCED....N...VN.
ENSNLEP00000020085  ............................................s----------.....----CPS....N...VS.
ENSNLEP00000007349  ...........................................cv----------.....DIDECSI....M...NG.
ENSNLEP00000020669  .......................................agcper----------.....-------....-...--.
ENSNLEP00000021907  ............................................q----------.....-------....-...--.
ENSNLEP00000010913  ............................tcgpcepaacpplpplg----------.....-------....-...--.
ENSNLEP00000007349  ...........................................ct----------.....DLDECSE....N...LN.
ENSNLEP00000021510  ...................................rregqecgvy----------.....-------....-...--.
ENSNLEP00000017624  .............................................-CLPGWMGQN.....CDININD....C...LG.
ENSNLEP00000004973  ............................................g----------.....----CLS....Csk.DN.
ENSNLEP00000012621  ............................................g-----RLCDK.....DVNECSQ....E...NG.
ENSNLEP00000000477  ..................neecgdicpgtakgktncpatvingqf----------.....-------....-...--.
ENSNLEP00000000484  ..................neecgdicpgtakgktncpatvingqf----------.....-------....-...--.
ENSNLEP00000010925  .............................................-CPDGSDEGD.....LCDECSL....N...NG.
ENSNLEP00000002105  .........................................qcsp----------.....-----LP....C...NE.
ENSNLEP00000005270  ..........................................ash----------.....--LVCSA....C...FG.
ENSNLEP00000011454  ...........................................ip----------.....-------....-...--.
ENSNLEP00000019757  ...........................................tn----------.....-------....-...--.
ENSNLEP00000023356  .........................................qcsp----------.....-----LP....C...NE.
ENSNLEP00000005810  .............................................----------.....----CSD....F...NG.
ENSNLEP00000016448  ............................................d----------.....-VNECQR....Y...PGr
ENSNLEP00000015087  .........................................sqgr----------.....---WCSE....C...HS.
ENSNLEP00000018039  ..............................gcapcrpeecaaprg-CLAGWVRDA.....CG-C---....-...--.
ENSNLEP00000019913  .............................................-CIPGWKGIN.....CHINVND....C...RG.
ENSNLEP00000021201  .............................................TCVKGFVGLH.....CETEVNE....Cq..SN.
ENSNLEP00000004633  ............................................y----------.....----CAL....N...KP.
ENSNLEP00000006856  .............................................----------.....-------....-...--.
ENSNLEP00000015740  ....................................wpckcphqk----------.....-------....-...--.
ENSNLEP00000000324  .............................................RCPVGYSGFN.....CEKKIDY....Cs..SS.
ENSNLEP00000001645  .............................................----GATGCS.....DVDECEV....G...GH.
ENSNLEP00000016448  .............................................----------.....-------....-...--.
ENSNLEP00000011548  .............................................KCLPGYAGSW.....CEIDIDE....Cl..PS.
ENSNLEP00000007349  ..........................................ceg----------.....-------....-...NH.
ENSNLEP00000019359  ...........................................ei----------.....--NECTV....N...PD.
ENSNLEP00000005978  ............................................i----------.....-------....-...--.
ENSNLEP00000010158  .............................................KCVAGYHGVN.....CSEEIDE....Cl..SH.
ENSNLEP00000005952  ...........................................ql----------.....-------....-...--.
ENSNLEP00000010165  .............................................KCVAGYHGVN.....CSEEIDE....Cl..SH.
ENSNLEP00000017005  .............................................----------.....-------....-...--.
ENSNLEP00000019757  ...........................................pg----------.....-------....-...--.
ENSNLEP00000006645  .............................................ICNPGYMGAI.....CSDQIDE....Cy..SS.
ENSNLEP00000006645  ..........................................cte----------.....DVDECAM....An..SN.
ENSNLEP00000001905  .............................................VCLPNGTWTG.....EQPRCRDtse.Cs..SQ.
ENSNLEP00000010165  ............................................c---------Q.....DVDECSL....G...AN.
ENSNLEP00000015039  ..........................................cdg----------.....-------....-...NH.
ENSNLEP00000007050  ...................................wpcecppspp----------.....-------....-...--.
ENSNLEP00000010158  ............................................c---------Q.....DVDECSL....G...AN.
ENSNLEP00000015039  ......................................cemcpaq----------.....-------....-...--.
ENSNLEP00000011158  .............................................-CFPGYTGKT.....CSQDVNE....CgmkPR.
ENSNLEP00000016459  .............................................QCPEGYFGSA.....CEEKVDP....Ca..SS.
ENSNLEP00000001781  .............................................-CMDGYFSSLrne..THSICTA....C...DE.
ENSNLEP00000019359  ..........................................pdv----------.....-------....-...--.
ENSNLEP00000019757  .........................................caph----------.....-------....-...--.
ENSNLEP00000006856  ...........................................td----------.....---ECRL....N...QN.
ENSNLEP00000005978  ..........................................ckd----------.....-------....-...NG.
ENSNLEP00000010460  ......................................scrpgqh----------.....-------....-...--.
ENSNLEP00000001350  ...........................................ya----------.....-------....-...--.
ENSNLEP00000017678  ..................................gpcrcpaepap----------.....-------....-...--.
ENSNLEP00000010158  ............................................t----GTYCTE.....DVDECQL....M...PN.
ENSNLEP00000015550  .................................carttfsghtdy----------.....-------....-...--.
ENSNLEP00000004633  ...........................................hm----------.....-------....-...--.
ENSNLEP00000006645  .............................................-CKKGFKGYN.....CQVNIDE....Ca..SN.
ENSNLEP00000002755  ...........................................ca----------.....------L....N...TH.
ENSNLEP00000006645  ..........................................qld----------.....------E....Ca..SN.
ENSNLEP00000004222  .....................pcrpegcpahapcpapgistrdec----------.....-------....-...--.
ENSNLEP00000010165  .............................................-CLKGTTGPN.....CEINLDD....Ca..SS.
ENSNLEP00000006645  .............................................-CPVGFTGSF.....CLHEINE....Cs..SH.
ENSNLEP00000010165  .............................................VCPTGWQGQT.....CEVDINE....Cv..LS.
ENSNLEP00000008073  ....................................tpctcpwpp----------.....-------....-...--.
ENSNLEP00000010158  .............................................-CLKGTTGPN.....CEINLDD....Ca..SS.
ENSNLEP00000010158  .............................................VCPTGWQGQT.....CEVDINE....Cv..LS.
ENSNLEP00000004148  .............................................ECPPNFTGSN.....CEKKVDR....Ct..SN.
ENSNLEP00000019913  .............................................-CPPGWKGST.....CAVAKNSs...Cl..PN.
ENSNLEP00000014468  ............................................p----------.....-------....-...--.
ENSNLEP00000005978  ..........................................cea----------.....-------....-...-Q.
ENSNLEP00000001645  ...........................................di----------.....--DECGD....I...PA.
ENSNLEP00000002003  ...........................................ss----------.....-------....-...--.
ENSNLEP00000008103  ............................................e----------.....-------....Cl..SQ.
ENSNLEP00000008104  ............................................e----------.....-------....Cl..SQ.
ENSNLEP00000021658  ..........................................ehd----------.....---ECGS....G...QH.
ENSNLEP00000015039  .............................................----------.....-------....-...--.
ENSNLEP00000014046  ...........................................cv---SPKYGCN.....------F....N...NG.
ENSNLEP00000001645  ............................................p----------.....-------....-...-H.
ENSNLEP00000008103  ............................................n----------.....------P....Ce..SR.
ENSNLEP00000008104  ............................................n----------.....------P....Ce..SR.
ENSNLEP00000023327  .............................................-CCWGWARQS.....WG-QCQPv...C...QP.
ENSNLEP00000006645  ............................................t----GQFCTE.....DVDECLL....Q...PN.
ENSNLEP00000019757  ...........................................aq----------.....------T....C...PS.
ENSNLEP00000007155  ..........................................sds----------.....-------....-...--.
ENSNLEP00000019565  .............................................-CRPGFDLAQ.....NQKDCTLt...CnygNG.
ENSNLEP00000023327  .............................................----------.....-------....-...--.
ENSNLEP00000015898  .............................................----------.....-------....-...--.
ENSNLEP00000015039  ........................................qtidi----------.....-------....-...--.
ENSNLEP00000010165  ............................................d----------.....-------....Ct..ES.
ENSNLEP00000015155  ...........................................ca----------.....-------....-...--.
ENSNLEP00000021778  ..........................................sct----------.....EHDECIT....N...QH.
ENSNLEP00000016448  ...........................................gg----------.....-------....-...--.
ENSNLEP00000017005  .......................................ecgild----------.....-------....-...--.
ENSNLEP00000019565  ...........................................gq----------.....-------....-...--.
ENSNLEP00000017005  .............................................-CEPGYHAGLegtcdDVDECQD....Yg..PE.
ENSNLEP00000010158  ...........................................ce----------.....--NNTPD....Ct..ES.
ENSNLEP00000010591  ............................................i----------.....--NECLV....N...NG.
ENSNLEP00000005968  .............................................-CPLGFEGQR.....CEINPDD....Ce..DN.
ENSNLEP00000008103  .........................................ddci----------.....-------....-...AA.
ENSNLEP00000008104  .........................................ddci----------.....-------....-...AA.
ENSNLEP00000003215  .............................................RCPPGFTGDY.....CETEVDL....Cy..SR.
ENSNLEP00000005978  ............................................l----------.....-------....-...--.
ENSNLEP00000014067  .............................................KCSALYIGTH.....CEISVNP....Cs..SN.
ENSNLEP00000020776  ..........................................slq----------.....-------....-...--.
ENSNLEP00000019757  .........................................qaee----------.....-------....-...--.
ENSNLEP00000009644  ........................................qcfrg----------.....---RCHP....V...DG.
ENSNLEP00000019359  ..........................................aee----------.....-------....-...--.
ENSNLEP00000016629  ............................................l----------.....----CSP....D...LN.
ENSNLEP00000000509  .............................................---PGNFSCT.....DINECLTgr..V...CP.
ENSNLEP00000010596  ............................................i----------.....--NECLV....N...NG.
ENSNLEP00000003589  .............................................KCDNNQYFDI.....SALSCVP....C...GA.
ENSNLEP00000023948  .............................................-CNCSVVGSL.....DVNRCSQ....T...TG.
ENSNLEP00000020675  .............................................-CNCSVVGSL.....DVNRCSQ....T...TG.
ENSNLEP00000021306  ............................................s----------.....-------....-...--.
ENSNLEP00000010712  ...........................................dp----------.....-------....-...--.
ENSNLEP00000002921  ..........................................tse----------.....----CFP....C...KP.
ENSNLEP00000008103  .............................................----------.....-------....Ca..DS.
ENSNLEP00000008104  .............................................----------.....-------....Ca..DS.
ENSNLEP00000014749  ..........................................ess----------.....-------....-...--.
ENSNLEP00000010168  ............................................r----------.....-------....-...--.
ENSNLEP00000001003  ...........................................cs----------.....------P....D...TG.
ENSNLEP00000014272  .......................................pigkcs----------.....-------....-...--.
ENSNLEP00000004064  ............................................r----------.....-------....-...--.
ENSNLEP00000021941  ...........................................ea----------.....-------....-...--.
ENSNLEP00000018144  ..........................................vas----------.....-------....-...--.
ENSNLEP00000004631  ............................................r----------.....-------....-...--.
ENSNLEP00000015211  .......qcaskyddceggsvarcvhgicedsvreqagepkysci-CDAGWMSSP.....NSPACTLdrdeCsfqPG.
ENSNLEP00000013004  ........................................qaslk----------.....-------....-...--.
ENSNLEP00000009392  ............................................q----------.....-------....-...--.
ENSNLEP00000017897  ....................................csgdiwdqa----------.....-------....-...--.
ENSNLEP00000000606  .............................................----------.....-------....-...--.
ENSNLEP00000019939  ......................................vfgqfng----------.....--KSCTD....A...VG.
ENSNLEP00000016279  ...........................................ig----------.....-------....-...--.
ENSNLEP00000018144  ......................................aytsecf----------.....-------....-...--.
ENSNLEP00000021918  ........................................iqsfl----------.....------Y....C...NE.
ENSNLEP00000005978  .............................................-CAAGQQWAI.....DNDECLE....I...PE.
ENSNLEP00000002921  ..................................nvmngvasycr----------.....-------....-...--.
ENSNLEP00000011025  ..........................................pig----------.....-------....-...--.


                                       30                             40                            
                                        |                              |                            
d2dtge6               --Ve....RC...W-.THSHCQ..................K.V..CPTICKSH..G.C................T...
ENSNLEP00000000606  ECGek...GC...DG.PNADQClncvhfslgsvktsrkcvS.V..CPLGYFGD..T.T................A...
ENSNLEP00000002426  KCF.....HC...MG.PAEDQCqtcprnslllnttcv...K.D..CPEGYYAD..E.D................S...
ENSNLEP00000002426  DCL.....EC...SG.PKADDCelcsenswvlydglcl..E.E..CPAGTYYE..K.E................T...
ENSNLEP00000002426  SCL.....TC...NG.PGFKNC..................T.S..CPSGYLLD..L.GmcqmgaickdgeyvdeH...
ENSNLEP00000010151  SCA.....SC...SG.PTASHCtacsppktlrqghcl...P.H..CGEGFYSD..-.-................H...
ENSNLEP00000002426  ECSev...GC...DG.PGPDHCndclhyyyklknntricvS.S..CPPGHYHA..-.D................K...
ENSNLEP00000010151  SCA.....GC...WG.PTEKHClacrdplhvlrdggce..N.S..CGKGFYNR..-.-................Q...
ENSNLEP00000002426  ACE.....TC...TG.PAHDQC..................S.S..CREGLQLL..-.-................R...
ENSNLEP00000002426  NCE.....LC...--.HSVHVC..................T.R..CMKGYFIA..P.T................N...
ENSNLEP00000010151  HCG.....SC...--.DSQASCtscrdrnkvllfgecqy.E.S..CAPQYYLD..F.S................T...
ENSNLEP00000010419  LCSpe...GC...WG.PEPRDC..................V.S..CRNVSRGR..E.CvdkcnilegeprefveN...
ENSNLEP00000008878  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010151  LCQ.....HCaadLH.NTGSIClrcqnarylllgdhcv..P.D..CPSGYYAE..-.-................R...
ENSNLEP00000010925  GCSq....DC...QD.LPVSYK..................C.K..CWPGFQLK..D.D................G...
ENSNLEP00000002317  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000008780  LCSsd...GC...WG.PGPDQC..................L.S..CRRFSRGR..I.CiescnlydgefrefenG...
ENSNLEP00000001285  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000021313  LCSsg...GC...WG.PGPGQC..................L.S..CRNYSRGG..V.CvthcnflngeprefahE...
ENSNLEP00000002426  SCK.....GC...QG.PRPTDClscdrffflfrskgech.R.S..CPDHYYVE..Q.S................T...
ENSNLEP00000017341  GCAq....KC...QM.VRGVVQ..................C.T..CHTGYRLT..E.D................G...
ENSNLEP00000001645  VCTng...VC...VN.TDGSFR..................C.E..CPFGYSLD..F.T................G...
ENSNLEP00000019565  GCDh....FC...RN.TVGSFE..................C.G..CRKGYKLL..T.D................E...
ENSNLEP00000010419  SCPng...SC...WG.AGEENCqkltk.............I.I..CAQQCSGR..C.R................G...
ENSNLEP00000021313  VCKg....RC...WG.PGPEDCqtltk.............T.I..CAPQCNGH..C.F................G...
ENSNLEP00000002401  SCEg....HC...VN.TEGGFV..................C.E..CGPGMQLS..A.D................R...
ENSNLEP00000005281  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000001645  LCRgg...TC...AN.TDGSYK..................C.Q..CPPGHELT..A.E................G...
ENSNLEP00000021306  GCDh....FC...KN.TVGSFD..................C.S..CKKGFKLL..T.D................E...
ENSNLEP00000010151  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000008780  SCTg....RC...WG.PTENHCqtltr.............T.V..CAEQCDGR..C.Y................G...
ENSNLEP00000008875  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000004633  GCEh....EC...VN.ADGSYL..................C.Q..CREGFALN..P.D................K...
ENSNLEP00000015039  LCKng...RC...VN.TDGSFQ..................C.I..CNAGFELT..T.D................G...
ENSNLEP00000021907  PCSh....TC...HN.AMGTYY..................C.S..CPKGLTIA..A.D................G...
ENSNLEP00000007349  ICShg...QC...ID.TVGSFY..................C.L..CHTGFKTN..D.D................Q...
ENSNLEP00000015130  QCSrha..FC...TD.YATGFC..................C.H..CQSKFYGN..-.-................G...
ENSNLEP00000015039  ICSng...QC...IN.TDGSFR..................C.E..CPMGYNLD..Y.T................G...
ENSNLEP00000017005  VCGpg...RC...IS.RPSGYT..................C.A..CDSGFRLS..P.Q................G...
ENSNLEP00000001645  PCTf....LC...KN.TKGSFL..................C.S..CPRGYLLE..E.D................G...
ENSNLEP00000020776  PTQ.....IC...IN.TEGGYT..................C.S..CTDGYWLL..-.-................E...
ENSNLEP00000001645  --Rfg...HC...LN.TAGSFH..................C.L..CQDGFELT..A.D................G...
ENSNLEP00000002426  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000007349  LCRgg...VC...HN.TEGSYR..................C.E..CPPGHQLS..P.N................I...
ENSNLEP00000015039  VCShg...LC...VD.LQGSYQ..................C.I..CHNGFKAS..Q.D................Q...
ENSNLEP00000019565  DCHida..IC...QN.TPKSYK..................C.L..CKPGYKGE..-.-................G...
ENSNLEP00000007349  PCNf....IC...KN.TEGSYQ..................C.S..CPKGYILQ..E.D................G...
ENSNLEP00000001645  GCDv....HC...IN.TEGSYQ..................C.S..CGQGYLLM..P.D................G...
ENSNLEP00000017005  LCGrg...AC...KN.LPGSFH..................C.V..CPAGFRGS..A.C................E...
ENSNLEP00000003819  QCSvha..EC...RD.YATGFC..................C.S..CVAGYTGN..-.-................G...
ENSNLEP00000015039  ICAng...IC...EN.LRGSYR..................C.N..CNSGYEPD..A.S................G...
ENSNLEP00000010460  GCDh....IC...RN.TVGSFE..................C.S..CKKGYKLL..I.N................E...
ENSNLEP00000014132  KLFillerND...IR.QVGVCL..................P.S..CPPGYFDArnP.D................M...
ENSNLEP00000010925  NCQy....RC...TM.VRNSTR..................C.Y..CEDGFEIK..E.D................G...
ENSNLEP00000000953  -NY.....RC...W-.TTNRCQ..................K.M..CPSACGKR..A.C................T...
ENSNLEP00000001285  VCKgs...RC...WG.ESSEDCqsltr.............T.V..CAGGCARC..K.G................P...
ENSNLEP00000005364  VCA.....EL...VR.EPSCGC..................C.T..CALSEGQP..-.C................G...
ENSNLEP00000007349  ICNng...RC...IN.TDGSFH..................C.V..CNAGFHVT..R.D................G...
ENSNLEP00000007349  LCQng...RC...IP.TPGSYR..................C.E..CNKGFQLD..-.L................R...
ENSNLEP00000011454  YCHq....RC...VN.TPGSFY..................C.Q..CSPGFQLA..A.N................N...
ENSNLEP00000001645  VCAng...MC...EN.LRGSYR..................C.V..CNLGYEAG..A.S................G...
ENSNLEP00000007349  VCKhg...QC...IN.TDGSYR..................C.E..CPFGYILA..-.-................G...
ENSNLEP00000003819  PQRa....RC...IYtGGSSYT..................C.S..CLPGFSGD..-.-................G...
ENSNLEP00000017155  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000015039  PCNf....IC...KN.TEGSYQ..................C.S..CPRGYVLQ..E.D................G...
ENSNLEP00000019359  LCAhg...QC...RN.TEGSFQ..................C.V..CDQGYRAS..G.L................G...
ENSNLEP00000001645  LCLng...RC...LP.TPSSYR..................C.E..CNVGYTQD..-.V................R...
ENSNLEP00000007349  LCThg...KC...RN.TIGSFK..................C.R..CDSGFALD..S.E................E...
ENSNLEP00000007155  YCQh....RC...VN.LPGSFR..................C.Q..CEPGFQLG..P.N................N...
ENSNLEP00000015039  MCTyg...KC...RN.TIGSFK..................C.R..CNSGFALD..M.E................E...
ENSNLEP00000005810  NCQy....QC...HE.TPYGGA..................C.F..CPPGYIIN..HnD................S...
ENSNLEP00000001645  VCShg...DC...MD.TEGSYM..................C.L..CHRGFQAS..A.D................Q...
ENSNLEP00000011444  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000021306  DCHada..LC...QN.TPTSYK..................C.S..CKPGYQGE..-.-................G...
ENSNLEP00000001645  LCHlg...RC...VN.TKGSFQ..................C.V..CNAGFELS..P.D................G...
ENSNLEP00000015039  NCDmha..SC...LN.IPGSFK..................C.S..CREGWIGN..-.-................G...
ENSNLEP00000015039  GCDt....QC...TN.SEGSYE..................C.S..CSEGYALM..P.D................G...
ENSNLEP00000010925  PCGdda..YC...NQ.IKTSVF..................C.R..CKPGFQRN..M.K................N...
ENSNLEP00000020085  ECSh....DC...VL.TSEGPL..................C.F..CPEGSVLE..R.D................G...
ENSNLEP00000007349  GCEt....FC...TN.SEGSYE..................C.S..CQPGFALM..P.D................Q...
ENSNLEP00000020669  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000021907  ---.....IC...EN.TRGSYR..................C.V..CPRGYRSQ..G.V................G...
ENSNLEP00000010913  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000007349  LCGng...QC...LN.APGGYR..................C.E..CDMGFVPS..A.D................G...
ENSNLEP00000021510  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000017624  QCQnda..SC...RD.LVNGYR..................C.I..CPPGYAGD..H.C................E...
ENSNLEP00000004973  GCS.....RC...QQ.KLFFFLrregmrqygecl......H.S..CPSGYYGHraP.D................M...
ENSNLEP00000012621  GCLq....IC...HN.KLGSFH..................C.S..CHSGFELS..S.D................G...
ENSNLEP00000000477  --Ve....RC...W-.THSHCQ..................K.V..CPTICKSH..G.C................T...
ENSNLEP00000000484  --Ve....RC...W-.THSHCQ..................K.V..CPTICKSH..G.C................T...
ENSNLEP00000010925  GCSy....HCs..VV.PERGIV..................C.S..CPEGLQLN..K.D................N...
ENSNLEP00000002105  DGYm....SC...KD.GKASFT..................C.T..CKPGWQGE..K.C................E...
ENSNLEP00000005270  PCA.....RC...SG.PEESNC..................L.Q..CKKGWALH..-.-................H...
ENSNLEP00000011454  ---.....--...--.SNPSHR..................I.Q..CAAGYEQS..-.E................H...
ENSNLEP00000019757  VCGpg...TC...VN.LPDGYR..................C.V..CSPGYQLH..P.S................Q...
ENSNLEP00000023356  DGYm....SC...KD.GKASFT..................C.T..CKPGWQGE..K.C................E...
ENSNLEP00000005810  GCTh....EC...VQ.EPFGAK..................C.L..CPLGFLLA..N.D................S...
ENSNLEP00000016448  LCGh....KC...EN.TLGSYL..................C.S..CSVGFRLS..V.D................G...
ENSNLEP00000015087  NA-.....TC...TE.DEAITT..................C.T..CQEGFTGD..-.-................G...
ENSNLEP00000018039  -CW.....EC...AN.LEGQLCdldpsalfyg........H.-..--------..-.-................-...
ENSNLEP00000019913  QCQhgg..TC...KD.LVNGYQ..................C.V..CPRGFGGR..H.C................E...
ENSNLEP00000021201  PCLnna..VC...ED.QVGGFL..................C.K..CPPGFLGT..R.C................G...
ENSNLEP00000004633  GCEh....EC...IN.TEESYY..................C.R..CRRGYTLD..P.N................G...
ENSNLEP00000006856  ---.....-C...IN.FPGHYK..................C.N..CYPGYRLK..A.S................Rp..
ENSNLEP00000015740  ---.....--...--.------..................P.R..CPPGVSLV..R.D................G...
ENSNLEP00000000324  PCSnga..KC...VD.LGDAYL..................C.R..CQAGFSGR..H.C................D...
ENSNLEP00000001645  NCDsha..SC...LN.ILGSFS..................C.R..CLPGWVGD..-.-................G...
ENSNLEP00000016448  ---.....-C...QN.TLGSFRcrpk..............L.Q..CKSGFIQD..-.A................L...
ENSNLEP00000011548  PCHngg..TC...HN.LVGGFS..................C.S..CPDGFTGR..A.C................E...
ENSNLEP00000007349  RCQh....GC...QN.IIGGYR..................C.S..CPQGYLQH..Y.Q................W...
ENSNLEP00000019359  ICGag...HC...IN.LPVRYT..................C.I..CYEGYKFS..E.Q................Q...
ENSNLEP00000005978  ---.....--...--.------..................-.-..CARGYHAS..D.D................G...
ENSNLEP00000010158  PCQngg..TC...LD.LPNTYK..................C.S..CPRGTQGV..H.C................E...
ENSNLEP00000005952  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010165  PCQngg..TC...LD.LPNTYK..................C.S..CPRGTQGV..H.C................E...
ENSNLEP00000017005  ---.....-C...EN.TEGSFQ..................C.V..CPMGFQPN..A.A................G...
ENSNLEP00000019757  VCNgg...QC...TN.TEGSYH..................C.E..CDQGYIMV..-.R................K...
ENSNLEP00000006645  PCLndg..RC...ID.LVNGYQ..................C.N..CQPGTSGV..N.C................E...
ENSNLEP00000006645  PCEhag..KC...VN.TDGAFH..................C.E..CLKGYAGP..R.C................E...
ENSNLEP00000001905  PCQngg..TC...VE.GVNQYR..................C.I..CPPGRTGN..R.C................Q...
ENSNLEP00000010165  PCEhag..KC...IN.TLGSFE..................C.Q..CLQGYTGP..R.C................E...
ENSNLEP00000015039  RCQh....GC...QN.ILGGYR..................C.G..CPQGYIQH..Y.Q................W...
ENSNLEP00000007050  ---.....--...--.------..................-.R..CPLGVSLI..T.D................G...
ENSNLEP00000010158  PCEhag..KC...IN.TLGSFE..................C.Q..CLQGYTGP..R.C................E...
ENSNLEP00000015039  ---.....--...--.-----P..................Q.P..CRRGFIPN..I.R................T...
ENSNLEP00000011158  PCQh....RC...VN.THGSYK..................C.F..CLSGHMLM..-.P................D...
ENSNLEP00000016459  PCQnng..TC...YV.DGVHFT..................C.S..CSPGFTGP..T.C................A...
ENSNLEP00000001781  SCK.....TC...SG.LTNRDC..................G.E..CEVGWVLD..-.-................E...
ENSNLEP00000019359  -CGeg...HC...VN.TVGAFR..................C.Ey.CDSGYRMT..-.Q................R...
ENSNLEP00000019757  --G.....EC...LN.SHGSFF..................C.L..CAPGFVSA..E.G................G...
ENSNLEP00000006856  ICGhg...EC...VP.GPPDYS..................C.H..CNPGYRSH..P.Q................H...
ENSNLEP00000005978  PCKq....VC...ST.VGGSAI..................C.S..CFPGYAIM..A.D................G...
ENSNLEP00000010460  ---.....--...--.RAGTKC..................V.S..CPQGTYYH..G.Q................T...
ENSNLEP00000001350  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000017678  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010158  ACQngg..TC...HN.THGGYN..................C.V..CVNGWTGE..D.C................S...
ENSNLEP00000015550  ---.....RC...W-.-TSSHCqrv...............C.P..CPHGLA--..-.C................T...
ENSNLEP00000004633  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000006645  PCLnqg..TC...FD.DISGYT..................C.H..CVLPYTGK..N.C................Q...
ENSNLEP00000002755  GCEh....ICv..ND.RSGSYH..................C.E..CYEGYTLN..E.D................R...
ENSNLEP00000006645  PCQhga..TC...SD.FIGGYR..................C.E..CIPGYQGV..N.C................E...
ENSNLEP00000004222  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010165  PCDsg...TC...LD.KIDGYE..................C.A..CEPGYTGS..M.C................N...
ENSNLEP00000006645  PCLneg..TC...VD.GLGTYR..................C.S..CPLGYTGK..N.C................Q...
ENSNLEP00000010165  PCRhga..SC...QN.THGGYR..................C.H..CQAGYSGR..N.C................E...
ENSNLEP00000008073  ---.....--...--.------..................T.R..CPLGVPLV..L.D................G...
ENSNLEP00000010158  PCDsg...TC...LD.KIDGYE..................C.A..CEPGYTGD..M.C................N...
ENSNLEP00000010158  PCRhga..SC...QN.THGGYR..................C.H..CQAGYSGR..N.C................E...
ENSNLEP00000004148  PCAngg..QC...LN.RGPSRM..................C.R..CRPGFTGT..Y.C................E...
ENSNLEP00000019913  PCVngg..TC...VG.SGASFS..................C.I..CRDGWEGR..T.C................T...
ENSNLEP00000014468  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000005978  RCSq....EC...AN.IYGSYQ..................C.Y..CRQGYQLA..E.D................G...
ENSNLEP00000001645  ICAng...IC...IN.QIGSFR..................C.E..CPTGFNYN..S.I................L...
ENSNLEP00000002003  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000008103  PCHpg...TC...LD.LLATFH..................C.L..CPPGLEGQ..L.C................E...
ENSNLEP00000008104  PCHpg...TC...LD.LLATFH..................C.L..CPPGLEGQ..L.C................E...
ENSNLEP00000021658  NCDena..IC...TN.TVQGHS..................C.T..CKPGYVGN..-.-................G...
ENSNLEP00000015039  -CAf....RC...MN.TFGSYE..................C.T..CPIGYALR..E.D................Q...
ENSNLEP00000014046  GCHq....DCf..EG.GDGSFL..................C.G..CRPGFRLL..D.D................L...
ENSNLEP00000001645  RCQh....GC...QN.QLGGYR..................C.S..CPQGFTQH..S.Q................W...
ENSNLEP00000008103  PCQnga..TC...MA.QPSGYL..................C.Q..CAPGYDGQ..N.C................S...
ENSNLEP00000008104  PCQnga..TC...MA.QPSGYL..................C.Q..CAPGYDGQ..N.C................S...
ENSNLEP00000023327  RCKhg...EC...IG.PN---K..................C.K..CHPGYAGK..T.C................N...
ENSNLEP00000006645  ACQngg..TC...AN.RNGGYG..................C.V..CVNGWSGD..D.C................S...
ENSNLEP00000019757  PTPa....TC...QS.LAVLTC..................L.S..CRVPHRMQ..-.C................P...
ENSNLEP00000007155  ---.....--...--.-----Y..................T.E..CTDGYEWD..P.D................S...
ENSNLEP00000019565  GCQh....SC...ED.TDTGPM..................C.G..CHQKYALH..S.D................G...
ENSNLEP00000023327  ---.....--...--.------..................-.-..--PGLQLA..P.D................G...
ENSNLEP00000015898  ---.....--...--.------..................-.-..--PGLQLA..P.D................G...
ENSNLEP00000015039  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010165  SCFngg..TC...MD.GINSFT..................C.L..CPPGFTGS..Y.C................Q...
ENSNLEP00000015155  ---.....--...--.------..................-.-..--------..-.G................T...
ENSNLEP00000021778  NCDena..LC...FN.TVGGHN..................C.V..CKPGYTGN..-.-................G...
ENSNLEP00000016448  PCKq....QC...RD.TGDEVV..................C.S..CFVGYQLL..S.D................G...
ENSNLEP00000017005  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000019565  ---.....--...--.-----C..................V.P..CMPGTYQD..T.E................Gq..
ENSNLEP00000017005  ICGaq...RC...EN.TPGSYR..................C.TpaCDPGYQPT..-.P................G...
ENSNLEP00000010158  SCFngg..TC...MD.GINSFT..................C.L..CPPGFTGS..Y.C................Q...
ENSNLEP00000010591  GCSh....IC...KD.LVIGYE..................C.D..CAAGFELI..-.D................R...
ENSNLEP00000005968  DCEnna..TC...VD.GINNYV..................C.V..CPPNYTGE..L.C................D...
ENSNLEP00000008103  TCApgs..TC...ID.RVGSFS..................C.L..CPPGRTGL..L.C................H...
ENSNLEP00000008104  TCApgs..TC...ID.RVGSFS..................C.L..CPPGRTGL..L.C................H...
ENSNLEP00000003215  PCGphg..RC...RS.REGGYT..................C.L..CRDGYTGE..H.C................E...
ENSNLEP00000005978  ---.....--...--.------..................-.T..CEPGYALK..-.-................D...
ENSNLEP00000014067  PCLygg..TC...VV.DSGGFV..................C.Q..CRGLYTGQ..R.C................Q...
ENSNLEP00000020776  ---.....--...--.------..................A.Q..CTNGFDLD..R.Q................S...
ENSNLEP00000019757  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000009644  TCA.....CE...PG.YRGKYCr.................E.P..CPAGFYGL..G.C................R...
ENSNLEP00000019359  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000016629  PCQhea..QC...VG.TPDGPR..................C.E..CMPGYAGD..N.C................S...
ENSNLEP00000000509  EHS.....DC...VN.SMGSYN..................C.S..CQVGFISR..-.-................N...
ENSNLEP00000010596  GCSh....IC...KD.LVIGYE..................C.D..CAAGFELI..-.D................R...
ENSNLEP00000003589  NQRq....DA...--.--RGTS..................C.V..CLPGFQMI..S.N................Nggp
ENSNLEP00000023948  QCE.....CR...PG.YQGLHC..................E.T..CKEGFYLN..Y.T................S...
ENSNLEP00000020675  QCE.....CR...PG.YQGLHC..................E.T..CKEGFYLN..Y.T................S...
ENSNLEP00000021306  -CG.....VG...QG.HVENQC..................V.S..CRAGTYYD..G.A................Q...
ENSNLEP00000010712  ---.....--...--.-----C..................S.N..CPAGTFCD..N.Nr...............N...
ENSNLEP00000002921  GTYa....DK...--.QGSSFC..................K.L..CPANSYSN..K.G................E...
ENSNLEP00000008103  PCRnra..TC...QD.SPQGPR..................C.L..CPTGYTGG..S.C................Q...
ENSNLEP00000008104  PCRnra..TC...QD.SPQGPR..................C.L..CPTGYTGG..S.C................Q...
ENSNLEP00000014749  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000010168  ---.....--...--.------..................C.M..CKAGFEAV..E.N................G...
ENSNLEP00000001003  SCE.....SC...EP.GWNGTQ..................C.QqpCLPGTFGE..S.C................E...
ENSNLEP00000014272  -CN.....AG...YE.ERGFMC..................Q.A..CRPGFYKA..L.D................Gn..
ENSNLEP00000004064  ---.....--...--.------..................C.H..CEPGYEEG..G.S................G...
ENSNLEP00000021941  ---.....--...--.--SGYV..................C.I..CQPGFTGI..H.C................E...
ENSNLEP00000018144  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000004631  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000015211  PCStlv..QC...FN.TQGSFY..................CgA..CPTGWQGN..-.-................G...
ENSNLEP00000013004  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000009392  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000017897  ---.....SC...--.SSSTTCvrq...............A.Q..CGQDFQCK..-.E................T...
ENSNLEP00000000606  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000019939  DRR.....QC...VP.TE--PCedae..............D.D..CGNDFQCS..-.-................T...
ENSNLEP00000016279  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000018144  ---.....--...--.------..................-.-..--------..-.-................-...
ENSNLEP00000021918  NGL.....LG...SF.SEETHS..................C.T..CPNDQVVC..T.A................F...
ENSNLEP00000005978  SGMegn..VC...RT.AQRHCCvsylqe............K.S..CMAGVLGA..K.E................G...
ENSNLEP00000002921  PCA.....LE...AS.DVGSSC..................T.S..CPAGYYID..R.D................S...
ENSNLEP00000011025  ---.....--...--.------..................-.-..--------..-.-................-...


                         50                                                                         
                          |                                                                         
d2dtge6               .AEGL.........................................................................
ENSNLEP00000000606  .RRCR.........................................................................
ENSNLEP00000002426  .HRCA.........................................................................
ENSNLEP00000002426  .KECR.........................................................................
ENSNLEP00000002426  .GHCQ.........................................................................
ENSNLEP00000010151  .GVCK.........................................................................
ENSNLEP00000002426  .KRCR.........................................................................
ENSNLEP00000010151  .GTCS.........................................................................
ENSNLEP00000002426  .GVCVhatqtqeegkfwndilrksq.....................................................
ENSNLEP00000002426  .HTCRklecgqgevqdpdyeecv.......................................................
ENSNLEP00000010151  .NTCK.........................................................................
ENSNLEP00000010419  .SECI.........................................................................
ENSNLEP00000008878  .----.........................................................................
ENSNLEP00000010151  .GACK.........................................................................
ENSNLEP00000010925  .KTCV.........................................................................
ENSNLEP00000002317  .--CP.........................................................................
ENSNLEP00000008780  .SICV.........................................................................
ENSNLEP00000001285  .----.........................................................................
ENSNLEP00000021313  .AECF.........................................................................
ENSNLEP00000002426  .QTCE.........................................................................
ENSNLEP00000017341  .HTCQ.........................................................................
ENSNLEP00000001645  .INCV.........................................................................
ENSNLEP00000019565  .RTCQ.........................................................................
ENSNLEP00000010419  .KSPS.........................................................................
ENSNLEP00000021313  .PNPN.........................................................................
ENSNLEP00000002401  .HSCQ.........................................................................
ENSNLEP00000005281  .-QCA.........................................................................
ENSNLEP00000001645  .TACE.........................................................................
ENSNLEP00000021306  .KSCQ.........................................................................
ENSNLEP00000010151  .----.........................................................................
ENSNLEP00000008780  .PYVS.........................................................................
ENSNLEP00000008875  .----.........................................................................
ENSNLEP00000004633  .KTCT.........................................................................
ENSNLEP00000015039  .KNCV.........................................................................
ENSNLEP00000021907  .RTCQ.........................................................................
ENSNLEP00000007349  .TMCL.........................................................................
ENSNLEP00000015130  .KHCLpegaphrvngkvsghlhvghtpvhftdvdlhayivgndgraytaishipqpaaqallpltpigglfgwlfale
ENSNLEP00000015039  .VRCV.........................................................................
ENSNLEP00000017005  .TRCI.........................................................................
ENSNLEP00000001645  .RTCK.........................................................................
ENSNLEP00000020776  .GQCL.........................................................................
ENSNLEP00000001645  .KNCV.........................................................................
ENSNLEP00000002426  .----.........................................................................
ENSNLEP00000007349  .SACI.........................................................................
ENSNLEP00000015039  .TMCM.........................................................................
ENSNLEP00000019565  .KQCE.........................................................................
ENSNLEP00000007349  .RSCK.........................................................................
ENSNLEP00000001645  .RACA.........................................................................
ENSNLEP00000017005  .EDVD.........................................................................
ENSNLEP00000003819  .RQCVaegspqrvngkvkgrifvgssqtpivfentdlhsyvvmnhgrsytaistipetvgysllplapvggiigwmfa
ENSNLEP00000015039  .RNCI.........................................................................
ENSNLEP00000010460  .RNCQ.........................................................................
ENSNLEP00000014132  .NKCI.........................................................................
ENSNLEP00000010925  .RSCK.........................................................................
ENSNLEP00000000953  .ENNE.........................................................................
ENSNLEP00000001285  .LPTD.........................................................................
ENSNLEP00000005364  .IYTE.........................................................................
ENSNLEP00000007349  .KNCE.........................................................................
ENSNLEP00000007349  .GECI.........................................................................
ENSNLEP00000011454  .YTCV.........................................................................
ENSNLEP00000001645  .KDCT.........................................................................
ENSNLEP00000007349  .NECV.........................................................................
ENSNLEP00000003819  .QACQ.........................................................................
ENSNLEP00000017155  .----.........................................................................
ENSNLEP00000015039  .KTCK.........................................................................
ENSNLEP00000019359  .DHCE.........................................................................
ENSNLEP00000001645  .GECI.........................................................................
ENSNLEP00000007349  .RNCT.........................................................................
ENSNLEP00000007155  .RSCV.........................................................................
ENSNLEP00000015039  .RNCT.........................................................................
ENSNLEP00000005810  .RTCV.........................................................................
ENSNLEP00000001645  .TLCM.........................................................................
ENSNLEP00000011444  .----.........................................................................
ENSNLEP00000021306  .RQCE.........................................................................
ENSNLEP00000001645  .KKCV.........................................................................
ENSNLEP00000015039  .IKCI.........................................................................
ENSNLEP00000015039  .RSCA.........................................................................
ENSNLEP00000010925  .RQCE.........................................................................
ENSNLEP00000020085  .KTCS.........................................................................
ENSNLEP00000007349  .RSCT.........................................................................
ENSNLEP00000020669  .----.........................................................................
ENSNLEP00000021907  .RPCM.........................................................................
ENSNLEP00000010913  .----.........................................................................
ENSNLEP00000007349  .KACE.........................................................................
ENSNLEP00000021510  .----.........................................................................
ENSNLEP00000017624  .RDID.........................................................................
ENSNLEP00000004973  .NRCA.........................................................................
ENSNLEP00000012621  .RTCQ.........................................................................
ENSNLEP00000000477  .AEGL.........................................................................
ENSNLEP00000000484  .AEGL.........................................................................
ENSNLEP00000010925  .KTCE.........................................................................
ENSNLEP00000002105  .FDIN.........................................................................
ENSNLEP00000005270  .LKCV.........................................................................
ENSNLEP00000011454  .NVCQ.........................................................................
ENSNLEP00000019757  .AYCT.........................................................................
ENSNLEP00000023356  .FDIN.........................................................................
ENSNLEP00000005810  .KTCE.........................................................................
ENSNLEP00000016448  .RSCE.........................................................................
ENSNLEP00000015087  .LTCV.........................................................................
ENSNLEP00000018039  .----.........................................................................
ENSNLEP00000019913  .LERD.........................................................................
ENSNLEP00000021201  .KNVD.........................................................................
ENSNLEP00000004633  .KTCS.........................................................................
ENSNLEP00000006856  .PVCE.........................................................................
ENSNLEP00000015740  .CGCC.........................................................................
ENSNLEP00000000324  .DNVD.........................................................................
ENSNLEP00000001645  .FECH.........................................................................
ENSNLEP00000016448  .GNCI.........................................................................
ENSNLEP00000011548  .RDIN.........................................................................
ENSNLEP00000007349  .NQCV.........................................................................
ENSNLEP00000019359  .RKCV.........................................................................
ENSNLEP00000005978  .AKCV.........................................................................
ENSNLEP00000010158  .INLD.........................................................................
ENSNLEP00000005952  .----.........................................................................
ENSNLEP00000010165  .INLD.........................................................................
ENSNLEP00000017005  .SECE.........................................................................
ENSNLEP00000019757  .GHCQ.........................................................................
ENSNLEP00000006645  .INFD.........................................................................
ENSNLEP00000006645  .MDIN.........................................................................
ENSNLEP00000001905  .HQAQ.........................................................................
ENSNLEP00000010165  .IDVN.........................................................................
ENSNLEP00000015039  .NQCV.........................................................................
ENSNLEP00000007050  .CECC.........................................................................
ENSNLEP00000010158  .IDVN.........................................................................
ENSNLEP00000015039  .GACQ.........................................................................
ENSNLEP00000011158  .ATCV.........................................................................
ENSNLEP00000016459  .QLID.........................................................................
ENSNLEP00000001781  .GACV.........................................................................
ENSNLEP00000019359  .GRCE.........................................................................
ENSNLEP00000019757  .TSCQ.........................................................................
ENSNLEP00000006856  .RYCV.........................................................................
ENSNLEP00000005978  .VSCE.........................................................................
ENSNLEP00000010460  .EQCV.........................................................................
ENSNLEP00000001350  .---V.........................................................................
ENSNLEP00000017678  .----.........................................................................
ENSNLEP00000010158  .ENID.........................................................................
ENSNLEP00000015550  .ARGE.........................................................................
ENSNLEP00000004633  .--CS.........................................................................
ENSNLEP00000006645  .TVLA.........................................................................
ENSNLEP00000002755  .KTCS.........................................................................
ENSNLEP00000006645  .YEVD.........................................................................
ENSNLEP00000004222  .----.........................................................................
ENSNLEP00000010165  .INID.........................................................................
ENSNLEP00000006645  .TLVN.........................................................................
ENSNLEP00000010165  .TDID.........................................................................
ENSNLEP00000008073  .CGCC.........................................................................
ENSNLEP00000010158  .INID.........................................................................
ENSNLEP00000010158  .TDID.........................................................................
ENSNLEP00000004148  .RHVS.........................................................................
ENSNLEP00000019913  .HNTN.........................................................................
ENSNLEP00000014468  .----.........................................................................
ENSNLEP00000005978  .HTCT.........................................................................
ENSNLEP00000001645  .LACE.........................................................................
ENSNLEP00000002003  .----.........................................................................
ENSNLEP00000008103  .VETN.........................................................................
ENSNLEP00000008104  .VETN.........................................................................
ENSNLEP00000021658  .TICR.........................................................................
ENSNLEP00000015039  .KMCK.........................................................................
ENSNLEP00000014046  .VTCA.........................................................................
ENSNLEP00000001645  .AQCV.........................................................................
ENSNLEP00000008103  .KELD.........................................................................
ENSNLEP00000008104  .KELD.........................................................................
ENSNLEP00000023327  .QDLN.........................................................................
ENSNLEP00000006645  .ENID.........................................................................
ENSNLEP00000019757  .ISDV.........................................................................
ENSNLEP00000007155  .QHCR.........................................................................
ENSNLEP00000019565  .RTCI.........................................................................
ENSNLEP00000023327  .RTCV.........................................................................
ENSNLEP00000015898  .RTCV.........................................................................
ENSNLEP00000015039  .--CK.........................................................................
ENSNLEP00000010165  .HDVN.........................................................................
ENSNLEP00000015155  .NECL.........................................................................
ENSNLEP00000021778  .TTCK.........................................................................
ENSNLEP00000016448  .VSCE.........................................................................
ENSNLEP00000017005  .----.........................................................................
ENSNLEP00000019565  .LSCT.........................................................................
ENSNLEP00000017005  .GGCQ.........................................................................
ENSNLEP00000010158  .HDVN.........................................................................
ENSNLEP00000010591  .KTCG.........................................................................
ENSNLEP00000005968  .DVID.........................................................................
ENSNLEP00000008103  .LEDM.........................................................................
ENSNLEP00000008104  .LEDM.........................................................................
ENSNLEP00000003215  .VSAR.........................................................................
ENSNLEP00000005978  .GECE.........................................................................
ENSNLEP00000014067  .LSPY.........................................................................
ENSNLEP00000020776  .GQCL.........................................................................
ENSNLEP00000019757  .----.........................................................................
ENSNLEP00000009644  .RRCG.........................................................................
ENSNLEP00000019359  .----.........................................................................
ENSNLEP00000016629  .ENQD.........................................................................
ENSNLEP00000000509  .SICE.........................................................................
ENSNLEP00000010596  .KTCG.........................................................................
ENSNLEP00000003589  aIICK.........................................................................
ENSNLEP00000023948  .GLCQ.........................................................................
ENSNLEP00000020675  .GLCQ.........................................................................
ENSNLEP00000021306  .ERCI.........................................................................
ENSNLEP00000010712  .QICS.........................................................................
ENSNLEP00000002921  .TSCH.........................................................................
ENSNLEP00000008103  .TLMD.........................................................................
ENSNLEP00000008104  .TLMD.........................................................................
ENSNLEP00000014749  .----.........................................................................
ENSNLEP00000010168  .TVCR.........................................................................
ENSNLEP00000001003  .QQCL.........................................................................
ENSNLEP00000014272  .MKCA.........................................................................
ENSNLEP00000004064  .EECI.........................................................................
ENSNLEP00000021941  .EDVN.........................................................................
ENSNLEP00000018144  .----.........................................................................
ENSNLEP00000004631  .----.........................................................................
ENSNLEP00000015211  .YVCE.........................................................................
ENSNLEP00000013004  .----.........................................................................
ENSNLEP00000009392  .----.........................................................................
ENSNLEP00000017897  .GRCL.........................................................................
ENSNLEP00000000606  .--CG.........................................................................
ENSNLEP00000019939  .GRCI.........................................................................
ENSNLEP00000016279  .----.........................................................................
ENSNLEP00000018144  .----.........................................................................
ENSNLEP00000021918  .LPCT.........................................................................
ENSNLEP00000005978  .ETCG.........................................................................
ENSNLEP00000002921  .GTCH.........................................................................
ENSNLEP00000011025  .----.........................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  kpgsengfslagaafthdmevtfypgeervhitqtaegldpenylsiktniqgqvpyvpanftahispykelyhysds
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  veqdgfkngfsitggeftrqaevtfvghpghlvikqrfsgidehghltidtelegrvpqipfgssvhiepytelyhys
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000020085  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ..............................................................................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ..............................................................................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  ..............................................................................
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  ..............................................................................
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  tvtstssrdysltfgavnqtwsyrihqnityqvcrhaprrpsfpttqqlnvdrvfalyndeervlrfavtnqigpvke
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  tsvitssstreytvteperdgaspsrvytyqwrqtitfqecihddsrpalpstqqlsvdsvfvlynqeerilryalsn
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000020085  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ..............................................................................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ..............................................................................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  ..............................................................................
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  ..............................................................................
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                   60            70                 
                                                                    |             |                 
d2dtge6               ...............C...CHS.............ECL......GNCS..QPD..DPTKCV..AC.........RNFY
ENSNLEP00000000606  ...............R...CHK.............GCE......-TCT..GRG..-VTQCL..SCrr.......GFYH
ENSNLEP00000002426  ...............R...CHS.............SCR......-TCE..GRH..-SRQCH..SCrp.......GWFQ
ENSNLEP00000002426  ...............D...CHK.............SCL......-TCS..S--..-SGTCT..ACqk.......GLMM
ENSNLEP00000002426  ...............T...CEA.............SCA......-KCQ..GPT..-QEDCT..TCpm.......TRIF
ENSNLEP00000010151  ...............A...CHS.............SCL......-ACM..GPA..-PSHCT..GCkkpeeglqvE---
ENSNLEP00000002426  ...............K...CAP.............NCE......-SCF..GSH..-GDQCM..SCky.......GYFL
ENSNLEP00000010151  ...............A...CDQ.............SCE......-SCG..PS-..-SPRCL..TCte.......KTVL
ENSNLEP00000002426  ...............P...CHS.............SCK......-TCN..GS-..-ATLCT..SCpk.......GAYL
ENSNLEP00000002426  ...............P...CEE.............GCL......-GCS..LD-..DPGTCT..SCam.......GYYR
ENSNLEP00000010151  ...............E...CDW.............SCS......-ACS..GPL..-KTDCL..QCmd.......GYVL
ENSNLEP00000010419  ...............Q...CHP.............ECLpqvmn.ITCT..GQG..-PDNCI..QC.........AHYI
ENSNLEP00000008878  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000010151  ...............K...CHS.............SCR......-TCQ..GSG..-PFSCS..SCdt.......NLVL
ENSNLEP00000010925  ...............D...IDEcssdf........PCS......QQCI..NTY..GTYRC-..--.........----
ENSNLEP00000002317  ...............P...CSEekla.........RCRpp....VGCE..ELV..REPGC-..--.........----
ENSNLEP00000008780  ...............E...CDP.............QCEkmedglLTCH..GPG..-PDNCT..KC.........SHFK
ENSNLEP00000001285  ...............-...CHQ.............LCAr.....GHCW..GPG..-PTQCV..NC.........SQFL
ENSNLEP00000021313  ...............S...CHP.............ECQpmegt.ATCN..GSG..-SDTCA..QC.........AHFR
ENSNLEP00000002426  ...............R...CHP.............TCD......-QCK..GKG..-ALNCL..SCvw.......SYHL
ENSNLEP00000017341  ...............D...VNEcaeeg........YCS......QGCT..NSE..GAFQC-..--.........----
ENSNLEP00000001645  ...............D...IDEcsvgh........PCGq.....GTCT..NVI..GGFEC-..--.........----
ENSNLEP00000019565  ...............D...IDEcsfer........TCD......HICI..NSP..GSFQC-..--.........----
ENSNLEP00000010419  ...............Dc..CHN.............QCA......AGCT..GPR..-ESDCL..VC.........RKFR
ENSNLEP00000021313  ...............Qc..CHD.............ECA......GGCS..GPQ..-DTDCF..AC.........RHFN
ENSNLEP00000002401  ...............D...TDEclgt.........PCQ......QRCK..NSI..GSYKC-..--.........----
ENSNLEP00000005281  ...............P...CSAekla.........LCPpvp...ASCS..EVT..RSAGCG..CC.........----
ENSNLEP00000001645  ...............D...IDEcslrdg.......LCPh.....GQCV..NVI..GAFQC-..--.........----
ENSNLEP00000021306  ...............D...VDEcsldr........TCD......HSCI..NHP..GTFAC-..--.........----
ENSNLEP00000010151  ...............-...CHP.............DCL......-TCS..QS-..-PDHCD..LCqdp......TKLL
ENSNLEP00000008780  ...............Dc..CHR.............ECA......GGCS..GPK..-DTDCF..AC.........MNFN
ENSNLEP00000008875  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000004633  ...............K...INYcassnh.......GCQ......HECV..NTD..DSYSC-..--.........----
ENSNLEP00000015039  ...............D...HDEctttn........MCLn.....GMCI..NED..GSFKC-..--.........----
ENSNLEP00000021907  ...............D...IDEcalgrh.......TCHag....QDCD..NTI..GSYRC-..--.........----
ENSNLEP00000007349  ...............D...INEcerd.........ACGn.....GTCR..NTI..GSFNC-..--.........----
ENSNLEP00000015130  .......dsdptpvnP...CYDgsh..........MCDtt....ARCHp.GTG..VDYTC-..--.........----
ENSNLEP00000015039  ...............D...TDEcsign........PCGn.....GTCT..NVI..GSFEC-..--.........----
ENSNLEP00000017005  ...............D...VDEcrrvpp.......PCAp.....GRCE..NSP..GSFRC-..--.........----
ENSNLEP00000001645  ...............D...LDEctsrqh.......NCQ......FLCV..NTV..GAFTC-..--.........----
ENSNLEP00000020776  ...............D...IDEcryg.........YCQ......QLCA..NVP..GSYSC-..--.........----
ENSNLEP00000001645  ...............D...TNEclslag.......TCLp.....GTCQ..NLE..GSFRC-..--.........----
ENSNLEP00000002426  ...............-...CSS.............PCR......-TCE..GN-..-ATNCH..SCeg.......GLVL
ENSNLEP00000007349  ...............D...INEcelsah.......LCPn.....GRCV..NLI..GKYQC-..--.........----
ENSNLEP00000015039  ...............D...VDEcerh.........PCGn.....GTCK..NTV..GSYNC-..--.........----
ENSNLEP00000019565  ...............D...IDEcendyyng.....GCV......HECI..NIP..GNYRC-..--.........----
ENSNLEP00000007349  ...............D...LDEcatkqh.......NCQ......FLCV..NTI..GGFTC-..--.........----
ENSNLEP00000001645  ...............D...VDEceenpr.......VCDq.....GHCT..NMP..GGHRC-..--.........----
ENSNLEP00000017005  ...............E...CAQepp..........PCGp.....GRCD..NTA..GSFHC-..--.........----
ENSNLEP00000003819  sigpvregspdalqnP...CYIgth..........GCDtn....AACRp.GPR..TQFTC-..--.........----
ENSNLEP00000015039  ...............D...IDEclvnrl.......LCDn.....GLCR..NTP..GSYSC-..--.........----
ENSNLEP00000010460  ...............D...IDEcsfdr........TCD......HICV..NTP..GSFQC-..--.........----
ENSNLEP00000014132  ...............K...CKIe............HCE......-ACF..S--..-HNFCT..KCke.......GLYL
ENSNLEP00000010925  ...............D...QDEcavyg........TCS......QTCR..NTH..GSYIC-..--.........----
ENSNLEP00000000953  ...............C...CHP.............ECL......GSCS..APD..NDTACV..AC.........RHYY
ENSNLEP00000001285  ...............C...CHE.............QCA......AGCT..GPK..-HSDCL..AC.........LHFN
ENSNLEP00000005364  ...............R...CGSgl...........RC-......----..---..------..--.........----
ENSNLEP00000007349  ...............D...MDEcsirn........MCLn.....GMCI..NED..GSFKC-..--.........----
ENSNLEP00000007349  ...............D...VDEcekn.........PCAg.....GECI..NNQ..GSYTC-..--.........----
ENSNLEP00000011454  ...............D...INEcdasn........QCA......QQCY..NIL..GSFIC-..--.........----
ENSNLEP00000001645  ...............D...VDEcalnsl.......LCDn.....GWCQ..NSP..GSYSC-..--.........----
ENSNLEP00000007349  ...............D...TDEcsvgn........PCGn.....GTCK..NVI..GGFEC-..--.........----
ENSNLEP00000003819  ...............D...VDEcqps.........RCHpd....AFCY..NTP..GSFTC-..QCkp.......GYQG
ENSNLEP00000017155  ...............-...CQG.............GCA......-TCS..D--..-YNGCL..SCkp.......RLFF
ENSNLEP00000015039  ...............D...LDEcqtkqh.......NCQ......FLCV..NTL..GGFTC-..--.........----
ENSNLEP00000019359  ...............D...INEcledks.......VCQr.....GDCI..NTA..GSYDC-..--.........----
ENSNLEP00000001645  ...............D...VDEctss.........PCHh.....GDCV..NIP..GTYHC-..--.........----
ENSNLEP00000007349  ...............D...IDEcrispd.......LCGr.....GQCV..NTP..GDFEC-..--.........----
ENSNLEP00000007155  ...............D...VNEcdmga........PCE......QRCF..NSY..GTFLC-..--.........----
ENSNLEP00000015039  ...............D...IDEcrispd.......LCGs.....GICV..NTP..GSFEC-..--.........----
ENSNLEP00000005810  ...............EfddCQIwg...........ICD......QKCE..SRP..GHHLC-..--.........----
ENSNLEP00000001645  ...............D...IDEcdrq.........PCGn.....GTCK..NII..GSYNC-..--.........----
ENSNLEP00000011444  ...............-...---.............-CI......-ICS..E--..-ENGCS..TCqq.......RLFL
ENSNLEP00000021306  ...............D...IDEcgnelng......GCV......HDCL..NIP..GNYRC-..--.........----
ENSNLEP00000001645  ...............D...HNEcatst........TCVn.....GVCL..NED..GSFSC-..--.........----
ENSNLEP00000015039  ...............D...LDEcsngth.......QCSin....AQCV..NTP..GSYRC-..--.........----
ENSNLEP00000015039  ...............D...IDEcennpd.......ICDg.....GQCT..NIP..GEYRC-..--.........----
ENSNLEP00000010925  ...............D...LNEclvfg........TCS......HQCI..NVE..GSYKC-..VCdq.......NFQE
ENSNLEP00000020085  ...............G...CSSpdng.........GCS......QLCIplSPV..-SWEC-..--.........----
ENSNLEP00000007349  ...............D...IDEcednpn.......ICDg.....GQCT..NIP..GEYRC-..--.........----
ENSNLEP00000020669  ...............-...---.............-CE......----..---..------..--.........----
ENSNLEP00000021907  ...............D...IDEcentd........ACQ......HECK..NTF..GSYQC-..--.........----
ENSNLEP00000010913  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000007349  ...............D...IDEcslpn........ICVf.....GTCH..NLP..GLFRC-..--.........----
ENSNLEP00000021510  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000017624  ...............E...CASn............PCLng....GHCQ..NEI..NRFQC-..--.........----
ENSNLEP00000004973  ...............R...CRIe............NCD......-SCF..S--..-KDFCT..KCkv.......GFYL
ENSNLEP00000012621  ...............D...IDEcadse........ACGe.....ARCK..NLP..GSYSC-..--.........----
ENSNLEP00000000477  ...............C...CHS.............ECL......GNCS..EPD..DPTKCV..AC.........RNFY
ENSNLEP00000000484  ...............C...CHS.............ECL......GNCS..EPD..DPTKCV..AC.........RNFY
ENSNLEP00000010925  ...............I...VDYcsnhl........KCS......QVCE..QHK..RTVKC-..--.........----
ENSNLEP00000002105  ...............E...CKDpsning.......GCS......QICD..NTP..GSYHC-..--.........----
ENSNLEP00000005270  ...............D...IDEcgtega.......NCGad....QFCV..NTE..GSYECR..DCakacl....GCMG
ENSNLEP00000011454  ...............D...IDEctagth.......NCRad....QVCI..NLR..GSFAC-..--.........----
ENSNLEP00000019757  ...............D...DNEclrd.........PCKgk....GRCI..NRV..GSYSC-..--.........----
ENSNLEP00000023356  ...............E...CKDpsning.......GCS......QICD..NTP..GSYHC-..--.........----
ENSNLEP00000005810  ...............D...IDEcdipg........SCS......QHCY..NMR..GSFRC-..--.........----
ENSNLEP00000016448  ...............D...INEcsss.........PCS......QECA..NVY..GSYQC-..--.........----
ENSNLEP00000015087  ...............D...LDEcaipgah......NCSan....SSCV..NTP..GSFSC-..--.........----
ENSNLEP00000018039  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000019913  ...............E...CASs............PCHsg....GLCE..DLA..DGFHC-..--.........----
ENSNLEP00000021201  ...............E...CLSq............PCKng....ATCK..DGA..NSFRC-..--.........----
ENSNLEP00000004633  ...............R...VDHcaqqdh.......GCE......QLCL..NTE..DSFVC-..QCse.......GFLI
ENSNLEP00000006856  ...............D...IDEcrdps........SCPd.....GKCE..NKP..GSFKCI..--.........----
ENSNLEP00000015740  ...............Ki..CAKqpge.........I--......----..---..------..--.........----
ENSNLEP00000000324  ...............D...CASs............PCAng....GTCR..DSV..NDFSC-..--.........----
ENSNLEP00000001645  ...............D...LDEcisqeh.......RCSpr....GDCL..NVP..GSYRC-..--.........----
ENSNLEP00000016448  ...............D...INEclsisa.......PCPvg....HTCI..NTE..GSYTC-..--.........----
ENSNLEP00000011548  ...............E...CLQs............PCKna....AVCQ..NFP..GSFNC-..--.........----
ENSNLEP00000007349  ...............D...ENEclsah........ICGg.....ASCH..NTL..GSYKC-..--.........----
ENSNLEP00000019359  ...............D...IDEctqvqh.......LCSq.....GRCE..NTE..GSFLC-..--.........----
ENSNLEP00000005978  ...............D...VNEcetgvh.......RCSeg....QVCH..NLP..GSYRC-..--.........----
ENSNLEP00000010158  ...............D...CNPlvdpvsrsp....KCFnn....GTCV..DQV..GGYSC-..--.........----
ENSNLEP00000005952  ...............-...CPP.............QCP......GQCP..VTP..--P---..--.........----
ENSNLEP00000010165  ...............D...CNPlvdpvsrsp....KCFnn....GTCV..DQV..GGYSC-..--.........----
ENSNLEP00000017005  ...............D...VDEcenhl........ACPg.....QECV..NSP..GSFKCR..ACps.......GHHL
ENSNLEP00000019757  ...............D...INEcrhpg........TCPd.....GRCV..NSP..GSYTCL..--.........----
ENSNLEP00000006645  ...............D...CASn............PCIh.....GICM..DGI..NRYSC-..--.........----
ENSNLEP00000006645  ...............E...CHSd............PCQnd....ATCL..DKI..GGFTC-..--.........----
ENSNLEP00000001905  ...............T...AAPegsvagdsafs..RA-......PRCA..QVE..RAQHC-..--.........----
ENSNLEP00000010165  ...............E...CVSn............PCQnd....ATCL..DQI..GEFQC-..--.........----
ENSNLEP00000015039  ...............DeneCSNpn...........ACGs.....ASCY..NTL..GSYKC-..--.........----
ENSNLEP00000007050  ...............Km..CAQqlgd.........NCTea....AICD..---..------..--.........----
ENSNLEP00000010158  ...............E...CVSn............PCQnd....ATCL..DQI..GEFQC-..--.........----
ENSNLEP00000015039  ...............D...VDEcqaipg.......ICQg.....GNCI..NTV..GSFEC-..--.........----
ENSNLEP00000011158  ...............NsrtCAMi............NCQ......YGCE..DTE..EGPQC-..--.........----
ENSNLEP00000016459  ...............F...CALs............PCAh.....GTCR..SVG..TSYKC-..--.........----
ENSNLEP00000001781  ...............D...VDEcaaetp.......PCSaa....QFCK..NAN..GSYTC-..--.........----
ENSNLEP00000019359  ...............D...IDEclnps........TCPd.....EQCV..NSP..GSYQCV..PCte.......GFRG
ENSNLEP00000019757  ...............D...VDEcaatd........PCLg.....GHCV..NTE..GSFNC-..--.........----
ENSNLEP00000006856  ...............D...VNEceae.........PCGpgr...GICM..NTG..GSYNC-..--.........----
ENSNLEP00000005978  ...............D...QDEclmgah.......DCSrr....QFCV..NTL..GSFYC-..--.........----
ENSNLEP00000010460  ...............P...CPA.............G--......-TFQ..ERE..GQLSCD..LCpgsdah...GPLG
ENSNLEP00000001350  ...............D...CPQ.............HCDs.....SECK..S--..-SPRC-..--.........----
ENSNLEP00000017678  ...............-...---.............---......----..---..------..--.........----
ENSNLEP00000010158  ...............D...CASa............ACFhg....ATCH..DRV..ASFYC-..ECphgrt....GLLC
ENSNLEP00000015550  ...............C...CHT.............ECL......GGCS..QPE..DPRACV..AC.........RHLY
ENSNLEP00000004633  ...............T...LEH.............NCA......HFCI..NIP..GSYVC-..--.........----
ENSNLEP00000006645  ...............P...CSPn............PCEna....AVCK..ESSnfESYTC-..--.........----
ENSNLEP00000002755  ...............A...QDKcalgah.......GCQ......HICVn.DRT..GSHHC-..--.........----
ENSNLEP00000006645  ...............E...CQNq............PCQng....GTCI..DLV..NHFKC-..--.........----
ENSNLEP00000004222  ...............-...---.............GCC......ARCL..GAE..-GASC-..--.........----
ENSNLEP00000010165  ...............E...CAGn............PCHng....GTCE..DGI..NGFTC-..--.........----
ENSNLEP00000006645  ...............L...CSRs............PCKnk....GTCV..QKK..AESQC-..--.........----
ENSNLEP00000010165  ...............D...CRPn............PCHng....GSCT..DGI..NTAFC-..--.........----
ENSNLEP00000008073  ...............Rv..CARrlge.........PCDql....HVCD..ASQ..-GLVCQ..--.........----
ENSNLEP00000010158  ...............E...CAGn............PCHng....GTCE..DGI..NGFTC-..--.........----
ENSNLEP00000010158  ...............D...CRPn............PCHng....GSCT..DGI..NTAFC-..--.........----
ENSNLEP00000004148  ...............D...CARn............PCAhg....GTCH..DLE..NGLMC-..--.........----
ENSNLEP00000019913  ...............D...CNPl............PCYng....GICV..DGV..NWFRC-..--.........----
ENSNLEP00000014468  ...............-...CPA.............RCDv.....SRCP..SP-..------..--.........----
ENSNLEP00000005978  ...............D...IDEcaqgagi......LCT......FRCL..NVP..GSYQC-..--.........----
ENSNLEP00000001645  ...............D...VDEcgsres.......PCQqn....ADCI..NIP..GSYRC-..--.........----
ENSNLEP00000002003  ...............-...---.............---......-ACV..QRD..TEGLCQ..ACdg.......PAYI
ENSNLEP00000008103  ...............E...CASa............PCLnh....ADCH..DLL..NGFQC-..--.........----
ENSNLEP00000008104  ...............E...CASa............PCLnh....ADCH..DLL..NGFQC-..--.........----
ENSNLEP00000021658  ...............Af..CEE.............GCRyg....GTCV..A--..-PNKC-..--.........----
ENSNLEP00000015039  ...............D...LDEcaeglh.......DCEsrg...MMCK..NLI..GTFMC-..--.........----
ENSNLEP00000014046  ...............SrnpCSSs............PCRge....ATCIlgPHG..KNYTC-..--.........----
ENSNLEP00000001645  ...............D...ENEcalspp.......TCGs.....ASCR..NTL..GGFRC-..--.........----
ENSNLEP00000008103  ...............A...CQSq............PCHnh....GTCT..PKP..GGFHC-..--.........----
ENSNLEP00000008104  ...............A...CQSq............PCHnh....GTCT..PKP..GGFHC-..--.........----
ENSNLEP00000023327  ...............E...CGLkpr..........PCK......HRCM..NTY..GSYKC-..--.........----
ENSNLEP00000006645  ...............D...CAFa............SCTpg....STCI..DRV..ASFSC-..MCpegka....GLLC
ENSNLEP00000019757  ...............De..Y-Pqs...........SCLg.....GECK..NTV..GSYQC-..--.........----
ENSNLEP00000007155  ...............D...VNEcltipe.......ACKge....MKCI..NHY..GGYLC-..--.........----
ENSNLEP00000019565  ...............Et..CAVnkr..........GCN......WMCK..DTA..TGVRC-..--.........----
ENSNLEP00000023327  ...............D...VDEcatgra.......SCPrf....RQCA..NTF..GSYIC-..--.........----
ENSNLEP00000015898  ...............D...VDEcatgra.......SCPrf....RQCA..NTF..GSYIC-..--.........----
ENSNLEP00000015039  ...............H...HAN.............LCLn.....GRCI..PTV..SSYRC-..--.........----
ENSNLEP00000010165  ...............E...CDSq............PCLhg....GTCQ..DGC..GSYRC-..--.........----
ENSNLEP00000015155  ...............D...NNG.............GCS......HVCN..DLK..IGYEC-..--.........----
ENSNLEP00000021778  ...............Af..CKD.............GCRng....GACI..A--..-ANVC-..--.........----
ENSNLEP00000016448  ...............D...VNEcitgsh.......SCRlg....ESCI..NTV..GSFRC-..--.........----
ENSNLEP00000017005  ...............-...---.............GCTn.....GRCV..RVP..EGFTC-..--.........----
ENSNLEP00000019565  ...............P...YPSsdglglagarnvsE--......----..---..------..--.........----
ENSNLEP00000017005  ...............D...VDEcrnrs........FCGah....AVCQ..NLP..GSFQC-..--.........----
ENSNLEP00000010158  ...............E...CDSq............PCLhg....GTCQ..DGC..GSYRC-..--.........----
ENSNLEP00000010591  ...............D...IDEcqnpg........ICS......QICI..NLK..GGYKC-..--.........----
ENSNLEP00000005968  ...............H...CVEln...........LCQhe....AKCI..PLD..KGFRC-..--.........----
ENSNLEP00000008103  ...............C...LSQ.............PCHgd....AQCS..TNPltGSTLC-..--.........----
ENSNLEP00000008104  ...............C...LSQ.............PCHgd....AQCS..TNPltGSTLC-..--.........----
ENSNLEP00000003215  ...............Sgr.CTPg............VCKng....GTCV..NLLv.GGFKC-..--.........----
ENSNLEP00000005978  ...............D...VDEcamgth.......TCQag....FLCQ..NTK..GSFYC-..--.........----
ENSNLEP00000014067  ...............C...RDE.............PCKng....GTCF..DSL..DGAVC-..--.........----
ENSNLEP00000020776  ...............D...IDEcrtipe.......ACRgd....MMCV..NQN..GGYLC-..--.........----
ENSNLEP00000019757  ...............-...CGIln...........GCEn.....GRCV..RVR..EGYTC-..--.........----
ENSNLEP00000009644  ...............Q...CKGqq...........PCT......---V..---..AEGRCL..TC.........EPGW
ENSNLEP00000019359  ...............-...CGIln...........GCEn.....GRCV..RVQ..EGYTC-..--.........----
ENSNLEP00000016629  ...............D...CRDh............RCQng....AQCM..DEV..NSYSC-..--.........----
ENSNLEP00000000509  ...............D...VDEcadpr........ACPeh....ATCN..NTV..GNYSC-..--.........----
ENSNLEP00000010596  ...............D...IDEcqnpg........ICS......QICI..NLK..GGYKC-..--.........----
ENSNLEP00000003589  ...............K...CPK.............NMK......GVTE..D--..-GWNCI..SC.........PSGL
ENSNLEP00000023948  ...............P...CDCsphga........LS-......ILCN..S--..-SGKC-..QC.........KVGV
ENSNLEP00000020675  ...............P...CDCsphga........LS-......ILCN..S--..-SGKC-..QC.........KVGV
ENSNLEP00000021306  ...............L...CPN.............G--......-IFQ..NEE..GQITCE..PCsrpgns...G---
ENSNLEP00000010712  ...............P...CPP.............N--......-SFS..SAG..GQRTCD..ICrqck.....GVFR
ENSNLEP00000002921  ...............Q...CDPdkysekgss....SCNmr....PACT..DKD..YFYTHT..AC.........----
ENSNLEP00000008103  ...............L...CAQk............PCPrn....SHCL..QTG..PSFHC-..--.........----
ENSNLEP00000008104  ...............L...CAQk............PCPrn....SHCL..QTG..PSFHC-..--.........----
ENSNLEP00000014749  ...............-...---.............---......-GCK..TLT..SSQACV..VCee.......GFSL
ENSNLEP00000010168  ...............G...CPS.............G--......-TFK..ANQ..GDEACT..HCpin......S-RT
ENSNLEP00000001003  ...............H...CQHge...........ACE......----..--P..DTGHCQ..RC.........DPGW
ENSNLEP00000014272  ...............K...CPP.............HSS......-T--..QED..GSMNC-..--.........----
ENSNLEP00000004064  ...............A...CPS.............GSY......---R..TDM..DTPHCL..TCp........QHST
ENSNLEP00000021941  ...............E...CSSn............PCQng....GTCE..NLP..GNYTC-..--.........----
ENSNLEP00000018144  ...............-...---.............---......----..---..---SCR..ACal.......GSEQ
ENSNLEP00000004631  ...............-...---.............---......----..---..----C-..--.........----
ENSNLEP00000015211  ...............D...INEceinng.......GCSvapp..VECV..NTP..GSSHCQ..--.........----
ENSNLEP00000013004  ...............S...CPR.............PAS......-VCS..S--..-SVNCRpeLCl........GYVC
ENSNLEP00000009392  ...............-...---.............---......----..---..----C-..--.........----
ENSNLEP00000017897  ...............K...RHL.............MCNgd....QDCL..DGS..DEEDCE..--.........DVRA
ENSNLEP00000000606  ...............E...CHH.............TCG......-TCV..GPG..-REECI..HCak.......NFHF
ENSNLEP00000019939  ...............K...RRL.............QCNgd....NDCG..DFS..DEDDC-..--.........----
ENSNLEP00000016279  ...............-...---.............---......----..---..---KC-..ICka.......GYQQ
ENSNLEP00000018144  ...............-...---.............PCKp.....GTFS..NKP..GSFNCQ..VCpr.......NTYS
ENSNLEP00000021918  ...............V...GDAs............ACL......-TCA..PDN..-RTRCG..TCnt.......GYML
ENSNLEP00000005978  ...............A...EDNd............TCG......----..VSL..YKQCC-..DCcgl......GLRV
ENSNLEP00000002921  ...............S...CPA.............NTI......LKAH..QPY..GVQACV..PCgp.......GTKN
ENSNLEP00000011025  ...............-...---.............---......----..---..---KC-..MCka.......GYEE


                                     80                                                             
                                      |                                                             
d2dtge6               L...D........G..RCVE..................................................TCP.....
ENSNLEP00000000606  Hqe.M........N..TCVT..................................................LCP.....
ENSNLEP00000002426  L...G........K..ECLL..................................................QCR.....
ENSNLEP00000002426  Np..R........G..SCTAnk................................................KCT.....
ENSNLEP00000002426  D...D........G..RCVS..................................................NCP.....
ENSNLEP00000010151  -...QlsgagipsG..ECLA..................................................QCR.....
ENSNLEP00000002426  Nee.T........N..SCVT..................................................HCP.....
ENSNLEP00000010151  H...D........G..KCMS..................................................ECP.....
ENSNLEP00000002426  L...A........Q..ACVS..................................................SCP.....
ENSNLEP00000002426  F...D........H..HCYK..................................................TCP.....
ENSNLEP00000010151  Q...D........G..ACVE..................................................QCL.....
ENSNLEP00000010419  D...G........P..HCVK..................................................TCP.....
ENSNLEP00000008878  -...-........-..----..................................................---.....
ENSNLEP00000010151  Sh..T........G..TCST..................................................TCF.....
ENSNLEP00000010925  -...-........-..----..................................................LCT.....
ENSNLEP00000002317  -...-........-..----..................................................---.....
ENSNLEP00000008780  D...G........P..NCVE..................................................KCP.....
ENSNLEP00000001285  R...G........Q..ECVE..................................................ECRvlqgl
ENSNLEP00000021313  D...G........P..HCVS..................................................SCP.....
ENSNLEP00000002426  M...G........G..ICTS..................................................DCL.....
ENSNLEP00000017341  -...-........-..----..................................................WCE.....
ENSNLEP00000001645  -...-........-..----..................................................ACP.....
ENSNLEP00000019565  -...-........-..----..................................................LCH.....
ENSNLEP00000010419  D...E........A..TCKD..................................................TCP.....
ENSNLEP00000021313  D...S........G..ACVP..................................................RCP.....
ENSNLEP00000002401  -...-........-..----..................................................SCR.....
ENSNLEP00000005281  -...-........-..----..................................................---.....
ENSNLEP00000001645  -...-........-..----..................................................SCR.....
ENSNLEP00000021306  -...-........-..----..................................................ACN.....
ENSNLEP00000010151  Q...N........G..RCVH..................................................SCG.....
ENSNLEP00000008780  D...S........G..ACVT..................................................QCP.....
ENSNLEP00000008875  -...-........-..----..................................................---.....
ENSNLEP00000004633  -...-........-..----..................................................RCL.....
ENSNLEP00000015039  -...-........-..----..................................................ICK.....
ENSNLEP00000021907  -...-........-..--VV..................................................RCG.....
ENSNLEP00000007349  -...-........-..----..................................................RCN.....
ENSNLEP00000015130  -...-........-..----..................................................ECA.....
ENSNLEP00000015039  -...-........-..----..................................................NCN.....
ENSNLEP00000017005  -...-........-..----..................................................VCG.....
ENSNLEP00000001645  -...-........-..----..................................................RCP.....
ENSNLEP00000020776  -...-........-..----..................................................TCN.....
ENSNLEP00000001645  -...-........-..----..................................................ICP.....
ENSNLEP00000002426  H...H........R..VCQE..................................................TCP.....
ENSNLEP00000007349  -...-........-..----..................................................ACN.....
ENSNLEP00000015039  -...-........-..----..................................................LCY.....
ENSNLEP00000019565  -...-........-..----..................................................TCF.....
ENSNLEP00000007349  -...-........-..----..................................................KCP.....
ENSNLEP00000001645  -...-........-..----..................................................LCY.....
ENSNLEP00000017005  -...-........-..----..................................................ACP.....
ENSNLEP00000003819  -...-........-..----..................................................ECS.....
ENSNLEP00000015039  -...-........-..----..................................................TCP.....
ENSNLEP00000010460  -...-........-..----..................................................LCH.....
ENSNLEP00000014132  H...K........G..RCYP..................................................ACP.....
ENSNLEP00000010925  -...-........-..----..................................................SCV.....
ENSNLEP00000000953  Y...A........G..VCVP..................................................ACP.....
ENSNLEP00000001285  H...S........G..ICEL..................................................HCP.....
ENSNLEP00000005364  -...-........-..----..................................................---.....
ENSNLEP00000007349  -...-........-..----..................................................ICK.....
ENSNLEP00000007349  -...-........-..----..................................................QCR.....
ENSNLEP00000011454  -...-........-..----..................................................QCN.....
ENSNLEP00000001645  -...-........-..----..................................................SCP.....
ENSNLEP00000007349  -...-........-..----..................................................TCE.....
ENSNLEP00000003819  D...G........F..RCVPgevektrcqherehilgaagaadpqrpippglfvp...............ECD.....
ENSNLEP00000017155  Al..Erigmkqi.G..VCLS..................................................SCP.....
ENSNLEP00000015039  -...-........-..----..................................................KCP.....
ENSNLEP00000019359  -...-........-..----..................................................TCP.....
ENSNLEP00000001645  -...-........-..----..................................................RCY.....
ENSNLEP00000007349  -...-........-..----..................................................KCD.....
ENSNLEP00000007155  -...-........-..----..................................................RCH.....
ENSNLEP00000015039  -...-........-..----..................................................ECF.....
ENSNLEP00000005810  -...-........-..----..................................................HCE.....
ENSNLEP00000001645  -...-........-..----..................................................LCF.....
ENSNLEP00000011444  FirrEgirqy...G..KCLH..................................................DCP.....
ENSNLEP00000021306  -...-........-..----..................................................TCF.....
ENSNLEP00000001645  -...-........-..----..................................................LCK.....
ENSNLEP00000015039  -...-........-..----..................................................ACS.....
ENSNLEP00000015039  -...-........-..----..................................................LCY.....
ENSNLEP00000010925  R...N........N..TCIAkgsedqvlyiandtdilgf...............................IYP.....
ENSNLEP00000020085  -...-........-..----..................................................DCF.....
ENSNLEP00000007349  -...-........-..----..................................................LCY.....
ENSNLEP00000020669  -...-........-..---Pa.................................................RCP.....
ENSNLEP00000021907  -...-........-..----..................................................ICP.....
ENSNLEP00000010913  -...-........-..----..................................................-CL.....
ENSNLEP00000007349  -...-........-..----..................................................ECE.....
ENSNLEP00000021510  -...-........-..----..................................................---.....
ENSNLEP00000017624  -...-........-..----..................................................LCP.....
ENSNLEP00000004973  H...R........G..RCFD..................................................ECP.....
ENSNLEP00000012621  -...-........-..----..................................................LCD.....
ENSNLEP00000000477  L...D........G..RCVE..................................................TCP.....
ENSNLEP00000000484  L...D........G..RCVE..................................................TCP.....
ENSNLEP00000010925  -...-........-..----..................................................SCY.....
ENSNLEP00000002105  -...-........-..----..................................................SCK.....
ENSNLEP00000005270  Ag..P........G..RCK-..................................................KCS.....
ENSNLEP00000011454  -...-........-..----..................................................QCP.....
ENSNLEP00000019757  -...-........-..----..................................................FCY.....
ENSNLEP00000023356  -...-........-..----..................................................SCK.....
ENSNLEP00000005810  -...-........-..----..................................................SCD.....
ENSNLEP00000016448  -...-........-..----..................................................YCR.....
ENSNLEP00000015087  -...-........-..----..................................................VCP.....
ENSNLEP00000018039  -...-........-..----..................................................---.....
ENSNLEP00000019913  -...-........-..----..................................................HCP.....
ENSNLEP00000021201  -...-........-..----..................................................LCA.....
ENSNLEP00000004633  N...E........DlkTCSRvdycllsdhgceyscvnmdrsfac..........................QCP.....
ENSNLEP00000006856  -...-........-..----..................................................ACQ.....
ENSNLEP00000015740  -...-........-..----..................................................---.....
ENSNLEP00000000324  -...-........-..----..................................................TCP.....
ENSNLEP00000001645  -...-........-..----..................................................TCR.....
ENSNLEP00000016448  -...-........Q..KNVP..................................................NCG.....
ENSNLEP00000011548  -...-........-..----..................................................VCK.....
ENSNLEP00000007349  -...-........-..----..................................................MCP.....
ENSNLEP00000019359  -...-........-..----..................................................ICP.....
ENSNLEP00000005978  -...-........-..----..................................................DCK.....
ENSNLEP00000010158  -...-........-..----..................................................TCP.....
ENSNLEP00000005952  -...-........-..----..................................................TCA.....
ENSNLEP00000010165  -...-........-..----..................................................TCP.....
ENSNLEP00000017005  H...R........G..RCTDvdecssgappcgphghctntegsfrc........................SCA.....
ENSNLEP00000019757  -...-........-..----..................................................ACE.....
ENSNLEP00000006645  -...-........-..----..................................................VCS.....
ENSNLEP00000006645  -...-........-..----..................................................LCM.....
ENSNLEP00000001905  -...-........-..----..................................................SCE.....
ENSNLEP00000010165  -...-........-..----..................................................ICM.....
ENSNLEP00000015039  -...-........-..----..................................................ACP.....
ENSNLEP00000007050  -...-........-..----..................................................---.....
ENSNLEP00000010158  -...-........-..----..................................................ICM.....
ENSNLEP00000015039  -...-........-..----..................................................RCP.....
ENSNLEP00000011158  -...-........-..----..................................................LCPs....
ENSNLEP00000016459  -...-........-..----..................................................LCD.....
ENSNLEP00000001781  -...-........-..----..................................................---.....
ENSNLEP00000019359  W...N........G..QCLDvdeclepnvctngdcsnlegsymc..........................SCH.....
ENSNLEP00000019757  -...-........-..----..................................................LCE.....
ENSNLEP00000006856  -...-........-..----..................................................HCN.....
ENSNLEP00000005978  V...N........H..TV--..................................................LCA.....
ENSNLEP00000010460  A...T........NvtTCAG..................................................QCP.....
ENSNLEP00000001350  -...-........-..----..................................................---.....
ENSNLEP00000017678  -...-........-..----..................................................RCP.....
ENSNLEP00000010158  Hl..N........D..ACISnpcnegsncdtnpvngkaic..............................TCP.....
ENSNLEP00000015550  F...Q........G..ACLW..................................................ACP.....
ENSNLEP00000004633  -...-........-..----..................................................RCK.....
ENSNLEP00000006645  -...-........-..----..................................................LCA.....
ENSNLEP00000002755  -...-........-..----..................................................ECY.....
ENSNLEP00000006645  -...-........-..----..................................................SCP.....
ENSNLEP00000004222  -...G........G..RAGA..................................................RCG.....
ENSNLEP00000010165  -...-........-..----..................................................RCP.....
ENSNLEP00000006645  -...-........-..----..................................................LCP.....
ENSNLEP00000010165  -...-........-..----..................................................DCL.....
ENSNLEP00000008073  -...-........-..----..................................................---.....
ENSNLEP00000010158  -...-........-..----..................................................RCP.....
ENSNLEP00000010158  -...-........-..----..................................................DCL.....
ENSNLEP00000004148  -...-........-..----..................................................TCP.....
ENSNLEP00000019913  -...-........-..----..................................................ECA.....
ENSNLEP00000014468  -...-........-..----..................................................RCP.....
ENSNLEP00000005978  -...-........-..----..................................................ACPe....
ENSNLEP00000001645  -...-........-..----..................................................KCT.....
ENSNLEP00000002003  L...G........Q..LCLA..................................................YCP.....
ENSNLEP00000008103  -...-........-..----..................................................ICL.....
ENSNLEP00000008104  -...-........-..----..................................................ICL.....
ENSNLEP00000021658  -...-........-..----..................................................VCP.....
ENSNLEP00000015039  -...-........-..----..................................................ICP.....
ENSNLEP00000014046  -...-........-..----..................................................RCP.....
ENSNLEP00000001645  -...-........-..----..................................................VCP.....
ENSNLEP00000008103  -...-........-..----..................................................ACP.....
ENSNLEP00000008104  -...-........-..----..................................................ACP.....
ENSNLEP00000023327  -...-........-..----..................................................YCL.....
ENSNLEP00000006645  Hl..D........D..ACISnpchkgalcdtnplngqyic..............................TCP.....
ENSNLEP00000019757  -...-........-..----..................................................LCP.....
ENSNLEP00000007155  -...-........-..--LPrsaavindlhgegppppvppaqhpn.........................PCP.....
ENSNLEP00000019565  -...-........-..----..................................................SCP.....
ENSNLEP00000023327  -...-........-..----..................................................KCH.....
ENSNLEP00000015898  -...-........-..----..................................................KCH.....
ENSNLEP00000015039  -...-........-..----..................................................ECN.....
ENSNLEP00000010165  -...-........-..----..................................................TCP.....
ENSNLEP00000015155  -...-........-..----..................................................LCP.....
ENSNLEP00000021778  -...-........-..----..................................................ACP.....
ENSNLEP00000016448  -...-........-..QRDS..................................................SCG.....
ENSNLEP00000017005  -...-........-..----..................................................RCF.....
ENSNLEP00000019565  -...-........-..-CGG..................................................QCS.....
ENSNLEP00000017005  -...-........-..----..................................................LCD.....
ENSNLEP00000010158  -...-........-..----..................................................TCP.....
ENSNLEP00000010591  -...-........-..----..................................................ECS.....
ENSNLEP00000005968  -...-........-..----..................................................ECV.....
ENSNLEP00000008103  -...-........-..----..................................................LCQ.....
ENSNLEP00000008104  -...-........-..----..................................................LCQ.....
ENSNLEP00000003215  -...-........-..----..................................................DCP.....
ENSNLEP00000005978  -...-........-..QARQ..................................................RCM.....
ENSNLEP00000014067  -...-........-..----..................................................QCD.....
ENSNLEP00000020776  -...-........-..--IPrtnpvyrgpysnpysnpysgpypaaapplsapnyptisrpl.........ICR.....
ENSNLEP00000019757  -...-........-..----..................................................DCF.....
ENSNLEP00000009644  N...G........T..KCDQ..................................................PCA.....
ENSNLEP00000019359  -...-........-..----..................................................DCF.....
ENSNLEP00000016629  -...-........-..----..................................................LCA.....
ENSNLEP00000000509  -...-........-..----..................................................FCN.....
ENSNLEP00000010596  -...-........-..----..................................................ECS.....
ENSNLEP00000003589  Ta..E........G..KCH-..................................................-CP.....
ENSNLEP00000023948  I...G........S..TCD-..................................................RCQ.....
ENSNLEP00000020675  I...G........S..TCD-..................................................RCQ.....
ENSNLEP00000021306  Al..Ktpeawnv.S..ECGG..................................................LCQ.....
ENSNLEP00000010712  T...R........K..ECSStsnaec............................................DCI.....
ENSNLEP00000002921  -...-........-..--DAngetqlmykwakpkicsedlegavklpasgmkthcp..............PCN.....
ENSNLEP00000008103  -...-........-..----..................................................LCL.....
ENSNLEP00000008104  -...-........-..----..................................................LCL.....
ENSNLEP00000014749  H...Q........K..SCVQ..................................................HCP.....
ENSNLEP00000010168  Ts..E........GatNCV-..................................................-CR.....
ENSNLEP00000001003  L...G........P..RCED..................................................LCP.....
ENSNLEP00000014272  -...-........-..----..................................................RCE.....
ENSNLEP00000004064  Aes.E........G..ATIC..................................................TCE.....
ENSNLEP00000021941  -...-........-..----..................................................HCPfdnl.
ENSNLEP00000018144  S...G........S..SCV-..................................................PCP.....
ENSNLEP00000004631  -...-........-..----..................................................TCK.....
ENSNLEP00000015211  -...-........-..----..................................................ACP.....
ENSNLEP00000013004  Q...P........M..ACLPsvcmpttfqpa.......................................SCL.....
ENSNLEP00000009392  -...-........-..----..................................................LCQ.....
ENSNLEP00000017897  I...D........E..DCSQyepipgsqkaalgyniltqedaqsvydanyyggqcetvyngewrelrydsTCE.....
ENSNLEP00000000606  Q...D........W..KCVP..................................................ACG.....
ENSNLEP00000019939  -...-........-..----..................................................---.....
ENSNLEP00000016279  K...G........D..TCE-..................................................PCG.....
ENSNLEP00000018144  Ekg.A........K..ECI-..................................................RCK.....
ENSNLEP00000021918  S...Q........G..LCK-..................................................---.....
ENSNLEP00000005978  Rae.G........Q..SCES..................................................NPN.....
ENSNLEP00000002921  Nki.H........S..LCYN..................................................DC-.....
ENSNLEP00000011025  K...N........G..TCQ-..................................................VCR.....


                        90                                                                          
                         |                                                                          
d2dtge6               PPYYHFQDWR........C...........................................................
ENSNLEP00000000606  AGFYADESQ-........-...........................................................
ENSNLEP00000002426  EGYYADNST-........-...........................................................
ENSNLEP00000002426  PSEYWDEDA-........-...........................................................
ENSNLEP00000002426  SWKFEFE---........-...........................................................
ENSNLEP00000010151  AHFYLEST--........-...........................................................
ENSNLEP00000002426  DGSYQDTKK-........-...........................................................
ENSNLEP00000010151  GRYYADAT--........-...........................................................
ENSNLEP00000002426  QGTWPSIRS-........-...........................................................
ENSNLEP00000002426  EKTYSEE---........-...........................................................
ENSNLEP00000010151  SSFYQDS---........-...........................................................
ENSNLEP00000010419  AGVMGENNTLvwky....A...........................................................
ENSNLEP00000008878  ----------........-...........................................................
ENSNLEP00000010151  PGHYLDDN--........-...........................................................
ENSNLEP00000010925  DGYEIQPDNPng......Ckslsdeepfliladhheirkistdgsnytllkqglnnviaidfdyreefiywidssrpn
ENSNLEP00000002317  ----------........-...........................................................
ENSNLEP00000008780  DGLQGANSFIfky.....A...........................................................
ENSNLEP00000001285  PREYVNA---........-...........................................................
ENSNLEP00000021313  HGVLGAKGPIyky.....P...........................................................
ENSNLEP00000002426  VGEYRVGEG-........-...........................................................
ENSNLEP00000017341  TGYELRPDRRs.......Ckalgpepvllfanridirqvlphrseytlllnnlenaialdfhhrrelvfwsdvtldri
ENSNLEP00000001645  DGFEPGPMMT........C...........................................................
ENSNLEP00000019565  RGYILYGTTH........C...........................................................
ENSNLEP00000010419  PLMLYNPTTY........Q...........................................................
ENSNLEP00000021313  QPLVYNKLTF........Q...........................................................
ENSNLEP00000002401  TGFHLHGNRHs.......C...........................................................
ENSNLEP00000005281  ----------........-...........................................................
ENSNLEP00000001645  AGFQGTPDRQg.......C...........................................................
ENSNLEP00000021306  RGYTLYGFTH........C...........................................................
ENSNLEP00000010151  LGFYQAG---........-...........................................................
ENSNLEP00000008780  QTFVYNPTTF........Q...........................................................
ENSNLEP00000008875  ----------........C...........................................................
ENSNLEP00000004633  KGFTLNPDKKt.......C...........................................................
ENSNLEP00000015039  PGFVLAPNGRy.......C...........................................................
ENSNLEP00000021907  SGFQRTSDGLs.......C...........................................................
ENSNLEP00000007349  HGFILSHNND........C...........................................................
ENSNLEP00000015130  SGYQGDG--Rn.......C...........................................................
ENSNLEP00000015039  EGFEPGPMMN........C...........................................................
ENSNLEP00000017005  PGFRAGPRAAe.......C...........................................................
ENSNLEP00000001645  PGFTQRHQ-A........C...........................................................
ENSNLEP00000020776  PGFTLNEDGRs.......C...........................................................
ENSNLEP00000001645  PGFQVQSD-H........C...........................................................
ENSNLEP00000002426  ERHVAVE---........-...........................................................
ENSNLEP00000007349  PGYHSTPDRLf.......C...........................................................
ENSNLEP00000015039  PGFELTHNND........C...........................................................
ENSNLEP00000019565  DGFMLAHDGHn.......C...........................................................
ENSNLEP00000007349  PGFTQHHT-A........C...........................................................
ENSNLEP00000001645  DGFMATPDMKt.......C...........................................................
ENSNLEP00000017005  AGFHSRGPGAp.......C...........................................................
ENSNLEP00000003819  IGFRGDGR-T........C...........................................................
ENSNLEP00000015039  PGYVFRTETEt.......C...........................................................
ENSNLEP00000010460  RGYLLYGVTH........C...........................................................
ENSNLEP00000014132  EGSSAANGTM........-...........................................................
ENSNLEP00000010925  EGYLMQPDNRs.......Ckakieptdrppillianfetievfylngskmatlssvngneihtldfiynedmicwies
ENSNLEP00000000953  PNTYRFEGWR........C...........................................................
ENSNLEP00000001285  ALVTYNTDT-........-...........................................................
ENSNLEP00000005364  ----------........-...........................................................
ENSNLEP00000007349  PGFQLASDGRf.......C...........................................................
ENSNLEP00000007349  AGYQSTLTRTe.......C...........................................................
ENSNLEP00000011454  QGYELSSDRLn.......C...........................................................
ENSNLEP00000001645  AGFHFWQDTEi.......C...........................................................
ENSNLEP00000007349  EGFEPGPMMT........C...........................................................
ENSNLEP00000003819  AHGHYAPTQC........Hgstgycwcvdrdgrevegtrtrpgmtppclstvappihqgpavptaviplppgthllfa
ENSNLEP00000017155  SGYYGTR---........Y...........................................................
ENSNLEP00000015039  PGFTQHHT-A........C...........................................................
ENSNLEP00000019359  DGFQLDDNKT........C...........................................................
ENSNLEP00000001645  PGFQATPTRQa.......C...........................................................
ENSNLEP00000007349  EGYESGFMMMkn......C...........................................................
ENSNLEP00000007155  QGYELHRDGFs.......C...........................................................
ENSNLEP00000015039  EGYESGFMMMkn......C...........................................................
ENSNLEP00000005810  EGYILERGQY........Ckannsfgeasiifsngrdlligdihgrsfrilvesqnrgvavgvafhyhlqrvfwtdtv
ENSNLEP00000001645  PGFVVTHNGD........C...........................................................
ENSNLEP00000011444  TGYFGIRGQ-........-...........................................................
ENSNLEP00000021306  DGFMLAHDGHn.......C...........................................................
ENSNLEP00000001645  PGFLLAPGGRy.......C...........................................................
ENSNLEP00000015039  EGFTGDGF-T........C...........................................................
ENSNLEP00000015039  DGFMASMDMRt.......C...........................................................
ENSNLEP00000010925  FNYSGDHQQI........Shiehnsritgmdvyyrdmiiwstqfnpggifyktihgrekrqansglicpefkrprdia
ENSNLEP00000020085  PGYDLQLDKKs.......Caasgpqpfllfansqdirhmhfdgtdygtllsqqmgmvyaldhdpvenkiyfahtalkw
ENSNLEP00000007349  DGFMASEDMKt.......C...........................................................
ENSNLEP00000020669  PQPEHCEGGRa.......R...........................................................
ENSNLEP00000021907  PGYQLTHNGKt.......C...........................................................
ENSNLEP00000010913  LGETRDACGC........-...........................................................
ENSNLEP00000007349  IGYELDRSGGn.......C...........................................................
ENSNLEP00000021510  ----------........-...........................................................
ENSNLEP00000017624  TGFSGNL--C........Q...........................................................
ENSNLEP00000004973  DGFAPLEET-........-...........................................................
ENSNLEP00000012621  EGFAYSSQEKa.......C...........................................................
ENSNLEP00000000477  PPYYHFQDWR........C...........................................................
ENSNLEP00000000484  PPYYHFQDWR........C...........................................................
ENSNLEP00000010925  EGWKLDVDGEs.......Ctsvdpfeafiifsirheirridlhrrdysllvpglrntialdfhfsqsllywtdvvedr
ENSNLEP00000002105  SGFVMLSNKKd.......C...........................................................
ENSNLEP00000005270  PGYQQVGS-K........C...........................................................
ENSNLEP00000011454  PGYQKRGE-Q........C...........................................................
ENSNLEP00000019757  PGYTLATSGAtqe.....C...........................................................
ENSNLEP00000023356  SGFVMLSNKKd.......C...........................................................
ENSNLEP00000005810  TGYMLESDGRt.......Ckvtasesllllvasqnkiiadsvtsqvhniyslvengsyivavdfdsisgrifwsdatq
ENSNLEP00000016448  RGYQLSDVDGvt......C...........................................................
ENSNLEP00000015087  EGFRLSPGLG........C...........................................................
ENSNLEP00000018039  ----------........-...........................................................
ENSNLEP00000019913  QGFSGPL--C........E...........................................................
ENSNLEP00000021201  AGFTGSH--C........E...........................................................
ENSNLEP00000004633  EGHVLRSDGKt.......C...........................................................
ENSNLEP00000006856  PGYRSQGGGA........C...........................................................
ENSNLEP00000015740  ----------........-...........................................................
ENSNLEP00000000324  PGYTGRN---........-...........................................................
ENSNLEP00000001645  QGFAGDGF-S........C...........................................................
ENSNLEP00000016448  RGYHLNEEGTr.......C...........................................................
ENSNLEP00000011548  TGYTGKM--C........E...........................................................
ENSNLEP00000007349  AGFQYEQFSGg.......C...........................................................
ENSNLEP00000019359  AGFMASEEGTn.......C...........................................................
ENSNLEP00000005978  AGFQRDAFGRg.......C...........................................................
ENSNLEP00000010158  PGFVGER--C........E...........................................................
ENSNLEP00000005952  PGVRAVLDGC........-...........................................................
ENSNLEP00000010165  PGFVGER--C........E...........................................................
ENSNLEP00000017005  PGYRAPSGRPgp......C...........................................................
ENSNLEP00000019757  EGYRGQSG-S........C...........................................................
ENSNLEP00000006645  PGFTGQR--C........N...........................................................
ENSNLEP00000006645  PGFKGVH--C........E...........................................................
ENSNLEP00000001905  AGFHLSGAAGnsv.....C...........................................................
ENSNLEP00000010165  PGYEGVH--C........E...........................................................
ENSNLEP00000015039  SGFSFDQFSSa.......C...........................................................
ENSNLEP00000007050  ----------........-...........................................................
ENSNLEP00000010158  PGYEGVH--C........E...........................................................
ENSNLEP00000015039  AGHKQSETTQk.......C...........................................................
ENSNLEP00000011158  SGLRLAPNGRv.......C...........................................................
ENSNLEP00000016459  PGYHGLY--C........E...........................................................
ENSNLEP00000001781  ----------........-...........................................................
ENSNLEP00000019359  KGYTRTPDHKh.......C...........................................................
ENSNLEP00000019757  TGFQPSPESGe.......C...........................................................
ENSNLEP00000006856  RGYRLHVGAGgrs.....C...........................................................
ENSNLEP00000005978  DGYILNAHRK........C...........................................................
ENSNLEP00000010460  PGQHSADGF-........-...........................................................
ENSNLEP00000001350  ------KRTV........L...........................................................
ENSNLEP00000017678  AGVSLVLDGC........-...........................................................
ENSNLEP00000010158  SGYTGPA---........C...........................................................
ENSNLEP00000015550  PGTYQYESWR........C...........................................................
ENSNLEP00000004633  QGYILNSDQRt.......C...........................................................
ENSNLEP00000006645  PGWQGQR--C........T...........................................................
ENSNLEP00000002755  EGYTLNADKKt.......C...........................................................
ENSNLEP00000006645  PGTRGLL--C........E...........................................................
ENSNLEP00000004222  PGLVCAS---........-...........................................................
ENSNLEP00000010165  EGYHDPT--C........L...........................................................
ENSNLEP00000006645  SGWAGA----........-...........................................................
ENSNLEP00000010165  PGFQGTF--C........E...........................................................
ENSNLEP00000008073  ----------........-...........................................................
ENSNLEP00000010158  EGYHDPT--C........L...........................................................
ENSNLEP00000010158  PGFQGTF--C........E...........................................................
ENSNLEP00000004148  AGFSGRRCEV........R...........................................................
ENSNLEP00000019913  PGFAGPD--C........R...........................................................
ENSNLEP00000014468  GGYVPDLC--........-...........................................................
ENSNLEP00000005978  QGYTMTANGRs.......C...........................................................
ENSNLEP00000001645  RGYKLSPGGA........C...........................................................
ENSNLEP00000002003  PRFFNHTRLV........-...........................................................
ENSNLEP00000008103  PGFAGTR--C........E...........................................................
ENSNLEP00000008104  PGFAGTR--C........E...........................................................
ENSNLEP00000021658  SGFTGSH--C........E...........................................................
ENSNLEP00000015039  PGMARRPDGEg.......C...........................................................
ENSNLEP00000014046  QGYQLDSSQLd.......C...........................................................
ENSNLEP00000001645  SGFDFDQALGg.......C...........................................................
ENSNLEP00000008103  PGFVGLR--C........E...........................................................
ENSNLEP00000008104  PGFVGLR--C........E...........................................................
ENSNLEP00000023327  NGYMLMPDGS........C...........................................................
ENSNLEP00000006645  QGYKGAD--C........T...........................................................
ENSNLEP00000019757  QGFQLANGTV........C...........................................................
ENSNLEP00000007155  PGYEPDDQES........C...........................................................
ENSNLEP00000019565  IGFTLQPDRKt.......G...........................................................
ENSNLEP00000023327  KGFDLMYIGGkyq.....C...........................................................
ENSNLEP00000015898  KGFDLMYIGGkyq.....C...........................................................
ENSNLEP00000015039  MGYKQDANGD........C...........................................................
ENSNLEP00000010165  QGYTGPNCQ-........-...........................................................
ENSNLEP00000015155  DGFQLVAQRR........C...........................................................
ENSNLEP00000021778  QGFTGPS--C........E...........................................................
ENSNLEP00000016448  TGYELTEDNS........C...........................................................
ENSNLEP00000017005  DGYRLDMTRMa.......C...........................................................
ENSNLEP00000019565  PGFFSADGF-........-...........................................................
ENSNLEP00000017005  QGYEGARDGRh.......C...........................................................
ENSNLEP00000010158  QGYTGPNCQ-........-...........................................................
ENSNLEP00000010591  RGYQMDLATGv.......Ckavgkepsliftnrrdirkiglerkeyiqlveqlrntvaldadiaaqklfwadlsqkai
ENSNLEP00000005968  PGYSGKL--C........E...........................................................
ENSNLEP00000008103  PGYSGPT--C........H...........................................................
ENSNLEP00000008104  PGYSGPT--C........H...........................................................
ENSNLEP00000003215  SGDFEKPY--........Cqvttrsfpahsfitfrglrqrfhftlalsfatkerdglllyngrfnekhdfvaleviqe
ENSNLEP00000005978  DGFLQDPEGN........C...........................................................
ENSNLEP00000014067  SGFRGER--C........Q...........................................................
ENSNLEP00000020776  FGYQMDESNQ........C...........................................................
ENSNLEP00000019757  EGFQLDAAHMa.......C...........................................................
ENSNLEP00000009644  TGFYGEGCS-........-...........................................................
ENSNLEP00000019359  DGYHLDTAKMt.......C...........................................................
ENSNLEP00000016629  EGYSGQL---........-...........................................................
ENSNLEP00000000509  PGFESSSGHLsfqglkasC...........................................................
ENSNLEP00000010596  RGYQMDLATGv.......Ckavgkepsliftnrrdirkiglerkeyiqlveqlrntvaldadiaaqklfwadlsqkai
ENSNLEP00000003589  TGHILVER--........-...........................................................
ENSNLEP00000023948  DGYYGFSK--........-...........................................................
ENSNLEP00000020675  DGYYGFSK--........-...........................................................
ENSNLEP00000021306  PGEYSADGF-........-...........................................................
ENSNLEP00000010712  SGFHCLG---........-...........................................................
ENSNLEP00000002921  PGFFKTNN--........-...........................................................
ENSNLEP00000008103  QGWTGPL--C........N...........................................................
ENSNLEP00000008104  QGWTGPL--C........N...........................................................
ENSNLEP00000014749  PGFAPQVLDTh.......Y...........................................................
ENSNLEP00000010168  NGYYRADLDPldmp....C...........................................................
ENSNLEP00000001003  TGTFGEDCG-........-...........................................................
ENSNLEP00000014272  NNYFRADKDP........-...........................................................
ENSNLEP00000004064  SGHYRAPGEG........-...........................................................
ENSNLEP00000021941  SRTFYGG---........-...........................................................
ENSNLEP00000018144  PGHYIEKET-........-...........................................................
ENSNLEP00000004631  PGYEPENS--........-...........................................................
ENSNLEP00000015211  PGYQGDGR-V........C...........................................................
ENSNLEP00000013004  SKTYLSSSRR........Tasgisgsmgpgswyregafngneketmqflndrlasyltrvrqleqenaelesriqeas
ENSNLEP00000009392  AGYEKVE---........-...........................................................
ENSNLEP00000017897  RLYYGDDEKY........Frkpynflkyhfealadtgissefydnandllskvkkdksdsfgvtigigpagsplmvgv
ENSNLEP00000000606  EGFY------........-...........................................................
ENSNLEP00000019939  ----------........Esdprppcrdrvveeselartagfginilgmdplstpfdnefynglcnrdrdgntltyyr
ENSNLEP00000016279  RGFYKSS---........-...........................................................
ENSNLEP00000018144  DDSQFSEEGSse......C...........................................................
ENSNLEP00000021918  ----------........-...........................................................
ENSNLEP00000005978  LGYPCNHVMLs.......Ccegeeplivpevrrppepaaaprrvseaemagrealslgteaelpnslpg.........
ENSNLEP00000002921  ----------........-...........................................................
ENSNLEP00000011025  PGFFKASP--........-...........................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  gsrinrmclngsdikvvhntavpnalavdwigknlywsdtekriievsklnglyptmlvskrlkfprdlsldpragyl
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  lranlngsnveevvstglespgglavdwvhdklywtdsgtsrievanldgahrkvllwqnlekpraialhpmegtiyw
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  ressnqlkciqitkaggltdewtinilqsfhnvqqmaidwltrnlyfvdhvsdrifvcnyngsvcvtlidlelhnpka
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  qtgkierlplegntmrkteakaflhvpakviiglafdcvdkmvywtditepsigraslhggepttiirqdlgspegia
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  qnkvfsvdinglniqevlnvsvetpenlavdwvnnkiylvetkvnridmvnldgsyrvtlitenlghprgiavdptvg
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  vdwvagniywtdhsrmhwfsyytthwtslrysinvgqlngpnctrlltnmagepyaiavnpkrgmmywtvvgdhshie
ENSNLEP00000020085  ieranmdgsqrerlieegvdvpeglavdwigrrvywtdrgksligrsdlngkrskiitkenisqprgiavhpmakrlf
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  iyrgklsesggvsaievvvehglatpegltvdwiagniywidsnldqievakldgslrttliagamehpraialdpry
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  gktwsafqngtdrrvvfdssiiltetiaidwvgrnlywtdyaletievskidgshrtvlisknltnprglaldprmne
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  fsasiddkvgrhvkmidnvynpaaiavdwvyktiywtdaasktisvatldgtkrkflfnsdlrepasiavdplsgfvy
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  qvqltfsagestttvspfvpggvsdgqwhtvqlkyynkpllgqtglpqgpseqkvavvtvdgcdtgvalrfgsvlgny
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  fsasiddkvgrhvkmidnvynpaaiavdwvyktiywtdaasktisvatldgtkrkflfnsdlrepasiavdplsgfvy
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  hsqvltmtpdyqshfrtieelqqkilctkaenarmvvnidnaklaaddfrakyeaelamrqlveadinglrrilddlt
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  gvsesedasflnelnkynkekfiftriftkvqtahfkmrrddimldegmlqslmelpdqynygmyakfindygthyit
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  rpwnvaslvyetkgeknfrtehyeeqiqafksivqektsnfnadislkftpteankvetenpseetassnslhgkgsf
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ywidcceyphigrvgmdgtnqsvvietkisrpmaltidyvnrrlywadenhiefsnmdgshrykvpnqdipgvialtl
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  tdwgntprieassmdgsgrriiadthlfwpngltidyagrrmywvdakhhvieranldgshrkavisqglphpfaitv
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  iavdpiagklfftdygnvakvercdmdgmnrtriigskteqpaalaldlvnklvywvdlylecvgvvdyqgknrhsvi
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  vdhlgrnifwtdsnldrievakldgsqrrvlfetdlvnprgivtdsvrgnlywtdwnrdnpkietsymdgtnrrilvq
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ylffsdweslsgepklerafmdgsnrkdlvktklgwpagvtldtiskrvywvdsrfdyietvtydgiqrktvvhggsl
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  eaamdgtlrrilvqknlqrptglavdyfseriywadfelsiigsvlydgsnsvvsvsskqgllhphridifedyiyga
ENSNLEP00000020085  wtdtginpriessslqglgrlviassdliwpsgitidfltdklywcdakqsviemanldgskrqrltqndvghpfava
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  gilfwtdwdanfpriesasmsgagrktiykdmktgawpngltvdhfekrivwtdarsdaiysalydgtnmieiirghe
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  hllfwsdwghhprierasmdgsmrtvivqdkifwpcgltvdypnrllyfmdsyldymdfcdynghhrrqviasdliir
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  wsdwgepakiekagmngfdrrplvtvdiqwpngitldliksrlywldsklhmlssvdlngqdrrivlesleflahpla
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  scaaqgtqggskksldltgplllggvpdlpesfpvrmrqfvgcmrnlqvdsrhidmadf...................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  wsdwgepakiekagmngfdrrplvtvdiqwpngitldliksrlywldsklhmlssvdlngqdrrivlesleflahpla
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  lckadleaqveslkeelmclkknheeevsslrcqlgdrlnievdaappvdltrvleemrcqyetlveanrrdveewfn
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  sgsmggtyeyivvidkakmeslgitsrdimtcfggslgiqyegtinvggglsgdhcerfgggktererkamavediis
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  rfsysknetyqlflsysskkekmflhvkgeihlgrfvmrnrdvvltatfvddikalpttyekgeyfafletygthyss
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  fedyiywtdgktkslsrahktsgadrlslinswhaitdiq......................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  fedslywtdwhtksinsankftgknqeiirnklhfpmdih......................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  qgrqvrhlygitvfedylyatnsdnyniirinrfngtdihslikienargiriyqkrtqptvrshacevdpygmpggc
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  ddlglpngltfdafssqlcwvdagtnraeclnpsqpsrrkvleglqypfavtsygknlyftdwkmnsvvaldlaiske
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  iphpfgislfegqvfftdwtkmavlkankftetnpqvyyqaslrpygvt.............................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  gpkngvfrvqkfghgsveylalnidktkg.................................................
ENSNLEP00000020085  vfedyvwfsdwampsvmrvnkrtgkdrvrlqgsmlkpsslv.....................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ylshpfavslygsevywtdwrtntlskankwtgqnvsviqktsaqpfdlqiyhpsrqp....................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  hpyaltlfedsvywtdratrrvmrankwhggnqsvvmyniqwplgivavhpskqp.......................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ltifedrvywidgeneavygankftgselatlvnnlndaqdiivyhelvqp...........................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ltifedrvywidgeneavygankftgselatlvnnlndaqdiivyhelvqp...........................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  tqmeelnqqvatsseqlqnyqsdiidlrrtvntleielqaqhslrdslentltesearyssqlaqmqcmitnveaqla
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  rvrggssgwsgglaqnrstityrswgrslkynpvvidfemqpihevlrhtslgpleakrqnlhraldqyl........
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  sgslgglyeliyvldkasmnrkgveikdikrclgyhldvsldfssisagakvnkddcvkrgegravnitsdnliddvi
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  shicllsssyktrtcrcrtgfnlgsdgrsckrpknelflfygkgrpgivrgmdlntkiadeymipienlvnpraldfh
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  tdafqphkqtrlygit..............................................................
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000020085  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ..............................................................................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ..............................................................................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  eiradlerqnqeyqvlldvrarlegeinty................................................
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  slirggtrkyafelkekllrgtmidvtdfvnwassindapvlisqklspiynlvpvkmknahlkkqnleraiedyine
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  aetnyiyfadttsfligrqkidgteretilkddldnvegiavdwignnlywtndghrktinvarlekasqsrktlleg
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000020085  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ..............................................................................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ..............................................................................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  ..............................................................................
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  ..............................................................................
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000008878  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002317  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000017341  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000010419  ..............................................................................
ENSNLEP00000021313  ..............................................................................
ENSNLEP00000002401  ..............................................................................
ENSNLEP00000005281  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010151  ..............................................................................
ENSNLEP00000008780  ..............................................................................
ENSNLEP00000008875  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015130  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002426  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000014132  ..............................................................................
ENSNLEP00000010925  emshprgivvdplngwmywtdweedeiddsvgriekawmdgfnrqifvtskmlwpngltldfhtntlywcdayydhie
ENSNLEP00000000953  ..............................................................................
ENSNLEP00000001285  ..............................................................................
ENSNLEP00000005364  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000003819  ..............................................................................
ENSNLEP00000017155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000011444  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000020085  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000020669  ..............................................................................
ENSNLEP00000021907  ..............................................................................
ENSNLEP00000010913  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000021510  ..............................................................................
ENSNLEP00000017624  ..............................................................................
ENSNLEP00000004973  ..............................................................................
ENSNLEP00000012621  ..............................................................................
ENSNLEP00000000477  ..............................................................................
ENSNLEP00000000484  ..............................................................................
ENSNLEP00000010925  ..............................................................................
ENSNLEP00000002105  ..............................................................................
ENSNLEP00000005270  ..............................................................................
ENSNLEP00000011454  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000023356  ..............................................................................
ENSNLEP00000005810  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000015087  ..............................................................................
ENSNLEP00000018039  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000021201  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000015740  ..............................................................................
ENSNLEP00000000324  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000011548  ..............................................................................
ENSNLEP00000007349  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000005952  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000001905  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000007050  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000011158  ..............................................................................
ENSNLEP00000016459  ..............................................................................
ENSNLEP00000001781  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000006856  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000010460  ..............................................................................
ENSNLEP00000001350  ..............................................................................
ENSNLEP00000017678  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000015550  ..............................................................................
ENSNLEP00000004633  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000002755  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000004222  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000008073  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000004148  ..............................................................................
ENSNLEP00000019913  ..............................................................................
ENSNLEP00000014468  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000002003  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000021658  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000014046  ..............................................................................
ENSNLEP00000001645  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000006645  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000007155  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000023327  ..............................................................................
ENSNLEP00000015898  ..............................................................................
ENSNLEP00000015039  ..............................................................................
ENSNLEP00000010165  ..............................................................................
ENSNLEP00000015155  ..............................................................................
ENSNLEP00000021778  ..............................................................................
ENSNLEP00000016448  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000019565  ..............................................................................
ENSNLEP00000017005  ..............................................................................
ENSNLEP00000010158  ..............................................................................
ENSNLEP00000010591  ..............................................................................
ENSNLEP00000005968  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000003215  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000014067  ..............................................................................
ENSNLEP00000020776  ..............................................................................
ENSNLEP00000019757  ..............................................................................
ENSNLEP00000009644  ..............................................................................
ENSNLEP00000019359  ..............................................................................
ENSNLEP00000016629  ..............................................................................
ENSNLEP00000000509  ..............................................................................
ENSNLEP00000010596  ..............................................................................
ENSNLEP00000003589  ..............................................................................
ENSNLEP00000023948  ..............................................................................
ENSNLEP00000020675  ..............................................................................
ENSNLEP00000021306  ..............................................................................
ENSNLEP00000010712  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000008103  ..............................................................................
ENSNLEP00000008104  ..............................................................................
ENSNLEP00000014749  ..............................................................................
ENSNLEP00000010168  ..............................................................................
ENSNLEP00000001003  ..............................................................................
ENSNLEP00000014272  ..............................................................................
ENSNLEP00000004064  ..............................................................................
ENSNLEP00000021941  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000004631  ..............................................................................
ENSNLEP00000015211  ..............................................................................
ENSNLEP00000013004  ..............................................................................
ENSNLEP00000009392  ..............................................................................
ENSNLEP00000017897  ..............................................................................
ENSNLEP00000000606  ..............................................................................
ENSNLEP00000019939  ..............................................................................
ENSNLEP00000016279  ..............................................................................
ENSNLEP00000018144  ..............................................................................
ENSNLEP00000021918  ..............................................................................
ENSNLEP00000005978  ..............................................................................
ENSNLEP00000002921  ..............................................................................
ENSNLEP00000011025  ..............................................................................


                                                                                                 100
                                                                                                   |
d2dtge6               .................................................................VN..........F
ENSNLEP00000000606  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000010151  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000010151  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000010151  .................................................................--..........-
ENSNLEP00000010419  .................................................................-Da.........S
ENSNLEP00000008878  .................................................................--..........-
ENSNLEP00000010151  .................................................................--..........-
ENSNLEP00000010925  .................................................................V-..........-
ENSNLEP00000002317  .................................................................--..........-
ENSNLEP00000008780  .................................................................DP..........D
ENSNLEP00000001285  .................................................................--..........-
ENSNLEP00000021313  .................................................................DV..........Q
ENSNLEP00000002426  .................................................................-E..........K
ENSNLEP00000017341  .................................................................TL..........H
ENSNLEP00000001645  .................................................................ED..........I
ENSNLEP00000019565  .................................................................GD..........V
ENSNLEP00000010419  .................................................................MD..........V
ENSNLEP00000021313  .................................................................LE..........P
ENSNLEP00000002401  .................................................................VD..........V
ENSNLEP00000005281  .................................................................--..........-
ENSNLEP00000001645  .................................................................VD..........I
ENSNLEP00000021306  .................................................................GD..........T
ENSNLEP00000010151  .................................................................--..........-
ENSNLEP00000008780  .................................................................LE..........H
ENSNLEP00000008875  .................................................................GC..........C
ENSNLEP00000004633  .................................................................RR..........I
ENSNLEP00000015039  .................................................................TD..........V
ENSNLEP00000021907  .................................................................QD..........I
ENSNLEP00000007349  .................................................................ID..........V
ENSNLEP00000015130  .................................................................VD..........E
ENSNLEP00000015039  .................................................................ED..........I
ENSNLEP00000017005  .................................................................LD..........V
ENSNLEP00000001645  .................................................................FD..........N
ENSNLEP00000020776  .................................................................QD..........V
ENSNLEP00000001645  .................................................................ID..........I
ENSNLEP00000002426  .................................................................--..........-
ENSNLEP00000007349  .................................................................VD..........I
ENSNLEP00000015039  .................................................................LD..........I
ENSNLEP00000019565  .................................................................LD..........V
ENSNLEP00000007349  .................................................................ID..........N
ENSNLEP00000001645  .................................................................VD..........V
ENSNLEP00000017005  .................................................................QD..........V
ENSNLEP00000003819  .................................................................YD..........I
ENSNLEP00000015039  .................................................................ED..........I
ENSNLEP00000010460  .................................................................GD..........V
ENSNLEP00000014132  .................................................................--..........-
ENSNLEP00000010925  kvflngthrkivysgrelnhpfglshhgnyvfwtdymngsifqldlitsevtllrherpplfglqIY..........D
ENSNLEP00000000953  .................................................................VD..........R
ENSNLEP00000001285  .................................................................--..........-
ENSNLEP00000005364  .................................................................--..........-
ENSNLEP00000007349  .................................................................KD..........I
ENSNLEP00000007349  .................................................................RD..........I
ENSNLEP00000011454  .................................................................ED..........I
ENSNLEP00000001645  .................................................................KD..........V
ENSNLEP00000007349  .................................................................ED..........I
ENSNLEP00000003819  .................................................................TA..........L
ENSNLEP00000017155  .................................................................PD..........I
ENSNLEP00000015039  .................................................................ID..........N
ENSNLEP00000019359  .................................................................QD..........I
ENSNLEP00000001645  .................................................................VD..........V
ENSNLEP00000007349  .................................................................MD..........I
ENSNLEP00000007155  .................................................................SD..........I
ENSNLEP00000015039  .................................................................MD..........I
ENSNLEP00000005810  .................................................................VY..........H
ENSNLEP00000001645  .................................................................VD..........F
ENSNLEP00000011444  .................................................................-E..........V
ENSNLEP00000021306  .................................................................LD..........V
ENSNLEP00000001645  .................................................................MD..........I
ENSNLEP00000015039  .................................................................SD..........V
ENSNLEP00000015039  .................................................................ID..........V
ENSNLEP00000010925  .................................................................V-..........-
ENSNLEP00000020085  .................................................................VV..........H
ENSNLEP00000007349  .................................................................VD..........V
ENSNLEP00000020669  .................................................................DA..........C
ENSNLEP00000021907  .................................................................QD..........I
ENSNLEP00000010913  .................................................................--..........-
ENSNLEP00000007349  .................................................................TD..........V
ENSNLEP00000021510  .................................................................--..........-
ENSNLEP00000017624  .................................................................LD..........I
ENSNLEP00000004973  .................................................................--..........-
ENSNLEP00000012621  .................................................................QD..........V
ENSNLEP00000000477  .................................................................VN..........F
ENSNLEP00000000484  .................................................................VN..........F
ENSNLEP00000010925  .................................................................QA..........P
ENSNLEP00000002105  .................................................................KD..........V
ENSNLEP00000005270  .................................................................LD..........V
ENSNLEP00000011454  .................................................................VD..........I
ENSNLEP00000019757  .................................................................QD..........I
ENSNLEP00000023356  .................................................................KD..........V
ENSNLEP00000005810  .................................................................NS..........V
ENSNLEP00000016448  .................................................................ED..........I
ENSNLEP00000015087  .................................................................TD..........V
ENSNLEP00000018039  .................................................................--..........-
ENSNLEP00000019913  .................................................................VD..........V
ENSNLEP00000021201  .................................................................LN..........I
ENSNLEP00000004633  .................................................................AK..........L
ENSNLEP00000006856  .................................................................RD..........V
ENSNLEP00000015740  .................................................................--..........-
ENSNLEP00000000324  .................................................................--..........-
ENSNLEP00000001645  .................................................................ED..........R
ENSNLEP00000016448  .................................................................VD..........V
ENSNLEP00000011548  .................................................................SS..........V
ENSNLEP00000007349  .................................................................QD..........I
ENSNLEP00000019359  .................................................................ID..........V
ENSNLEP00000005978  .................................................................ID..........V
ENSNLEP00000010158  .................................................................GD..........V
ENSNLEP00000005952  .................................................................--..........-
ENSNLEP00000010165  .................................................................GD..........V
ENSNLEP00000017005  .................................................................AD..........V
ENSNLEP00000019757  .................................................................VD..........V
ENSNLEP00000006645  .................................................................ID..........I
ENSNLEP00000006645  .................................................................LE..........I
ENSNLEP00000001905  .................................................................QD..........V
ENSNLEP00000010165  .................................................................VN..........T
ENSNLEP00000015039  .................................................................HD..........V
ENSNLEP00000007050  .................................................................--..........-
ENSNLEP00000010158  .................................................................VN..........T
ENSNLEP00000015039  .................................................................ED..........I
ENSNLEP00000011158  .................................................................LD..........I
ENSNLEP00000016459  .................................................................EE..........Y
ENSNLEP00000001781  .................................................................ED..........V
ENSNLEP00000019359  .................................................................KD..........I
ENSNLEP00000019757  .................................................................VD..........I
ENSNLEP00000006856  .................................................................VD..........L
ENSNLEP00000005978  .................................................................VD..........I
ENSNLEP00000010460  .................................................................--..........-
ENSNLEP00000001350  .................................................................DD..........C
ENSNLEP00000017678  .................................................................--..........-
ENSNLEP00000010158  .................................................................QD..........V
ENSNLEP00000015550  .................................................................VT..........A
ENSNLEP00000004633  .................................................................RI..........Q
ENSNLEP00000006645  .................................................................ID..........I
ENSNLEP00000002755  .................................................................SV..........R
ENSNLEP00000006645  .................................................................EN..........I
ENSNLEP00000004222  .................................................................--..........-
ENSNLEP00000010165  .................................................................SE..........V
ENSNLEP00000006645  .................................................................--..........-
ENSNLEP00000010165  .................................................................ED..........I
ENSNLEP00000008073  .................................................................--..........-
ENSNLEP00000010158  .................................................................SE..........V
ENSNLEP00000010158  .................................................................ED..........I
ENSNLEP00000004148  .................................................................TS..........I
ENSNLEP00000019913  .................................................................IN..........I
ENSNLEP00000014468  .................................................................--..........-
ENSNLEP00000005978  .................................................................KD..........L
ENSNLEP00000001645  .................................................................VG..........R
ENSNLEP00000002003  .................................................................-TarpghmaapaL
ENSNLEP00000008103  .................................................................ED..........I
ENSNLEP00000008104  .................................................................ED..........I
ENSNLEP00000021658  .................................................................KD..........I
ENSNLEP00000015039  .................................................................VD..........E
ENSNLEP00000014046  .................................................................VD..........V
ENSNLEP00000001645  .................................................................QD..........V
ENSNLEP00000008103  .................................................................GD..........V
ENSNLEP00000008104  .................................................................GD..........V
ENSNLEP00000023327  .................................................................SS..........A
ENSNLEP00000006645  .................................................................ED..........V
ENSNLEP00000019757  .................................................................ED..........V
ENSNLEP00000007155  .................................................................VD..........V
ENSNLEP00000019565  .................................................................KD..........I
ENSNLEP00000023327  .................................................................HD..........V
ENSNLEP00000015898  .................................................................HD..........V
ENSNLEP00000015039  .................................................................ID..........V
ENSNLEP00000010165  .................................................................--..........-
ENSNLEP00000015155  .................................................................ED..........I
ENSNLEP00000021778  .................................................................TD..........I
ENSNLEP00000016448  .................................................................KD..........I
ENSNLEP00000017005  .................................................................VD..........I
ENSNLEP00000019565  .................................................................--..........-
ENSNLEP00000017005  .................................................................VD..........V
ENSNLEP00000010158  .................................................................--..........-
ENSNLEP00000010591  .................................................................SG..........K
ENSNLEP00000005968  .................................................................TD..........N
ENSNLEP00000008103  .................................................................QD..........L
ENSNLEP00000008104  .................................................................QD..........L
ENSNLEP00000003215  .................................................................IA..........N
ENSNLEP00000005978  .................................................................VD..........I
ENSNLEP00000014067  .................................................................SD..........V
ENSNLEP00000020776  .................................................................VD..........V
ENSNLEP00000019757  .................................................................VD..........V
ENSNLEP00000009644  .................................................................--..........-
ENSNLEP00000019359  .................................................................VD..........V
ENSNLEP00000016629  .................................................................--..........-
ENSNLEP00000000509  .................................................................ED..........I
ENSNLEP00000010596  .................................................................SG..........K
ENSNLEP00000003589  .................................................................-D..........V
ENSNLEP00000023948  .................................................................--..........-
ENSNLEP00000020675  .................................................................--..........-
ENSNLEP00000021306  .................................................................--..........-
ENSNLEP00000010712  .................................................................--..........-
ENSNLEP00000002921  .................................................................--..........-
ENSNLEP00000008103  .................................................................LP..........L
ENSNLEP00000008104  .................................................................LP..........L
ENSNLEP00000014749  .................................................................-Stendvetir.A
ENSNLEP00000010168  .................................................................--..........-
ENSNLEP00000001003  .................................................................--..........-
ENSNLEP00000014272  .................................................................--..........-
ENSNLEP00000004064  .................................................................--..........-
ENSNLEP00000021941  .................................................................--..........-
ENSNLEP00000018144  .................................................................--..........-
ENSNLEP00000004631  .................................................................--..........-
ENSNLEP00000015211  .................................................................TL..........I
ENSNLEP00000013004  .................................................................RS..........L
ENSNLEP00000009392  .................................................................--..........-
ENSNLEP00000017897  .................................................................ME..........F
ENSNLEP00000000606  .................................................................--..........-
ENSNLEP00000019939  .................................................................FS..........V
ENSNLEP00000016279  .................................................................--..........-
ENSNLEP00000018144  .................................................................TE..........R
ENSNLEP00000021918  .................................................................--..........-
ENSNLEP00000005978  .................................................................DD..........Q
ENSNLEP00000002921  .................................................................--..........-
ENSNLEP00000011025  .................................................................--..........-


                                                    110                                      120    
                                                      |                                        |    
d2dtge6               SFCQD...LHHK....................CK......NSRRQ.........................GCHQ....
ENSNLEP00000000606  KNCLK...CHPS....................CK......KCVDEpek......................CTVCkeg.
ENSNLEP00000002426  GRCER...CNRS....................CK......GCQGPrptd.....................CLSCdrff
ENSNLEP00000002426  ARCKP...CHAK....................CF......HCMGPaedq.....................CQTCprn.
ENSNLEP00000002426  NQCHP...CHHT....................CQ......RCQGSgpth.....................CTSCgadn
ENSNLEP00000010151  GICEA...CHQS....................CL......RCAGKsphn.....................CTDCgps.
ENSNLEP00000002426  NLCRK...CSEN....................CK......TCTEFhn.......................CTECrdg.
ENSNLEP00000010151  GRCKV...CHNS....................CA......SCSGPtash.....................CTACspp.
ENSNLEP00000002426  GSCEN...CTEA....................CA......ICSGAdl.......................CKKCkmqp
ENSNLEP00000002426  VECKT...CDSN....................CG......SCDQNgcyw.....................CEEG....
ENSNLEP00000010151  GLCKN...CDSY....................CL......QCQGPhe.......................CTRCegp.
ENSNLEP00000010419  HVCHL...CHPN....................CTy.....GCAGP.........................----....
ENSNLEP00000008878  SMCPP...SPLG....................CE......LVKEPg........................CGCCmt..
ENSNLEP00000010151  HVCQP...CNTH....................CG......SCDSQas.......................CTSCrdrn
ENSNLEP00000010925  --YHS...YRQPdvskhl..............CM......INNGG.........................CSHL....
ENSNLEP00000002317  GCCAT...CALGlgmp................CG......VYTPR.........................CGSGlr..
ENSNLEP00000008780  RECHP...CHPN....................CTq.....GCNGP.........................----....
ENSNLEP00000001285  RHCLP...CHPE....................CQpqngsvTCFGPeadq.....................CVSCa...
ENSNLEP00000021313  NECRP...CHEN....................--......-----.........................----....
ENSNLEP00000002426  FNCEK...CHES....................CM......ECKGPgakn.....................CTLCpanl
ENSNLEP00000017341  PQRQP...AGKNr...................CG......DNNGG.........................CTHL....
ENSNLEP00000001645  DECSL...NPLL....................--......-----.........................CAFR....
ENSNLEP00000019565  DECSI...SNGS....................--......-----.........................CDQG....
ENSNLEP00000010419  NPEGK...YSFG....................-A......TCVKK.........................CPRN....
ENSNLEP00000021313  NPHTK...YQYG....................-G......VCVAS.........................CPHN....
ENSNLEP00000002401  NECRR...----....................--......----Plerrv....................CHHS....
ENSNLEP00000005281  ---PM...CALPlgaa................C-......-----.........................----....
ENSNLEP00000001645  NECRV...RNGG....................--......-----.........................CDVH....
ENSNLEP00000021306  NECSV...NNGG....................--......-----.........................CQQV....
ENSNLEP00000010151  SLCLA...CQPQ....................CS......TCTSGle.......................CSSCqpp.
ENSNLEP00000008780  NFNAK...YTYG....................-A......FCVKK.........................CPHN....
ENSNLEP00000008875  SVCAR...LEGEa...................CG......VYTPR.........................CGQGlr..
ENSNLEP00000004633  NYCAL...NKPG....................--......-----.........................CEHE....
ENSNLEP00000015039  DECQT...----....................--......--PGI.........................CMNGh...
ENSNLEP00000021907  NECQE...----....................--......--SSP.........................CHQR....
ENSNLEP00000007349  DECAS...G---....................--......----Ngnl......................CRNGq...
ENSNLEP00000015130  NECAT...GFHR....................--......-----.........................CGPNsv..
ENSNLEP00000015039  NECAQ...NPLL....................--......-----.........................CAFR....
ENSNLEP00000017005  DECHR...VPPP....................--......-----.........................CDLGr...
ENSNLEP00000001645  DECSA...QPGP....................--......-----.........................CGAHgh..
ENSNLEP00000020776  NECAT...----....................--......--ENP.........................CVQT....
ENSNLEP00000001645  DECSE...EPNL....................--......-----.........................CLFGt...
ENSNLEP00000002426  GVCKH...CPEM....................CQ......DCIHEkt.......................CKECmse.
ENSNLEP00000007349  DECSI...MNGG....................--......-----.........................CETF....
ENSNLEP00000015039  DECSS...FF--....................--......---GQv........................CRNGr...
ENSNLEP00000019565  DECQD...NNGG....................--......-----.........................CQQI....
ENSNLEP00000007349  NECTS...DISL....................--......-----.........................CGAKgi..
ENSNLEP00000001645  DECDL...NPHI....................--......-----.........................CLHGd...
ENSNLEP00000017005  DECAR...SPPP....................--......-----.........................CTYGr...
ENSNLEP00000003819  DECSE...QPSV....................--......-----.........................CGSHai..
ENSNLEP00000015039  NECES...----....................--......---NP.........................CVNGa...
ENSNLEP00000010460  DECSI...NRGG....................--......-----.........................CRFG....
ENSNLEP00000014132  -----...----....................--......-----.........................----....
ENSNLEP00000010925  PRKQQ...GDNM....................CR......VNNGG.........................CSTL....
ENSNLEP00000000953  DFCAN...ILSA....................--......--ESS.........................DSEG....
ENSNLEP00000001285  FESMP...NPEGrytf................GA......SCVTA.........................CPYNy...
ENSNLEP00000005364  -----...----....................--......-----.........................----....
ENSNLEP00000007349  NECET...----....................--......--PGI.........................CMNGr...
ENSNLEP00000007349  DECLQ...----....................--......---NGri.......................CNNGr...
ENSNLEP00000011454  DECRT...SSYL....................--......-----.........................CQYQ....
ENSNLEP00000001645  DECLS...----....................--......---SP.........................CVNGv...
ENSNLEP00000007349  NECAQ...NPLL....................--......-----.........................CAFR....
ENSNLEP00000003819  SQCPQ...GHNY....................CS......VNNGG.........................CTHL....
ENSNLEP00000017155  NKCTK...CKAD....................CD......TCFNKnf.......................CTKCksg.
ENSNLEP00000015039  NECGS...QPSL....................--......-----.........................CGAKgi..
ENSNLEP00000019359  NECEH...----....................--......--PGL.........................CGPQge..
ENSNLEP00000001645  DECIV...----....................--......--SGGl........................CHLGr...
ENSNLEP00000007349  DECQR...DPLL....................--......-----.........................CRGGv...
ENSNLEP00000007155  DECSY...SSYL....................--......-----.........................CQYR....
ENSNLEP00000015039  DECER...NPLL....................--......-----.........................CRGGt...
ENSNLEP00000005810  SLRQP...YATNp...................CK......DNNGG.........................CEQV....
ENSNLEP00000001645  DECTT...L---....................--......--VGQv........................CRFGh...
ENSNLEP00000011444  NRCKK...CGAT....................CE......SCFSQdf.......................CIRCkrr.
ENSNLEP00000021306  DECLE...NNGG....................--......-----.........................CQHT....
ENSNLEP00000001645  DECQT...----....................--......--PGI.........................CVNGh...
ENSNLEP00000015039  DECAE...NINL....................--......-----.........................CENGq...
ENSNLEP00000015039  NECDL...NSNI....................--......-----.........................CMFGe...
ENSNLEP00000010925  --LIS...HHYK....................QL......DLPNP.........................CLDLacef
ENSNLEP00000020085  PLAKP...GADP....................CL......YQNGG.........................CEHI....
ENSNLEP00000007349  NECDL...NPNI....................--......-----.........................CLSGt...
ENSNLEP00000020669  GCCEV...CGAPegaa................CG......LQEGP.........................CGEGlq..
ENSNLEP00000021907  DECLE...QNVR....................--......-----.........................CGANrm..
ENSNLEP00000010913  --CPM...CARGe...................GE......PCGGGgagrgy...................CAPGme..
ENSNLEP00000007349  NECLD...----....................--......--P-Tt........................CISGn...
ENSNLEP00000021510  -----...----....................--......-----.........................----....
ENSNLEP00000017624  DYCEP...----....................--......---NP.........................CQNGaq..
ENSNLEP00000004973  MECVEg..CEVG....................HW......SE---.........................----....
ENSNLEP00000012621  DECLQ...----....................--......---GR.........................CEQV....
ENSNLEP00000000477  SFCQD...LHHK....................CK......NSRRQ.........................GCHQ....
ENSNLEP00000000484  SFCQD...LHHK....................CK......NSRRQ.........................GCHQ....
ENSNLEP00000010925  NPCAA...NDGK....................--......---GP.........................CSHMc...
ENSNLEP00000002105  DECSL...KPSI....................--......-----.........................CGTAv...
ENSNLEP00000005270  DECET...----....................--......---EV.........................CLGEnkq.
ENSNLEP00000011454  DECTI...----....................--......---PPy........................CHQR....
ENSNLEP00000019757  NECEQ...----....................--......--PGV.........................CNGGq...
ENSNLEP00000023356  DECSL...KPSI....................--......-----.........................CGTAv...
ENSNLEP00000005810  NPCAF...----....................--......---SR.........................CSHL....
ENSNLEP00000016448  DECAL...PTG-....................--......----Ghi.......................CSYR....
ENSNLEP00000015087  DECAE...----....................--......---PGlsh......................CHALat..
ENSNLEP00000018039  -----...----....................--......-----.........................CGEQle..
ENSNLEP00000019913  DLCEP...----....................--......---SP.........................CRNGar..
ENSNLEP00000021201  NECQS...----....................--......---NP.........................CRNQat..
ENSNLEP00000004633  DSCAL...GDHG....................--......-----.........................CEHS....
ENSNLEP00000006856  NECAE...----....................--......---GSp........................CSPGw...
ENSNLEP00000015740  -----...----....................--......-----.........................CNEAdl..
ENSNLEP00000000324  -----...CSAP....................VS......RCEHAp........................CHNGat..
ENSNLEP00000001645  DECAE...NVDL....................--......-----.........................CDNGq...
ENSNLEP00000016448  DECAP...PAEP....................--......-----.........................CGKGhr..
ENSNLEP00000011548  NYCEC...----....................--......---NP.........................CFNGgs..
ENSNLEP00000007349  NECGS...SQAP....................--......-----.........................CSYG....
ENSNLEP00000019359  DECLR...----....................--......--PDV.........................CGEGh...
ENSNLEP00000005978  NECWA...----....................--......---SPgrl......................CQHT....
ENSNLEP00000010158  NECLS...----....................--......---NP.........................CDARgtqn
ENSNLEP00000005952  SCCLV...CAR-....................--......----Qrges.....................CSDLep..
ENSNLEP00000010165  NECLS...----....................--......---NP.........................CDARgtqn
ENSNLEP00000017005  NECLE...----....................--......---GDf........................CFPHge..
ENSNLEP00000019757  NECLT...----....................--......--PGV.........................CAHGk...
ENSNLEP00000006645  DECAS...----....................--......---NP.........................CRKGat..
ENSNLEP00000006645  NECQS...----....................--......---NP.........................CVNNgq..
ENSNLEP00000001905  NECEL...YGQE....................--......---GRprl......................CMHA....
ENSNLEP00000010165  DECAS...----....................--......---SP.........................CLHNgr..
ENSNLEP00000015039  NECSS...SKNP....................--......-----.........................CNYG....
ENSNLEP00000007050  -----...----....................--......-----.........................----....
ENSNLEP00000010158  DECAS...----....................--......---SP.........................CLHNgr..
ENSNLEP00000015039  DECSI...IPGI....................--......-----.........................CETGe...
ENSNLEP00000011158  DECAS...GKAI....................--......-----.........................CPYNrr..
ENSNLEP00000016459  NECLS...----....................--......---AP.........................CLNAat..
ENSNLEP00000001781  DECSL...AEKA....................--......-----.........................CVRKnen.
ENSNLEP00000019359  DECQQ...----....................--......---GNl........................CINGq...
ENSNLEP00000019757  DECED...----....................--......--YGDpv.......................CGTWk...
ENSNLEP00000006856  NECAK...----....................--......---PHl........................CGDGgf..
ENSNLEP00000005978  NECVT...DLHT....................--......-----.........................CSRGeh..
ENSNLEP00000010460  KPCQP...CPRGtyqpeagrtl..........CF......PCGGGlttkhegaisfqdcdtkvq......C---....
ENSNLEP00000001350  GCCRV...CAAGrget................CY......RTVSGmdgmk....................CGPGlr..
ENSNLEP00000017678  GCCRV...CAKQlge.................LC......TERDP.........................CDPHkg..
ENSNLEP00000010158  DECSL...GANP....................--......-----.........................CEHAgk..
ENSNLEP00000015550  ERCAS...LHSV....................--......---PG.........................RTST....
ENSNLEP00000004633  DLCAM...EDHN....................--......-----.........................CEQL....
ENSNLEP00000006645  DECIS...----....................--......---KP.........................CMNHgl..
ENSNLEP00000002755  DKCAL...GSHG....................--......-----.........................CQHI....
ENSNLEP00000006645  DDCAR...----....................--......---GPh........................CLNGgq..
ENSNLEP00000004222  -----...----....................--......-----.........................----....
ENSNLEP00000010165  NECNS...----....................--......---NP.........................CVHGa...
ENSNLEP00000006645  -YCDV...PNVS....................CD......IAASSrgvlvehl.................CQHSgv..
ENSNLEP00000010165  NECAS...----....................--......---DP.........................CHNGan..
ENSNLEP00000008073  -----...----....................--......-----.........................----....
ENSNLEP00000010158  NECNS...----....................--......---NP.........................CVHGa...
ENSNLEP00000010158  NECAS...----....................--......---DP.........................CHNGan..
ENSNLEP00000004148  DACAS...----....................--......---SP.........................CFNRatcy
ENSNLEP00000019913  DECQS...----....................--......---SP.........................CAYGat..
ENSNLEP00000014468  NCCLV...CAASe...................GE......PCGGPldsp.....................CGES....
ENSNLEP00000005978  DECAL...GTHN....................--......-----.........................CSEAet..
ENSNLEP00000001645  NECRE...IPNV....................--......-----.........................CSHGd...
ENSNLEP00000002003  RVCSS...CHAS....................CY......TCRGGsprd.....................CT--....
ENSNLEP00000008103  NECRS...----....................--......---SP.........................CANGgq..
ENSNLEP00000008104  NECRS...----....................--......---SP.........................CANGgq..
ENSNLEP00000021658  DECSE...GIIE....................--......-----.........................CHNHsr..
ENSNLEP00000015039  NECRS...KPGI....................--......-----.........................CENGr...
ENSNLEP00000014046  DECQD...----....................--......---SP.........................CAQE....
ENSNLEP00000001645  DECAG...RRGP....................--......-----.........................CSYS....
ENSNLEP00000008103  DECLD...----....................--......---QP.........................CHPTgtaa
ENSNLEP00000008104  DECLD...----....................--......---QP.........................CHPTgtaa
ENSNLEP00000023327  LTCSM...----....................--......---AN.........................CQYG....
ENSNLEP00000006645  DECAM...ANSN....................--......----P.........................CEHAgk..
ENSNLEP00000019757  NECMG...----....................--......--EEH.........................CAPHge..
ENSNLEP00000007155  DECAQ...ALHD....................--......-----.........................CRPSqd..
ENSNLEP00000019565  NECLV...NNGG....................--......-----.........................CDHF....
ENSNLEP00000023327  DECSL...GQYQ....................--......-----.........................CSSFar..
ENSNLEP00000015898  DECSL...GQYQ....................--......-----.........................CSSFar..
ENSNLEP00000015039  DECTS...----....................--......---NP.........................CTNGd...
ENSNLEP00000010165  NLVHW...CDS-....................--......---SP.........................CKNGgk..
ENSNLEP00000015155  DECQD...----....................--......--PDT.........................CSQL....
ENSNLEP00000021778  DECSD...GFVQ....................--......-----.........................CDSRan..
ENSNLEP00000016448  DECES...GIHN....................--......-----.........................CLPDfi..
ENSNLEP00000017005  NECDE...AEAA....................--......---SPl........................CVNAr...
ENSNLEP00000019565  KPCQA...CPVGtyqpepgrtg..........CF......PCGGGlltkhegttsfqdceakvh......CSPGh...
ENSNLEP00000017005  NECET...LQGV....................--......-----.........................CGAAl...
ENSNLEP00000010158  NLVHW...CDS-....................--......---SP.........................CKNGgk..
ENSNLEP00000010591  NWCEE...DMEN....................--......---GGceyl.....................CLPApq..
ENSNLEP00000005968  DDCV-...----....................--......---HK.........................CRHGaq..
ENSNLEP00000008103  DECLM...AQQG....................--......--PSP.........................CEHGgs..
ENSNLEP00000008104  DECLM...AQQG....................--......--PSP.........................CEHGgs..
ENSNLEP00000003215  NGTVPg..CPAK....................KN......VCDSNt........................CHNGgt..
ENSNLEP00000005978  NECTS...LSEP....................--......-----.........................CRPGfs..
ENSNLEP00000014067  DECTG...----....................--......---NP.........................CLHGal..
ENSNLEP00000020776  DECAT...DSHQ....................--......-----.........................CNPTqi..
ENSNLEP00000019757  NECDD...LN--....................--......---GPavl......................CVHGy...
ENSNLEP00000009644  HRCPP...CRDGha..................CN......HVTGK.........................CTRCn...
ENSNLEP00000019359  NECDE...LNNR....................--......--MSL.........................CKNAk...
ENSNLEP00000016629  --CEIpphLPAP....................KS......PCEGTe........................CQNGan..
ENSNLEP00000000509  DECTEm..CPI-....................--......-----.........................---Nst..
ENSNLEP00000010596  NWCEE...DMEN....................--......---GGceyl.....................CLPApq..
ENSNLEP00000003589  NGTLL...SQAT....................CE......LCDGNensftvanalgdr............CVRCe...
ENSNLEP00000023948  NGCLP...CQCNnrsas...............CD......ALTGA.........................CLNC....
ENSNLEP00000020675  NGCLP...CQCNnrsas...............CD......ALTGA.........................CLNC....
ENSNLEP00000021306  APCQL...CALGtfqpeagrts..........CF......PCGGGlptkhqgatsfqdcetrvq......CSPGh...
ENSNLEP00000010712  AGCSM...CEQD....................--......-----.........................CKQG....
ENSNLEP00000002921  STCQP...CPY-....................--......-----.........................----....
ENSNLEP00000008103  SSCQK...AALS....................QG......IDISSl........................CHNGgl..
ENSNLEP00000008104  SSCQK...AALS....................QG......IDISSl........................CHNGgl..
ENSNLEP00000014749  SVCAP...CHAS....................C-......-----.........................----....
ENSNLEP00000010168  -----...----....................--......-----.........................----....
ENSNLEP00000001003  STCPT...----....................--......-----.........................CVQGa...
ENSNLEP00000014272  -----...----....................--......-----.........................----....
ENSNLEP00000004064  -PQVA...CTGPpsaprnlsfs..........A-......----SgtqlslhweppadtggrqdvrynvrCSQCq...
ENSNLEP00000021941  RDCSD...ILLG....................CThq....HCLNHgi.......................CIPH....
ENSNLEP00000018144  NQCKE...CPPD....................TY......-----.........................-LSI....
ENSNLEP00000004631  VACKA...CPAG....................TF......KASQEaeg......................CSHCpsns
ENSNLEP00000015211  DICSV...SNGG....................--......-----.........................CHPDas..
ENSNLEP00000013004  LESED...CKLP....................CN......PCSTPs........................CTPCvpsp
ENSNLEP00000009392  DACQA...CSPG....................FF......KFEASesp......................CLECpeht
ENSNLEP00000017897  NACRC...----....................--......---GP.........................CFNNgv..
ENSNLEP00000000606  -----...----....................--......-----.........................----....
ENSNLEP00000019939  RKCHT...----....................--......-----.........................CQNGgt..
ENSNLEP00000016279  -----...----....................--......---SQdlq......................CSRCpphs
ENSNLEP00000018144  PPCTT...KDYFqihtpcdeegktqimykwiePK......ICREDltdairlppsgekkd..........CPPCnpg.
ENSNLEP00000021918  -----...----....................--......-----.........................----....
ENSNLEP00000005978  DECLL...LPG-....................--......----El........................CQHL....
ENSNLEP00000002921  -----...----....................--......-----.........................----....
ENSNLEP00000011025  -HIQS...----....................--......-----.........................CGKCpphs


                                                       130               140                        
                                                         |                 |                        
d2dtge6               ....YVIH.NN......KC...............IPE.....CP..SG.YTMNSSN..........LLCTP.......
ENSNLEP00000000606  ....FSLA.RG......SC...............IPD.....CE..PG.TYFDSEL..........VRCGE.......
ENSNLEP00000002426  ...fLFRS.KG......EC...............HRS.....CP..DH.YYVEQST..........QTCER.......
ENSNLEP00000002426  ....SLLL.NT......TC...............VKD.....CP..EG.YYADEDS..........HRCAR.......
ENSNLEP00000002426  ygreHFLY.QG......EC...............QDS.....CP..EG.HYAT-EG..........NTCLP.......
ENSNLEP00000010151  ....HVLL.DG......QC...............LSQ.....CP..DG.YFH--QE..........DSCTE.......
ENSNLEP00000002426  ....LSLQ.GS......RC...............SVS.....CE..DG.RYF--NG..........QDCQP.......
ENSNLEP00000010151  ....KTLR.QG......HC...............LPH.....CG..EG.FYS--DH..........GVCKA.......
ENSNLEP00000002426  .ghpLFLH.EG......RC...............YSK.....CP..EG.FYA--ED..........GICER.......
ENSNLEP00000002426  ....FFLL.GG......SC...............VRK.....CS..PG.FYGDQEL..........GECEP.......
ENSNLEP00000010151  ....FLLL.EA......QC...............VQE.....CG..KG.YFADHAK..........HKCTA.......
ENSNLEP00000010419  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000008878  ....CALA.EG......QScgvy...........TER.....CA..QG.L------..........-RC--.......
ENSNLEP00000010151  ....KVLL.FG......EC...............QYEs....CA..PQ.YYLDFST..........NTCKE.......
ENSNLEP00000010925  ....CLLA.PGk.....TH...............TCA.....CP..TN.FYLAADN..........RTCLSn......
ENSNLEP00000002317  ....C---.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000008780  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000001285  ....HYKD.PP......FC...............VAR.....CP..SG.VKPDLSYmpiwkfpdeeGTCQP.......
ENSNLEP00000021313  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000002426  ....VLHT.DD......SR...............CLH.....CC..NT.SDPP-SA..........QECCD.......
ENSNLEP00000017341  ....CLPS.GQ......NY...............TCA.....CP..TG.FRKI-SS..........HAC--.......
ENSNLEP00000001645  ....CHNT.EG......SY...............LCT.....CP..AG.YTLREDG..........AMCRDvde....
ENSNLEP00000019565  ....CINT.KG......SY...............ECV.....CP..PG.RRLHWNR..........KDCV-.......
ENSNLEP00000010419  ....YVVT.DHg.....SC...............VRA.....CG..AD.SYEMEEDgv........RKCKK.......
ENSNLEP00000021313  ....FVVD.QT......SC...............VRA.....CP..PD.KMEVDKNgl........KMCEP.......
ENSNLEP00000002401  ....CHNT.VG......SF...............LCT.....CR..PG.FRLRADR..........VSCE-.......
ENSNLEP00000005281  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000001645  ....CINT.EG......SY...............QCS.....CG..QG.YLLMPDG..........RACAD.......
ENSNLEP00000021306  ....CVNT.VG......SY...............ECQ.....CH..PG.YKLHWNK..........KDCV-.......
ENSNLEP00000010151  ....LLMQ.HG......QC...............VST.....CG..DG.FYQ--DR..........HSCAV.......
ENSNLEP00000008780  ....FVVD.SS......SC...............VRA.....CP..SS.KMEVEENgi........KMCKP.......
ENSNLEP00000008875  ....CYPH.PG......S-...............---.....--..--.-------..........-----.......
ENSNLEP00000004633  ....CINT.EE......SY...............YCR.....CR..RG.YTLDPNG..........KTCS-.......
ENSNLEP00000015039  ....CINN.EG......SF...............RCD.....CP..PG.LAVGMDG..........RVCV-.......
ENSNLEP00000021907  ....CFNA.IG......SF...............HCG.....CE..PG.YQL--KG..........RKCMD.......
ENSNLEP00000007349  ....CINT.VG......SF...............QCQ.....CN..EG.YEVAPDG..........RTCVD.......
ENSNLEP00000015130  ....CINL.PG......SY...............RCE.....CR..SG.YEFADDR..........HTCVLitppanp
ENSNLEP00000015039  ....CMNT.FG......SY...............ECT.....CP..IG.YALREDQ..........KMCKDlde....
ENSNLEP00000017005  ....CENT.PG......SF...............LCV.....CP..AG.YQAAPHG..........ASCQD.......
ENSNLEP00000001645  ....CHNT.PG......SF...............RCE.....CH..QG.FTLDSSG..........HGCEDvne....
ENSNLEP00000020776  ....CVNT.YG......SF...............ICR.....CD..PG.YELEEDG..........VHCSDmde....
ENSNLEP00000001645  ....CTNS.PG......SF...............QCL.....CP..PG.FVLSDNG..........HRCF-.......
ENSNLEP00000002426  ....FFLH.DD......MC...............HQS.....CP..RG.FYA--DS..........RHCVP.......
ENSNLEP00000007349  ....CTNS.EG......SY...............ECS.....CQ..PG.FALMPDQ..........RSCT-.......
ENSNLEP00000015039  ....CFNE.IG......SF...............KCL.....CN..EG.YELTPDG..........KNCI-.......
ENSNLEP00000019565  ....CINA.MG......SY...............ECQ.....CH..SG.FFLSDNQ..........HTCIH.......
ENSNLEP00000007349  ....CQNT.PG......SF...............TCE.....CQ..RG.FSLDQTG..........SSCED.......
ENSNLEP00000001645  ....CENT.KG......SF...............VCH.....CQ..LG.YMVRKGA..........TGC--.......
ENSNLEP00000017005  ....CENT.EG......SF...............QCV.....CP..MG.FQPNAAG..........SECED.......
ENSNLEP00000003819  ....CNNH.PG......TF...............RCE.....CV..EG.YQFS-DE..........GTCVAvvdqrpi
ENSNLEP00000015039  ....CRNN.LG......SF...............NCE.....CS..PG.SKLSSTG..........LICID.......
ENSNLEP00000010460  ....CINT.PG......SY...............QCT.....CP..AG.QGRL---..........-----.......
ENSNLEP00000014132  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000010925  ....CLAI.PG......GR...............VCA.....CA..DN.QLLDANG..........TTCT-.......
ENSNLEP00000000953  ....FVIH.DG......EC...............MQE.....CP..SG.FIRNGSQs.........MYCIP.......
ENSNLEP00000001285  ....LSTD.VG......SC...............TLV.....CP..LH.NQEVTAEdgt.......QRCEK.......
ENSNLEP00000005364  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000007349  ....CVNT.DG......SY...............RCE.....CF..PG.LAVGLDG..........RVCV-.......
ENSNLEP00000007349  ....CINT.DG......SF...............HCV.....CN..AG.FHVTRDG..........KNCED.......
ENSNLEP00000011454  ....CVNE.PG......KF...............SCM.....CP..QG.YQVV-RS..........RTCQ-.......
ENSNLEP00000001645  ....CQNL.KG......SY...............TCK.....CA..PG.SRLDPSG..........TICLD.......
ENSNLEP00000007349  ....CVNT.YG......SY...............ECK.....CP..VG.YVLREDR..........RMCKDede....
ENSNLEP00000003819  ....CLAT.PG......SR...............TCR.....CP..DN.T----LG..........VDC--.......
ENSNLEP00000017155  ....FYLH.LG......KC...............LDN.....CP..EG.LEANNHT..........MECVN.......
ENSNLEP00000015039  ....CQNT.PG......SF...............SCE.....CQ..RG.FSLDATG..........LNCEDvde....
ENSNLEP00000019359  ....CLNT.EG......SF...............HCV.....CQ..QG.FSISADG..........RTCEDide....
ENSNLEP00000001645  ....CVNT.KG......SF...............QCV.....CN..AG.FELSPDG..........KKCVD.......
ENSNLEP00000007349  ....CHNT.EG......SY...............RCE.....CP..PG.HQLSPNI..........SACIDine....
ENSNLEP00000007155  ....CVNE.PG......RF...............SCH.....CP..QG.YQLL-AT..........RLCQDide....
ENSNLEP00000015039  ....CVNT.EG......SF...............QCD.....CP..LG.HELSPSR..........EDCVD.......
ENSNLEP00000005810  ....CVLS.HRtdndglGF...............RCK.....CT..FG.FQLDTDE..........RRCT-.......
ENSNLEP00000001645  ....CLNT.AG......SF...............HCL.....CQ..DG.FELTADG..........KNCV-.......
ENSNLEP00000011444  ....FYLY.KG......KC...............LPT.....CP..PG.TLAHQNT..........RECQGecelgpw
ENSNLEP00000021306  ....CVNI.MG......SY...............ECC.....CK..EG.FFLSDNQ..........HTCIH.......
ENSNLEP00000001645  ....CTNT.EG......SF...............HCQ.....CL..GG.LAVGTDG..........RRCVD.......
ENSNLEP00000015039  ....CLNV.PG......AY...............RCE.....CE..MG.FTPASDS..........RSCQD.......
ENSNLEP00000015039  ....CENT.KG......SF...............ICH.....CQ..LG.YSVKKGT..........TGCTDvde....
ENSNLEP00000010925  ...lCLLN.PS......GA...............TCV.....CP..EG.KYL--IN..........GTCND.......
ENSNLEP00000020085  ....CKER.LG......TA...............WCS.....CR..EG.FMKASDG..........KTCL-.......
ENSNLEP00000007349  ....CENT.KG......SF...............ICH.....CD..MG.YSGKKGK..........TGCTDine....
ENSNLEP00000020669  ....CVVP.FG......VPasatvrrraqag...LCV.....CA..S-.-------..........-----.......
ENSNLEP00000021907  ....CFNM.RG......SY...............QCIdtp..CP..PN.YQRDPVS..........GFCLKn......
ENSNLEP00000010913  ....CVKS.RK......RRkgkagaaaggpgvsgVCV.....CK..SR.Y------..........-----.......
ENSNLEP00000007349  ....CVNT.PG......SY...............TCD.....CP..PD.FELNPTR..........VGCVDt......
ENSNLEP00000021510  ....----.--......--...............TPN.....CA..PG.LQ-----..........-----.......
ENSNLEP00000017624  ....CYNR.AS......DY...............FCK.....CP..ED.Y----EG..........KNCSH.......
ENSNLEP00000004973  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000012621  ....CVNS.PG......SY...............TCH.....CDgrGG.LKLSQDM..........DTCED.......
ENSNLEP00000000477  ....YVIH.NN......KC...............IPE.....CP..SG.YTMNSSN..........LLCTP.......
ENSNLEP00000000484  ....YVIH.NN......KC...............IPE.....CP..SG.YTMNSSN..........LLCTP.......
ENSNLEP00000010925  ....LINH.NR......SA...............ACA.....CP..HL.MKLSSDK..........KTCY-.......
ENSNLEP00000002105  ....CKNI.PG......GF...............ECE.....CP..EG.YRYNLKS..........KSCED.......
ENSNLEP00000005270  ....CENT.EG......GY...............RCI.....CA..EG.YKQ--ME..........GICV-.......
ENSNLEP00000011454  ....CVNT.PG......SF...............YCQ.....CS..PG.FQLAANN..........YTCVDine....
ENSNLEP00000019757  ....CTNT.EG......SY...............HCE.....CD..QG.YIMV-RK..........GHCQ-.......
ENSNLEP00000023356  ....CKNI.PG......GF...............ECE.....CP..EG.YRYNLKS..........KSCED.......
ENSNLEP00000005810  ....CLLS.SQgph...FY...............SCV.....CP..SG.WSLS---..........-----.......
ENSNLEP00000016448  ....CINI.PG......SF...............QCS.....CPs.SG.YRLAPNG..........RNCQD.......
ENSNLEP00000015087  ....CVNV.VG......NY...............LCV.....CP..AG.YRG--DG..........WHCEC.......
ENSNLEP00000018039  ....CR--.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000019913  ....CYNL.EG......DY...............YCA.....CP..DD.F----GG..........KNCSV.......
ENSNLEP00000021201  ....CVDE.LN......SY...............SCK.....CQ..PG.F----SG..........KRCE-.......
ENSNLEP00000004633  ....CVSS.ED......SF...............VCQ.....CF..EG.YILREDG..........KTC--.......
ENSNLEP00000006856  ....CENL.PG......SF...............RCT.....CA..QG.YAPAPDG..........RSCL-.......
ENSNLEP00000015740  ....CDPH.KG......LY...............C--.....--..--.-------..........-----.......
ENSNLEP00000000324  ....CHER.GH......RY...............VCE.....CA..QG.Y----GG..........PNCQ-.......
ENSNLEP00000001645  ....CLNA.PG......GY...............RCE.....CE..MG.FDPTEDH..........RACQD.......
ENSNLEP00000016448  ....CVNS.PG......SF...............RCE.....CK..TG.YYFDGIS..........RMCV-.......
ENSNLEP00000011548  ....CQSG.VD......SY...............YCH.....CP..FG.V----FG..........KHCE-.......
ENSNLEP00000007349  ....CSNT.EG......GY...............LCG.....CP..PG.YFRI-GQ..........GHCV-.......
ENSNLEP00000019359  ....CVNT.VG......AF...............RCEy....CD..SG.YRMT-QR..........GRCE-.......
ENSNLEP00000005978  ....CENT.LG......SY...............RCS.....CA..SG.FLLAADG..........KHCED.......
ENSNLEP00000010158  ....CVQR.VN......DF...............HCE.....CR..AG.H----TG..........RRCES.......
ENSNLEP00000005952  ....CDES.SG......LY...............CD-.....--..--.-------..........-----.......
ENSNLEP00000010165  ....CVQR.VN......DF...............HCE.....CR..AG.H----TG..........RRCES.......
ENSNLEP00000017005  ....CLNT.DG......SF...............ACT.....CA..PG.YRPGPRG..........ASCLD.......
ENSNLEP00000019757  ....CTNL.EG......SF...............RCS.....CE..RG.YEVTSDE..........KGCQ-.......
ENSNLEP00000006645  ....CING.VN......GF...............RCI.....CP..EG.P----HH..........PSCYS.......
ENSNLEP00000006645  ....CVDK.VN......RF...............QCL.....CP..PG.F----TG..........PVCQI.......
ENSNLEP00000001905  ....CVNT.PG......SY...............RCT.....CP..SG.YRTLADG..........KSCE-.......
ENSNLEP00000010165  ....CLDK.IN......EF...............QCE.....CP..TG.F----TG..........HLCQY.......
ENSNLEP00000015039  ....CSNT.EG......GY...............LCG.....CP..PG.YYRV-GQ..........GHCV-.......
ENSNLEP00000007050  ....--PH.RG......LY...............C--.....--..--.-------..........-----.......
ENSNLEP00000010158  ....CLDK.IN......EF...............QCE.....CP..TG.F----TG..........HLCQY.......
ENSNLEP00000015039  ....CSNT.VG......SY...............FCV.....CP..RG.YVTSTDG..........SRCID.......
ENSNLEP00000011158  ....CVNT.FG......SY...............YCK.....CH..IG.FEL----..........-----.......
ENSNLEP00000016459  ....CRDL.VN......GY...............ECV.....CL..AE.Y----KG..........THCEL.......
ENSNLEP00000001781  ....CYNT.PG......SY...............VCV.....CP..DG.FEE--TE..........DACV-.......
ENSNLEP00000019359  ....CKNT.EG......SF...............RCT.....CG..QG.YQLSAAK..........DQCED.......
ENSNLEP00000019757  ....CENS.PG......SY...............RCVlg...CQ..PG.FHMA-PN..........GDCID.......
ENSNLEP00000006856  ....CINF.PG......HY...............KCN.....CY..PG.YRLKA--..........-----.......
ENSNLEP00000005978  ....CVNT.LG......SF...............HCYkalt.CE..PG.YAL--KD..........GEC--.......
ENSNLEP00000010460  ....----.--......--...............---.....-S..PG.HYYNTSI..........HRCIR.......
ENSNLEP00000001350  ....CQPS.N-......--...............---.....--..--.-------..........-----.......
ENSNLEP00000017678  ....LFC-.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000010158  ....CINT.LG......SF...............ECQ.....CL..QG.Y----TG..........PRCEI.......
ENSNLEP00000015550  ....FGIH.QG......SC...............LAQ.....CP..SG.FTRNSSS..........IFCHK.......
ENSNLEP00000004633  ....CVNV.PG......SF...............VCQ.....CY..SG.YALAEDG..........KRCVAvdy....
ENSNLEP00000006645  ....CHNT.QG......SY...............MCE.....CP..PG.F----SG..........MDCEE.......
ENSNLEP00000002755  ....CVSDgVA......SY...............HCD.....CY..PG.YTLNEDK..........KTCS-.......
ENSNLEP00000006645  ....CVDR.IG......GY...............SCH.....CL..PG.F----AG..........ERCEG.......
ENSNLEP00000004222  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000010165  ....CRDS.LN......GY...............KCN.....CD..PG.W----SG..........TNCDI.......
ENSNLEP00000006645  ....CINA.GN......TH...............YCQ.....CP..LG.Y----TG..........SYCEE.......
ENSNLEP00000010165  ....CTDC.VD......SY...............TCT.....CP..AG.F----SG..........IHCEN.......
ENSNLEP00000008073  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000010158  ....CRDS.LN......GY...............KCN.....CD..PG.W----SG..........TNCDI.......
ENSNLEP00000010158  ....CTDC.VD......SY...............TCT.....CP..AG.F----SG..........IHCEN.......
ENSNLEP00000004148  ....TDLS.TD......TF...............VCN.....CP..YG.F----VG..........SRC--.......
ENSNLEP00000019913  ....CVDE.IN......GY...............RCS.....CP..PG.R----AG..........PRCQ-.......
ENSNLEP00000014468  ....LECV.RG......LC...............RCR.....--..--.-------..........-----.......
ENSNLEP00000005978  ....CHNI.QG......SF...............RCLrfe..CP..PN.YVQV-SK..........TKCERtt.....
ENSNLEP00000001645  ....CMDT.EG......SY...............MCL.....CH..RG.FQASADQ..........TLCM-.......
ENSNLEP00000002003  ....----.--......--...............--S.....CP..PP.STLDQQQ..........GSCV-.......
ENSNLEP00000008103  ....CQDQ.PG......AF...............HCK.....CL..PG.F----EG..........PRCQT.......
ENSNLEP00000008104  ....CQDQ.PG......AF...............HCK.....CL..PG.F----EG..........PRCQT.......
ENSNLEP00000021658  ....CVNL.PG......WY...............HCE.....CR..SG.FH-----..........-----.......
ENSNLEP00000015039  ....CVNI.IG......SY...............RCE.....CN..EG.FQSSSSG..........TECL-.......
ENSNLEP00000014046  ....CVNT.PG......GF...............RCE.....CW..VG.YEPGG--..........-----.......
ENSNLEP00000001645  ....CANT.PG......GF...............LCG.....CP..QG.YFRA-GR..........GHCV-.......
ENSNLEP00000008103  ....CHSL.AN......AF...............YCQ.....CL..PG.Y----TG..........QWCEV.......
ENSNLEP00000008104  ....CHSL.AN......AF...............YCQ.....CL..PG.Y----TG..........QWCEV.......
ENSNLEP00000023327  ....CDVV.KG......QI...............RCQ.....CPs.PG.LQLAPDG..........RTCVDvde....
ENSNLEP00000006645  ....CVNT.DG......AF...............HCE.....CL..KG.Y----AG..........PRCEM.......
ENSNLEP00000019757  ....CLNS.HG......SF...............FCL.....CA..PG.FVSAEGG..........TSCQD.......
ENSNLEP00000007155  ....CHNL.PG......SY...............QCT.....CP..DG.YRK--IG..........PECVD.......
ENSNLEP00000019565  ....CRNT.VG......SF...............ECG.....CR..KG.YKLLTDE..........RTCQ-.......
ENSNLEP00000023327  ....CYNI.HG......SY...............KCK.....CK..EG.YQG--DG..........LTCV-.......
ENSNLEP00000015898  ....CYNI.HG......SY...............KCK.....CK..EG.YQG--DG..........LTCV-.......
ENSNLEP00000015039  ....CVNT.PG......SY...............YCK.....CH..AG.FQRTPTK..........QACIDide....
ENSNLEP00000010165  ....CWQT.HT......QY...............RCE.....CP..SG.W----TG..........LYCDV.......
ENSNLEP00000015155  ....CVNL.EG......GY...............KCQ.....CE..EG.FQLDPHS..........KACK-.......
ENSNLEP00000021778  ....CINL.PG......WY...............HCE.....CR..DG.Y------..........-----.......
ENSNLEP00000016448  ....CQNT.LG......SF...............RCRpklq.CK..SG.FIQD-AL..........GNC--.......
ENSNLEP00000017005  ....CLNT.DG......SF...............RCI.....CR..PG.FAPTHQP..........HHCA-.......
ENSNLEP00000019565  ....HYNT.TT......HH...............CIR.....CP..IG.TYQPEFGq.........NHCIT.......
ENSNLEP00000017005  ....CENV.EG......SF...............LCV.....CP..NSpEEFDPMT..........GRCV-.......
ENSNLEP00000010158  ....CWQT.HT......QY...............RCE.....CP..SG.W----TG..........LYCDV.......
ENSNLEP00000010591  ....FNDH.SP......KY...............TCS.....CP..NG.YNLEENG..........RDCQ-.......
ENSNLEP00000005968  ....CVDT.IN......GY...............TCT.....CP..QG.F----SG..........PFCE-.......
ENSNLEP00000008103  ....CLNT.PG......SF...............NCL.....CP..PG.Y----TG..........SRCEA.......
ENSNLEP00000008104  ....CLNT.PG......SF...............NCL.....CP..PG.Y----TG..........SRCEA.......
ENSNLEP00000003215  ....CVNQ.WD......AF...............SCE.....CP..LG.F----GG..........KSCA-.......
ENSNLEP00000005978  ....CINT.VG......SY...............TCQrnpliCA..RG.YHASDDG..........AKCVDvne....
ENSNLEP00000014067  ....CENT.HG......SY...............HCN.....CS..HE.Y----RG..........RHCED.......
ENSNLEP00000020776  ....CINT.EG......GY...............TCS.....CT..DG.YWL--LE..........GQCL-.......
ENSNLEP00000019757  ....CENT.EG......SY...............RCH.....CS..PG.YVAEAGP..........PHC--.......
ENSNLEP00000009644  ....AGWI.GD......RC...............ETK.....CS..NG.TYGEDCA..........FVCAD.......
ENSNLEP00000019359  ....CINT.DG......SY...............KCL.....CL..PG.YVPSDKP..........NYCTP.......
ENSNLEP00000016629  ....CVDQ.GN......RP...............VCQ.....CL..PG.F----GG..........PECE-.......
ENSNLEP00000000509  ....CTNT.PG......SY...............FCT.....CH..PG.F------..........-----.......
ENSNLEP00000010596  ....FNDH.SP......KY...............TCS.....CP..NG.YNLEENG..........RDCQ-.......
ENSNLEP00000003589  ....PTFV.NT......SR...............SCA.....CS..EP.NIL--TG..........GLC--.......
ENSNLEP00000023948  ....QENS.KG......NH...............CEE.....CK..EG.FYQSPDAt.........KECLR.......
ENSNLEP00000020675  ....QENS.KG......NH...............CEE.....CK..EG.FYQSPDAt.........KECLR.......
ENSNLEP00000021306  ....FYNT.TT......HR...............CIR.....CP..VG.TYQPEFGk.........NNCVS.......
ENSNLEP00000010712  ....QELT.KK......GC...............K-D.....CC..FG.TFNDQKR..........GVCRP.......
ENSNLEP00000002921  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000008103  ....CVDS.GP......SY...............FCR.....CP..PG.F----QG..........SLCQD.......
ENSNLEP00000008104  ....CVDS.GP......SY...............FCR.....CP..PG.F----QG..........SLCQD.......
ENSNLEP00000014749  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000010168  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000001003  ....CDAV.TG......EC...............--V.....CS..AG.YWGPS--..........-----.......
ENSNLEP00000014272  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000004064  ....GTAQ.--......--...............---.....--..--.-----DG..........GPCQP.......
ENSNLEP00000021941  ....FQDG.QH......GF...............SCL.....CP..SG.Y----TG..........SLCE-.......
ENSNLEP00000018144  ....HQVY.GK......EA...............CIP.....CG..PG.SKNNQDH..........SVCYS.......
ENSNLEP00000004631  ....RSPA.EA......SP...............ICT.....CR..TG.YYRAD--..........-----.......
ENSNLEP00000015211  ....CSST.LGs.....LP...............LCT.....CL..PG.YTGNGYGp.........NGCVQ.......
ENSNLEP00000013004  ....CV--.--......-P...............RTI.....CV..PR.T----VG..........VPCSP.......
ENSNLEP00000009392  ....LPSP.EG......AT...............SCE.....CE..EG.FFRAPQD..........-----.......
ENSNLEP00000017897  ....PILK.GT......SC...............RCQ.....CR..LG.R----LG..........PACE-.......
ENSNLEP00000000606  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000019939  ....VILM.DG......KC...............LCA.....CP..FK.F----EG..........IAC--.......
ENSNLEP00000016279  ....FSDK.EG......SS...............RCE.....CE..DG.YYRA---..........-----.......
ENSNLEP00000018144  ....FYNN.GS......SS...............CHP.....CP..PG.TFSD-GT..........KECRP.......
ENSNLEP00000021918  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000005978  ....CINT.VG......SY...............HCA.....CF..PG.FSLQDDG..........RTCRP.......
ENSNLEP00000002921  ....----.--......--...............---.....--..--.-------..........-----.......
ENSNLEP00000011025  ....YTHE.EA......ST...............SCV.....CE..KD.YFRRESD..........-----.......


                           150                                                                      
                             |                                                                      
d2dtge6               .....CLGPC---pkv..............................................................
ENSNLEP00000000606  .....CHHTCGTC.................................................................
ENSNLEP00000002426  .....CHPTC---.................................................................
ENSNLEP00000002426  .....CHSSCRTCeg...............................................................
ENSNLEP00000002426  .....CPDNCELCh................................................................
ENSNLEP00000010151  .....CHPTC---.................................................................
ENSNLEP00000002426  .....CHRFCATCa................................................................
ENSNLEP00000010151  .....CHSSCLACmg...............................................................
ENSNLEP00000002426  .....CSSPCRTCeg...............................................................
ENSNLEP00000002426  .....CHQACETCtg...............................................................
ENSNLEP00000010151  .....CPRGCLHCs................................................................
ENSNLEP00000010419  .....--------glegc............................................................
ENSNLEP00000008878  .....--------lprqdeekplhallhgrgvclneksy.......................................
ENSNLEP00000010151  .....CDWSC---.................................................................
ENSNLEP00000010925  .....CTASQFRC.................................................................
ENSNLEP00000002317  .....--------ypprgvekplhtlmhgqgvcmela.........................................
ENSNLEP00000008780  .....--------tshdc............................................................
ENSNLEP00000001285  .....CPINCT--hscvdlddkgc......................................................
ENSNLEP00000021313  .....----CT--qgckgpelqdc......................................................
ENSNLEP00000002426  .....CQDTT---dec..............................................................
ENSNLEP00000017341  .....--------a................................................................
ENSNLEP00000001645  .....CADGQQDC.................................................................
ENSNLEP00000019565  .....--------etgkc............................................................
ENSNLEP00000010419  .....CEGPC---rkvcng...........................................................
ENSNLEP00000021313  .....CGGLC---pkace............................................................
ENSNLEP00000002401  .....--------a................................................................
ENSNLEP00000005281  .....--------gvatarcarglscralpgeqqplqaltrgqgacvresda..........................
ENSNLEP00000001645  .....--------vdec.............................................................
ENSNLEP00000021306  .....--------.................................................................
ENSNLEP00000010151  .....CHESCAGCwgp..............................................................
ENSNLEP00000008780  .....CTDIC---p................................................................
ENSNLEP00000008875  .....--------elplqalvmgegtcekrrd..............................................
ENSNLEP00000004633  .....--------r................................................................
ENSNLEP00000015039  .....--------d................................................................
ENSNLEP00000021907  .....--------vnecrq...........................................................
ENSNLEP00000007349  .....--------inec.............................................................
ENSNLEP00000015130  .....CEDGSHTC.................................................................
ENSNLEP00000015039  .....CAEGLHDC.................................................................
ENSNLEP00000017005  .....--------.................................................................
ENSNLEP00000001645  .....C-------dg...............................................................
ENSNLEP00000020776  .....CSFSEFLC.................................................................
ENSNLEP00000001645  .....--------d................................................................
ENSNLEP00000002426  .....CHKDCLECsgp..............................................................
ENSNLEP00000007349  .....--------.................................................................
ENSNLEP00000015039  .....--------d................................................................
ENSNLEP00000019565  .....RSNEGMNC.................................................................
ENSNLEP00000007349  .....V-------dec..............................................................
ENSNLEP00000001645  .....--------sd...............................................................
ENSNLEP00000017005  .....V-------dec..............................................................
ENSNLEP00000003819  ...nyCETGLHNC.................................................................
ENSNLEP00000015039  .....--------slkgtc...........................................................
ENSNLEP00000010460  .....--------hwngkdct.........................................................
ENSNLEP00000014132  .....--------ecs..............................................................
ENSNLEP00000010925  .....--------f................................................................
ENSNLEP00000000953  .....CEGPC---.................................................................
ENSNLEP00000001285  .....CSKPCA--rvcy.............................................................
ENSNLEP00000005364  .....--------qpspdearplqalldgrglcvnasa........................................
ENSNLEP00000007349  .....--------d................................................................
ENSNLEP00000007349  .....--------m................................................................
ENSNLEP00000011454  .....--------d................................................................
ENSNLEP00000001645  .....--------st...............................................................
ENSNLEP00000007349  .....CEEGKHDC.................................................................
ENSNLEP00000003819  .....--------i................................................................
ENSNLEP00000017155  .....--------ivhcevs..........................................................
ENSNLEP00000015039  .....CDG-----n................................................................
ENSNLEP00000019359  .....CV------nn...............................................................
ENSNLEP00000001645  .....--------hnec.............................................................
ENSNLEP00000007349  .....CELSAHLC.................................................................
ENSNLEP00000007155  .....CESGAHQC.................................................................
ENSNLEP00000015039  .....--------inec.............................................................
ENSNLEP00000005810  .....--------a................................................................
ENSNLEP00000001645  .....--------d................................................................
ENSNLEP00000011444  ggwspCTH-----ngktc............................................................
ENSNLEP00000021306  .....RSEEGLSC.................................................................
ENSNLEP00000001645  .....--------thv..............................................................
ENSNLEP00000015039  .....I-------dec..............................................................
ENSNLEP00000015039  .....CEIGAHNC.................................................................
ENSNLEP00000010925  .....--------dsllddsc.........................................................
ENSNLEP00000020085  .....--------ald..............................................................
ENSNLEP00000007349  .....CEIGAHNC.................................................................
ENSNLEP00000020669  .....--------sepvcgsd.........................................................
ENSNLEP00000021907  .....CPPNDLEC.................................................................
ENSNLEP00000010913  .....--------pvcgsdg..........................................................
ENSNLEP00000007349  .....RSGNC---.................................................................
ENSNLEP00000021510  .....--------chppeddeaplralllgrgrclpa.........................................
ENSNLEP00000017624  .....LKDH----c................................................................
ENSNLEP00000004973  .....--------wgtcsrnn.........................................................
ENSNLEP00000012621  .....--------ilpc.............................................................
ENSNLEP00000000477  .....CLGPC---.................................................................
ENSNLEP00000000484  .....CLGPC---.................................................................
ENSNLEP00000010925  .....--------.................................................................
ENSNLEP00000002105  .....I-------decs.............................................................
ENSNLEP00000005270  .....--------k................................................................
ENSNLEP00000011454  .....C-------d................................................................
ENSNLEP00000019757  .....--------d................................................................
ENSNLEP00000023356  .....I-------decs.............................................................
ENSNLEP00000005810  .....--------pdll.............................................................
ENSNLEP00000016448  .....I-------decv.............................................................
ENSNLEP00000015087  .....SPGSC---.................................................................
ENSNLEP00000018039  .....--------ldtggdlsrgevpeplcacrsqsplcgsdg...................................
ENSNLEP00000019913  .....PREP----c................................................................
ENSNLEP00000021201  .....--------t................................................................
ENSNLEP00000004633  .....--------r................................................................
ENSNLEP00000006856  .....--------d................................................................
ENSNLEP00000015740  .....--------dysvdrpryetgvcayl................................................
ENSNLEP00000000324  .....--------f................................................................
ENSNLEP00000001645  .....V-------dec..............................................................
ENSNLEP00000016448  .....--------d................................................................
ENSNLEP00000011548  .....--------l................................................................
ENSNLEP00000007349  .....--------.................................................................
ENSNLEP00000019359  .....--------d................................................................
ENSNLEP00000005978  .....--------vnec.............................................................
ENSNLEP00000010158  .....VINGC---k................................................................
ENSNLEP00000005952  .....--------rsadpsnqtgicmavegdncvfdg.........................................
ENSNLEP00000010165  .....VINGC---k................................................................
ENSNLEP00000017005  .....--------vdec.............................................................
ENSNLEP00000019757  .....--------.................................................................
ENSNLEP00000006645  .....QVNEC---l................................................................
ENSNLEP00000006645  .....DIDDC---.................................................................
ENSNLEP00000001905  .....--------d................................................................
ENSNLEP00000010165  .....DVDEC---.................................................................
ENSNLEP00000015039  .....--------.................................................................
ENSNLEP00000007050  .....--------dysgdrpryaigvcara................................................
ENSNLEP00000010158  .....DVDEC---.................................................................
ENSNLEP00000015039  .....--------qrtgmcf..........................................................
ENSNLEP00000011158  .....--------q................................................................
ENSNLEP00000016459  .....YKDPC---a................................................................
ENSNLEP00000001781  .....--------p................................................................
ENSNLEP00000019359  .....--------id...............................................................
ENSNLEP00000019757  .....I-------dec..............................................................
ENSNLEP00000006856  .....--------srppvce..........................................................
ENSNLEP00000005978  .....--------.................................................................
ENSNLEP00000010460  .....CA------mgsyqpdfrqnfctrcpg...............................................
ENSNLEP00000001350  .....--------gedpfgeefgickd...................................................
ENSNLEP00000017678  .....--------dfgspanrkigvctakdgapcifg.........................................
ENSNLEP00000010158  .....DVNEC---v................................................................
ENSNLEP00000015550  .....CEGLC---pkec.............................................................
ENSNLEP00000004633  .....C-------asenhg...........................................................
ENSNLEP00000006645  .....DIDDC---.................................................................
ENSNLEP00000002755  .....--------a................................................................
ENSNLEP00000006645  .....DINE----c................................................................
ENSNLEP00000004222  .....--------raagaapegtglcvcaqrgtvcgsdg.......................................
ENSNLEP00000010165  .....NNNEC---.................................................................
ENSNLEP00000006645  .....QLDEC---.................................................................
ENSNLEP00000010165  .....NTPDC---.................................................................
ENSNLEP00000008073  .....--------pgagpggrgalcllaeddgscevn.........................................
ENSNLEP00000010158  .....NNNEC---.................................................................
ENSNLEP00000010158  .....NTPDC---.................................................................
ENSNLEP00000004148  .....--------e................................................................
ENSNLEP00000019913  .....--------e................................................................
ENSNLEP00000014468  .....--------wthavcgtdg.......................................................
ENSNLEP00000005978  .....CH------d................................................................
ENSNLEP00000001645  .....--------.................................................................
ENSNLEP00000002003  .....--------gp...............................................................
ENSNLEP00000008103  .....EVDEC---l................................................................
ENSNLEP00000008104  .....EVDEC---l................................................................
ENSNLEP00000021658  .....--------dd...............................................................
ENSNLEP00000015039  .....--------d................................................................
ENSNLEP00000014046  .....--------pgertc...........................................................
ENSNLEP00000001645  .....--------s................................................................
ENSNLEP00000008103  .....EIDPC---h................................................................
ENSNLEP00000008104  .....EIDPC---h................................................................
ENSNLEP00000023327  .....CATGRASC.................................................................
ENSNLEP00000006645  .....DINEC---.................................................................
ENSNLEP00000019757  .....--------vd...............................................................
ENSNLEP00000007155  .....--------i................................................................
ENSNLEP00000019565  .....--------.................................................................
ENSNLEP00000023327  .....--------y................................................................
ENSNLEP00000015898  .....--------y................................................................
ENSNLEP00000015039  .....CIQNGVLC.................................................................
ENSNLEP00000010165  .....PS------vsc..............................................................
ENSNLEP00000015155  .....--------.................................................................
ENSNLEP00000021778  .....--------hd...............................................................
ENSNLEP00000016448  .....--------i................................................................
ENSNLEP00000017005  .....--------p................................................................
ENSNLEP00000019565  .....CPGNT---stdfdgstnvthcknqhcg..............................................
ENSNLEP00000017005  .....--------p................................................................
ENSNLEP00000010158  .....P-------svsc.............................................................
ENSNLEP00000010591  .....--------s................................................................
ENSNLEP00000005968  .....--------h................................................................
ENSNLEP00000008103  .....DHNEC---l................................................................
ENSNLEP00000008104  .....DHNEC---l................................................................
ENSNLEP00000003215  .....--------q................................................................
ENSNLEP00000005978  .....CETGVHRC.................................................................
ENSNLEP00000014067  .....--------aap..............................................................
ENSNLEP00000020776  .....--------d................................................................
ENSNLEP00000019757  .....--------t................................................................
ENSNLEP00000009644  .....CGS-----g................................................................
ENSNLEP00000019359  .....--------.................................................................
ENSNLEP00000016629  .....--------k................................................................
ENSNLEP00000000509  .....--------ap...............................................................
ENSNLEP00000010596  .....--------r................................................................
ENSNLEP00000003589  .....--------.................................................................
ENSNLEP00000023948  .....CP------c................................................................
ENSNLEP00000020675  .....CP------c................................................................
ENSNLEP00000021306  .....CPGNT---ttdfdgstnitqckn..................................................
ENSNLEP00000010712  .....--------wtnc.............................................................
ENSNLEP00000002921  .....--------g................................................................
ENSNLEP00000008103  .....PVNPC---.................................................................
ENSNLEP00000008104  .....PVNPC---.................................................................
ENSNLEP00000014749  .....--------a................................................................
ENSNLEP00000010168  .....--------ttipsapqavissvnetslmlewtpprdsggredlvyniickscgsgrgactrcgdnvqya....
ENSNLEP00000001003  .....--------ahkspcpspaclpnftqpsacl...........................................
ENSNLEP00000014272  .....--------psmactrppssprnvisninetsvildwswpldtggrkdvtfniickkcgwnikqcepcspn...
ENSNLEP00000004064  .....C-------gvgvhf...........................................................
ENSNLEP00000021941  .....--------.................................................................
ENSNLEP00000018144  .....--------dcf..............................................................
ENSNLEP00000004631  .....--------fdppevactsvpsgprnvisivnetsiilewhppretggrddvtyniickkcradrrscsrcddn
ENSNLEP00000015211  .....LSNTC---.................................................................
ENSNLEP00000013004  .....CPQ-----g................................................................
ENSNLEP00000009392  .....--------pvsmpctrppsaphyltavgmgakvelrwtppqdsggredivysvtceqcwpesgecgpcea...
ENSNLEP00000017897  .....--------q................................................................
ENSNLEP00000000606  .....--------pe...............................................................
ENSNLEP00000019939  .....--------e................................................................
ENSNLEP00000016279  .....--------psd..............................................................
ENSNLEP00000018144  .....CPA-----g................................................................
ENSNLEP00000021918  .....--------p................................................................
ENSNLEP00000005978  .....--------.................................................................
ENSNLEP00000002921  .....--------t................................................................
ENSNLEP00000011025  .....--------pptmactrppsaprnaisnvnetsvflewippadtggrkdvsyyiackkcns.............


                          
                          
d2dtge6               ....
ENSNLEP00000000606  ....
ENSNLEP00000002426  ....
ENSNLEP00000002426  ....
ENSNLEP00000002426  ....
ENSNLEP00000010151  ....
ENSNLEP00000002426  ....
ENSNLEP00000010151  ....
ENSNLEP00000002426  ....
ENSNLEP00000002426  ....
ENSNLEP00000010151  ....
ENSNLEP00000010419  ....
ENSNLEP00000008878  ....
ENSNLEP00000010151  ....
ENSNLEP00000010925  ....
ENSNLEP00000002317  ....
ENSNLEP00000008780  ....
ENSNLEP00000001285  ....
ENSNLEP00000021313  ....
ENSNLEP00000002426  ....
ENSNLEP00000017341  ....
ENSNLEP00000001645  ....
ENSNLEP00000019565  ....
ENSNLEP00000010419  ....
ENSNLEP00000021313  ....
ENSNLEP00000002401  ....
ENSNLEP00000005281  ....
ENSNLEP00000001645  ....
ENSNLEP00000021306  ....
ENSNLEP00000010151  ....
ENSNLEP00000008780  ....
ENSNLEP00000008875  ....
ENSNLEP00000004633  ....
ENSNLEP00000015039  ....
ENSNLEP00000021907  ....
ENSNLEP00000007349  ....
ENSNLEP00000015130  ....
ENSNLEP00000015039  ....
ENSNLEP00000017005  ....
ENSNLEP00000001645  ....
ENSNLEP00000020776  ....
ENSNLEP00000001645  ....
ENSNLEP00000002426  ....
ENSNLEP00000007349  ....
ENSNLEP00000015039  ....
ENSNLEP00000019565  ....
ENSNLEP00000007349  ....
ENSNLEP00000001645  ....
ENSNLEP00000017005  ....
ENSNLEP00000003819  ....
ENSNLEP00000015039  ....
ENSNLEP00000010460  ....
ENSNLEP00000014132  ....
ENSNLEP00000010925  ....
ENSNLEP00000000953  ....
ENSNLEP00000001285  ....
ENSNLEP00000005364  ....
ENSNLEP00000007349  ....
ENSNLEP00000007349  ....
ENSNLEP00000011454  ....
ENSNLEP00000001645  ....
ENSNLEP00000007349  ....
ENSNLEP00000003819  ....
ENSNLEP00000017155  ....
ENSNLEP00000015039  ....
ENSNLEP00000019359  ....
ENSNLEP00000001645  ....
ENSNLEP00000007349  ....
ENSNLEP00000007155  ....
ENSNLEP00000015039  ....
ENSNLEP00000005810  ....
ENSNLEP00000001645  ....
ENSNLEP00000011444  ....
ENSNLEP00000021306  ....
ENSNLEP00000001645  ....
ENSNLEP00000015039  ....
ENSNLEP00000015039  ....
ENSNLEP00000010925  ....
ENSNLEP00000020085  ....
ENSNLEP00000007349  ....
ENSNLEP00000020669  ....
ENSNLEP00000021907  ....
ENSNLEP00000010913  ....
ENSNLEP00000007349  ....
ENSNLEP00000021510  ....
ENSNLEP00000017624  ....
ENSNLEP00000004973  ....
ENSNLEP00000012621  ....
ENSNLEP00000000477  ....
ENSNLEP00000000484  ....
ENSNLEP00000010925  ....
ENSNLEP00000002105  ....
ENSNLEP00000005270  ....
ENSNLEP00000011454  ....
ENSNLEP00000019757  ....
ENSNLEP00000023356  ....
ENSNLEP00000005810  ....
ENSNLEP00000016448  ....
ENSNLEP00000015087  ....
ENSNLEP00000018039  ....
ENSNLEP00000019913  ....
ENSNLEP00000021201  ....
ENSNLEP00000004633  ....
ENSNLEP00000006856  ....
ENSNLEP00000015740  ....
ENSNLEP00000000324  ....
ENSNLEP00000001645  ....
ENSNLEP00000016448  ....
ENSNLEP00000011548  ....
ENSNLEP00000007349  ....
ENSNLEP00000019359  ....
ENSNLEP00000005978  ....
ENSNLEP00000010158  ....
ENSNLEP00000005952  ....
ENSNLEP00000010165  ....
ENSNLEP00000017005  ....
ENSNLEP00000019757  ....
ENSNLEP00000006645  ....
ENSNLEP00000006645  ....
ENSNLEP00000001905  ....
ENSNLEP00000010165  ....
ENSNLEP00000015039  ....
ENSNLEP00000007050  ....
ENSNLEP00000010158  ....
ENSNLEP00000015039  ....
ENSNLEP00000011158  ....
ENSNLEP00000016459  ....
ENSNLEP00000001781  ....
ENSNLEP00000019359  ....
ENSNLEP00000019757  ....
ENSNLEP00000006856  ....
ENSNLEP00000005978  ....
ENSNLEP00000010460  ....
ENSNLEP00000001350  ....
ENSNLEP00000017678  ....
ENSNLEP00000010158  ....
ENSNLEP00000015550  ....
ENSNLEP00000004633  ....
ENSNLEP00000006645  ....
ENSNLEP00000002755  ....
ENSNLEP00000006645  ....
ENSNLEP00000004222  ....
ENSNLEP00000010165  ....
ENSNLEP00000006645  ....
ENSNLEP00000010165  ....
ENSNLEP00000008073  ....
ENSNLEP00000010158  ....
ENSNLEP00000010158  ....
ENSNLEP00000004148  ....
ENSNLEP00000019913  ....
ENSNLEP00000014468  ....
ENSNLEP00000005978  ....
ENSNLEP00000001645  ....
ENSNLEP00000002003  ....
ENSNLEP00000008103  ....
ENSNLEP00000008104  ....
ENSNLEP00000021658  ....
ENSNLEP00000015039  ....
ENSNLEP00000014046  ....
ENSNLEP00000001645  ....
ENSNLEP00000008103  ....
ENSNLEP00000008104  ....
ENSNLEP00000023327  ....
ENSNLEP00000006645  ....
ENSNLEP00000019757  ....
ENSNLEP00000007155  ....
ENSNLEP00000019565  ....
ENSNLEP00000023327  ....
ENSNLEP00000015898  ....
ENSNLEP00000015039  ....
ENSNLEP00000010165  ....
ENSNLEP00000015155  ....
ENSNLEP00000021778  ....
ENSNLEP00000016448  ....
ENSNLEP00000017005  ....
ENSNLEP00000019565  ....
ENSNLEP00000017005  ....
ENSNLEP00000010158  ....
ENSNLEP00000010591  ....
ENSNLEP00000005968  ....
ENSNLEP00000008103  ....
ENSNLEP00000008104  ....
ENSNLEP00000003215  ....
ENSNLEP00000005978  ....
ENSNLEP00000014067  ....
ENSNLEP00000020776  ....
ENSNLEP00000019757  ....
ENSNLEP00000009644  ....
ENSNLEP00000019359  ....
ENSNLEP00000016629  ....
ENSNLEP00000000509  ....
ENSNLEP00000010596  ....
ENSNLEP00000003589  ....
ENSNLEP00000023948  ....
ENSNLEP00000020675  ....
ENSNLEP00000021306  ....
ENSNLEP00000010712  ....
ENSNLEP00000002921  ....
ENSNLEP00000008103  ....
ENSNLEP00000008104  ....
ENSNLEP00000014749  ....
ENSNLEP00000010168  ....
ENSNLEP00000001003  ....
ENSNLEP00000014272  ....
ENSNLEP00000004064  ....
ENSNLEP00000021941  ....
ENSNLEP00000018144  ....
ENSNLEP00000004631  vefv
ENSNLEP00000015211  ....
ENSNLEP00000013004  ....
ENSNLEP00000009392  ....
ENSNLEP00000017897  ....
ENSNLEP00000000606  ....
ENSNLEP00000019939  ....
ENSNLEP00000016279  ....
ENSNLEP00000018144  ....
ENSNLEP00000021918  ....
ENSNLEP00000005978  ....
ENSNLEP00000002921  ....
ENSNLEP00000011025  ....


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053854 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Chaetomium globosum CBS 148.51
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Candida albicans SC5314
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Glycine max v109 - Soybean
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus elongatus PCC 7942
NoYes   Ilumatobacter coccineus
NoYes   Filifactor alocis ATCC 35896
NoYes   Runella slithyformis DSM 19594
NoYes   Treponema succinifaciens DSM 2489
NoYes   Desulfurispirillum indicum S5
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Hahella chejuensis KCTC 2396
NoYes   Allochromatium vinosum DSM 180
NoYes   gamma proteobacterium HdN1
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Methanospirillum hungatei JF-1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Coccidioides posadasii str. Silveira
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Synechococcus elongatus PCC 6301
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica OS117
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes